F396628

General Info

Members Datasets Scaffolds Average Seq Length
302 199 604 143

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0005919|Ga0451577_0005919_4661_5155
Length 164
Sequence VRRTTAPDLEEIDMRVMVIVKASKESEAGKMPDQKILEDMGRFNDELVKAGVMLAGEGLHPSARGKRVRFAGSKRTVIDGPFADSSGNPKELIAGFWLWQVKSMEEALEWARRCPNPMPDAPESEIEIRPVFEAEDFGAEFTPELREQEERQRAAIEARQKAGV

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
176 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
177 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0
Rhizoplane 0.33
Rhizosphere 97.02
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0005919 3300042876 Bacteria 12338
2 rootL2_10329609 3300003322 Bacteria 2047
3 Ga0065704_10698246 3300005289 Bacteria 562
4 Ga0065715_10002055 3300005293 Bacteria 5461
5 Ga0065707_10270674 3300005295 Bacteria 1072
6 Ga0070683_100035230 3300005329 Bacteria 4575
7 Ga0070670_100045769 3300005331 Bacteria 3762
8 Ga0070680_100004858 3300005336 Bacteria 10118
9 Ga0070680_100010484 3300005336 Bacteria 7147
10 Ga0070680_100030997 3300005336 Bacteria 4297
11 Ga0070661_100021300 3300005344 Bacteria 4629
12 Ga0070661_101586584 3300005344 Bacteria 553
13 Ga0070668_100148910 3300005347 Bacteria 1891
14 Ga0070669_100855121 3300005353 Bacteria 775
15 Ga0070669_100899639 3300005353 Bacteria 756
16 Ga0070675_100443114 3300005354 Bacteria 1164
17 Ga0070673_100009100 3300005364 Bacteria 6649
18 Ga0070659_100002214 3300005366 Bacteria 13819
19 Ga0070703_10000383 3300005406 Bacteria 18757
20 Ga0070709_10002128 3300005434 Bacteria 10720
21 Ga0070709_10177230 3300005434 Bacteria 1494
22 Ga0070714_100037794 3300005435 Bacteria 4058
23 Ga0070714_100406874 3300005435 Bacteria 1287
24 Ga0070713_100000731 3300005436 Bacteria 21093
25 Ga0070711_100031620 3300005439 Bacteria 3515
26 Ga0070705_100032588 3300005440 Bacteria 2896
27 Ga0070700_100046870 3300005441 Bacteria 2673
28 Ga0070694_100027016 3300005444 Bacteria 3724
29 Ga0070694_100042196 3300005444 Bacteria 3047
30 Ga0070694_100477183 3300005444 Bacteria 989
31 Ga0070708_100016198 3300005445 Bacteria 6180
32 Ga0070708_100034307 3300005445 Bacteria 4414
33 Ga0070708_100165474 3300005445 Bacteria 2063
34 Ga0070678_100321145 3300005456 Bacteria 1322
35 Ga0070662_100143943 3300005457 Bacteria 1850
36 Ga0070681_10038620 3300005458 Bacteria 4786
37 Ga0070685_10670787 3300005466 Bacteria 753
38 Ga0070706_100009212 3300005467 Bacteria 9194
39 Ga0070706_100059098 3300005467 Bacteria 3538
40 Ga0070706_100104322 3300005467 Bacteria 2637
41 Ga0070707_100001948 3300005468 Bacteria 19815
42 Ga0070707_100192858 3300005468 Bacteria 1987
43 Ga0070698_100058736 3300005471 Bacteria 3888
44 Ga0070698_100062120 3300005471 Bacteria 3769
45 Ga0070679_100009455 3300005530 Bacteria 9218
46 Ga0070679_100014439 3300005530 Bacteria 7584
47 Ga0070679_100175830 3300005530 Bacteria 2113
48 Ga0070684_100341544 3300005535 Bacteria 1376
49 Ga0070697_100012898 3300005536 Bacteria 6548
50 Ga0070697_100042330 3300005536 Bacteria 3685
51 Ga0068853_100514708 3300005539 Bacteria 1131
52 Ga0070672_100771915 3300005543 Bacteria 844
53 Ga0070695_100000489 3300005545 Bacteria 20688
54 Ga0070695_100167767 3300005545 Bacteria 1546
55 Ga0070696_100170274 3300005546 Bacteria 1609
56 Ga0070696_100285342 3300005546 Bacteria 1260
57 Ga0070693_100000061 3300005547 Bacteria 42929
58 Ga0070704_100184263 3300005549 Bacteria 1673
59 Ga0070704_100310945 3300005549 Bacteria 1316
60 Ga0068855_100157515 3300005563 Bacteria 2579
61 Ga0068855_100379124 3300005563 Bacteria 1553
62 Ga0068855_101911708 3300005563 Bacteria 601
63 Ga0070664_100004019 3300005564 Bacteria 11810
64 Ga0068857_100007975 3300005577 Bacteria 9140
65 Ga0068854_100255013 3300005578 Bacteria 1402
66 Ga0068854_100536637 3300005578 Bacteria 990
67 Ga0068854_100656615 3300005578 Bacteria 901
68 Ga0068854_100783425 3300005578 Bacteria 830
69 Ga0068852_100606058 3300005616 Bacteria 1100
70 Ga0068859_100090494 3300005617 Bacteria 3111
71 Ga0068859_101653466 3300005617 Unclassified 707
72 Ga0068864_100020426 3300005618 Bacteria 5541
73 Ga0068864_100032522 3300005618 Unclassified 4433
74 Ga0068861_100219413 3300005719 Bacteria 1606
75 Ga0068863_100261844 3300005841 Bacteria 1672
76 Ga0068858_100406012 3300005842 Bacteria 1309
77 Ga0068860_100052159 3300005843 Bacteria 3891
78 Ga0068860_100072471 3300005843 Bacteria 3274
79 Ga0068862_100251098 3300005844 Bacteria 1612
80 Ga0081539_10137094 3300005985 Bacteria 1193
81 Ga0070717_10320520 3300006028 Bacteria 1381
82 Ga0070717_10330991 3300006028 Bacteria 1359
83 Ga0070717_10350377 3300006028 Unclassified 1320
84 Ga0070717_10840993 3300006028 Bacteria 835
85 Ga0070715_10031100 3300006163 Bacteria 2164
86 Ga0070712_100000253 3300006175 Bacteria 30157
87 Ga0075428_100002084 3300006844 Bacteria 21577
88 Ga0075428_100011107 3300006844 Bacteria 10021
89 Ga0075430_100006255 3300006846 Bacteria 10044
90 Ga0075431_100009032 3300006847 Bacteria 9994
91 Ga0075431_100136204 3300006847 Bacteria 2532
92 Ga0075433_10018512 3300006852 Bacteria 5792
93 Ga0075433_10098693 3300006852 Bacteria 2586
94 Ga0075434_100039219 3300006871 Bacteria 4693
95 Ga0075434_100843892 3300006871 Bacteria 932
96 Ga0075429_100001951 3300006880 Bacteria 17123
97 Ga0075429_100006794 3300006880 Bacteria 9924
98 Ga0075429_100294084 3300006880 Bacteria 1422
99 Ga0075436_100013465 3300006914 Bacteria 5599
100 Ga0075436_100082779 3300006914 Bacteria 2226
101 Ga0097620_100090493 3300006931 Bacteria 3111
102 Ga0097620_101653939 3300006931 Unclassified 707
103 Ga0075435_100032408 3300007076 Bacteria 4127
104 Ga0075435_100322788 3300007076 Bacteria 1322
105 Ga0075435_100695648 3300007076 Bacteria 883
106 Ga0075435_100701748 3300007076 Bacteria 879
107 Ga0105240_10003364 3300009093 Bacteria 24876
108 Ga0111539_10003660 3300009094 Bacteria 20242
109 Ga0111539_10067845 3300009094 Bacteria 4211
110 Ga0111539_10150073 3300009094 Bacteria 2728
111 Ga0111539_10859606 3300009094 Bacteria 1055
112 Ga0114129_10000252 3300009147 Bacteria 60429
113 Ga0114129_10046140 3300009147 Bacteria 6125
114 Ga0114129_10156380 3300009147 Bacteria 3117
115 Ga0105248_10034472 3300009177 Bacteria 5660
116 Ga0105248_10673583 3300009177 Bacteria 1167
117 Ga0105249_10321488 3300009553 Bacteria 1559
118 Ga0105249_11051379 3300009553 Bacteria 884
119 Ga0105249_12110741 3300009553 Bacteria 636
120 Ga0099796_10375403 3300010159 Bacteria 618
121 Ga0105239_10556269 3300010375 Bacteria 1307
122 Ga0105246_11256213 3300011119 Bacteria 684
123 Ga0157373_10022617 3300013100 Bacteria 4560
124 Ga0157370_10020889 3300013104 Bacteria 6531
125 Ga0163162_10002406 3300013306 Bacteria 17599
126 Ga0157372_10023004 3300013307 Bacteria 6753
127 Ga0157372_10477603 3300013307 Bacteria 1453
128 Ga0163163_10010316 3300014325 Bacteria 8397
129 Ga0163163_10271797 3300014325 Bacteria 1746
130 Ga0157380_10327622 3300014326 Bacteria 1423
131 Ga0157380_11497702 3300014326 Bacteria 728
132 Ga0157379_10347329 3300014968 Bacteria 1358
133 Ga0213876_10167558 3300021384 Bacteria 1168
134 Ga0207653_10000165 3300025885 Bacteria 46874
135 Ga0207653_10024857 3300025885 Bacteria 1914
136 Ga0207692_10029830 3300025898 Bacteria 2596
137 Ga0207685_10107508 3300025905 Bacteria 1204
138 Ga0207699_10020221 3300025906 Bacteria 3563
139 Ga0207699_10078817 3300025906 Bacteria 2036
140 Ga0207699_10136753 3300025906 Bacteria 1606
141 Ga0207684_10002910 3300025910 Bacteria 16974
142 Ga0207684_10220588 3300025910 Bacteria 1636
143 Ga0207684_10681515 3300025910 Bacteria 874
144 Ga0207707_10008832 3300025912 Bacteria 8752
145 Ga0207695_10175368 3300025913 Bacteria 2066
146 Ga0207693_10000909 3300025915 Bacteria 26553
147 Ga0207663_10090624 3300025916 Bacteria 2027
148 Ga0207660_10031642 3300025917 Bacteria 3646
149 Ga0207660_10037950 3300025917 Bacteria 3360
150 Ga0207660_10570012 3300025917 Unclassified 921
151 Ga0207649_10043630 3300025920 Bacteria 2743
152 Ga0207652_10104496 3300025921 Bacteria 2505
153 Ga0207652_10121767 3300025921 Bacteria 2321
154 Ga0207652_11310195 3300025921 Bacteria 627
155 Ga0207646_10001994 3300025922 Bacteria 24538
156 Ga0207646_10373107 3300025922 Bacteria 1289
157 Ga0207646_10836367 3300025922 Bacteria 819
158 Ga0207650_10199548 3300025925 Bacteria 1602
159 Ga0207650_10281907 3300025925 Bacteria 1353
160 Ga0207659_10742403 3300025926 Bacteria 842
161 Ga0207700_10001992 3300025928 Bacteria 11648
162 Ga0207664_10025984 3300025929 Bacteria 4420
163 Ga0207664_10448908 3300025929 Bacteria 1151
164 Ga0207690_10111268 3300025932 Bacteria 1973
165 Ga0207706_10159529 3300025933 Bacteria 1983
166 Ga0207706_10212762 3300025933 Bacteria 1694
167 Ga0207686_10861531 3300025934 Bacteria 729
168 Ga0207669_10661838 3300025937 Bacteria 855
169 Ga0207665_10065452 3300025939 Bacteria 2472
170 Ga0207665_10531481 3300025939 Bacteria 912
171 Ga0207691_10212904 3300025940 Bacteria 1678
172 Ga0207711_10169525 3300025941 Bacteria 1980
173 Ga0207711_10266277 3300025941 Bacteria 1576
174 Ga0207661_10001438 3300025944 Bacteria 16058
175 Ga0207679_10046493 3300025945 Bacteria 3146
176 Ga0207667_11624955 3300025949 Bacteria 614
177 Ga0207712_10393332 3300025961 Bacteria 1163
178 Ga0207712_10464590 3300025961 Bacteria 1076
179 Ga0207712_10637504 3300025961 Bacteria 925
180 Ga0207668_10275230 3300025972 Bacteria 1378
181 Ga0207640_10806510 3300025981 Bacteria 814
182 Ga0207658_10614594 3300025986 Bacteria 977
183 Ga0207703_10902810 3300026035 Bacteria 846
184 Ga0207639_12079411 3300026041 Bacteria 529
185 Ga0207678_10752726 3300026067 Bacteria 859
186 Ga0207708_10237945 3300026075 Bacteria 1464
187 Ga0207648_10316215 3300026089 Bacteria 1402
188 Ga0207676_10022023 3300026095 Bacteria 4683
189 Ga0207674_10013293 3300026116 Bacteria 9143
190 Ga0207683_10560798 3300026121 Bacteria 1056
191 Ga0207683_12046307 3300026121 Bacteria 521
192 Ga0207698_10233719 3300026142 Bacteria 1671
193 Ga0207698_10961925 3300026142 Bacteria 863
194 Ga0207428_10001837 3300027907 Bacteria 21694
195 Ga0207428_10253671 3300027907 Bacteria 1311
196 Ga0268265_10129324 3300028380 Bacteria 2096
197 Ga0268264_10075170 3300028381 Bacteria 2872
198 Ga0307515_10091060 3300028794 Bacteria 3816
199 Ga0265338_10002470 3300028800 Bacteria 27614
200 Ga0265339_10062103 3300031249 Bacteria 2009
201 Ga0307408_100058637 3300031548 Bacteria 2799
202 Ga0307408_100299373 3300031548 Bacteria 1346
203 Ga0307516_10569011 3300031730 Bacteria 787
204 Ga0307405_10053250 3300031731 Bacteria 2520
205 Ga0307412_11267597 3300031911 Bacteria 662
206 Ga0307409_100844858 3300031995 Bacteria 926
207 Ga0307409_102682593 3300031995 Bacteria 526
208 Ga0307416_100057105 3300032002 Bacteria 3155
209 Ga0307416_100207796 3300032002 Bacteria 1864
210 Ga0307416_102156715 3300032002 Bacteria 659
211 Ga0373936_0036292 3300035113 Bacteria 1965
212 Ga0373956_0315813 3300035119 Bacteria 744
213 Ga0373935_0231744 3300035692 Bacteria 1286
214 Ga0373927_0628252 3300035695 Bacteria 710
215 Ga0373933_0791398 3300035724 Bacteria 624
216 Ga0373937_0043939 3300036401 Bacteria 4081
217 Ga0373925_0013481 3300037068 Bacteria 5917
218 Ga0436365_1449720 3300039437 Bacteria 1184
219 Ga0439431_0088567 3300041997 Bacteria 841
220 Ga0439435_0002732 3300042436 Bacteria 3556
221 Ga0439460_0016100 3300042461 Bacteria 1988
222 Ga0451577_0022188 3300042876 Bacteria 5798
223 Ga0451577_0269331 3300042876 Bacteria 1542
224 Ga0453683_0304168 3300044673 Bacteria 1020
225 Ga0466965_0366852 3300044683 Bacteria 791
226 Ga0466966_0139701 3300044684 Unclassified 1481
227 Ga0466961_0145251 3300044693 Bacteria 1484
228 Ga0453684_0367021 3300044712 Bacteria 1619
229 Ga0451576_0009874 3300045051 Bacteria 11026
230 Ga0451576_0163786 3300045051 Bacteria 2320
231 Ga0495629_0087663 3300046459 Bacteria 2172
232 Ga0495580_0060543 3300046472 Bacteria 2660
233 Ga0495580_0602413 3300046472 Bacteria 726
234 Ga0495594_0042798 3300046499 Bacteria 2481
235 Ga0495586_0175702 3300046535 Bacteria 1211
236 Ga0495667_0819816 3300046559 Bacteria 573
237 Ga0495658_0656884 3300046683 Bacteria 672
238 Ga0496102_1192569 3300048905 Bacteria 681
239 Ga0501033_0282684 3300049570 Bacteria 1171
240 Ga0501036_0445149 3300049572 Bacteria 1079
241 Ga0501039_0002996 3300049575 Bacteria 12630
242 Ga0501040_0277233 3300049576 Bacteria 1197
243 Ga0501040_1279623 3300049576 Bacteria 532
244 Ga0501041_0147620 3300049577 Bacteria 1468
245 Ga0501041_0152221 3300049577 Bacteria 1444
246 Ga0501042_0013840 3300049578 Bacteria 5495
247 Ga0501042_0850510 3300049578 Bacteria 664
248 Ga0501043_0378179 3300049579 Bacteria 1072
249 Ga0501046_0005540 3300049580 Bacteria 11279
250 Ga0501068_0288053 3300049584 Bacteria 1050
251 Ga0501069_0089840 3300049585 Bacteria 1737
252 Ga0501070_0503188 3300049586 Bacteria 973
253 Ga0501071_0006060 3300049587 Bacteria 7833
254 Ga0501072_0050353 3300049588 Bacteria 3279
255 Ga0501075_0077770 3300049591 Bacteria 2510
256 Ga0501076_0083285 3300049592 Bacteria 2568
257 Ga0501076_0378061 3300049592 Bacteria 1164
258 Ga0501076_0402385 3300049592 Bacteria 1126
259 Ga0501077_0159567 3300049593 Bacteria 1431
260 Ga0501206_104025 3300049653 Bacteria 518
261 Ga0501217_048653 3300049661 Bacteria 1102
262 Ga0501228_046632 3300049666 Bacteria 580
263 Ga0501261_119840 3300049690 Bacteria 520
264 Ga0501221_091013 3300049704 Bacteria 746
265 Ga0501225_0035015 3300049705 Bacteria 1382
266 Ga0501079_0199547 3300049741 Bacteria 1562
267 Ga0501080_0047452 3300049742 Bacteria 3998
268 Ga0501080_0075818 3300049742 Bacteria 3128
269 Ga0501080_1580403 3300049742 Bacteria 556
270 Ga0501081_0002057 3300049743 Bacteria 12550
271 Ga0501044_0009013 3300049823 Bacteria 10911
272 Ga0501045_0289974 3300049824 Bacteria 1218
273 Ga0501045_0371438 3300049824 Bacteria 1064
274 nmdc:mga05p37_105261_c1 3300050507 Bacteria 3471
275 nmdc:mga05p37_1392_c1 3300050507 Bacteria 28148
276 nmdc:mga05p37_92541_c1 3300050507 Bacteria 3726
277 nmdc:mga09592_2518_c1 3300050508 Bacteria 14825
278 nmdc:mga09592_4048_c1 3300050508 Bacteria 11830
279 nmdc:mga09592_690603_c1 3300050508 Bacteria 869
280 nmdc:mga09592_7829_c1 3300050508 Bacteria 8685
281 nmdc:mga0qj67_1018558_c1 3300050509 Bacteria 649
282 nmdc:mga0qj67_2381_c1 3300050509 Bacteria 13392
283 nmdc:mga06r32_131400_c1 3300050510 Bacteria 2476
284 nmdc:mga06r32_8880_c1 3300050510 Bacteria 9057
285 nmdc:mga08y16_186705_c1 3300050511 Bacteria 2151
286 nmdc:mga08y16_9516_c1 3300050511 Bacteria 10197
287 nmdc:mga0rr50_154865_c1 3300050513 Bacteria 1856
288 nmdc:mga0rr50_211338_c1 3300050513 Bacteria 1599
289 nmdc:mga08x19_13673_c1 3300050514 Bacteria 4911
290 nmdc:mga0a205_211598_c1 3300050515 Bacteria 1827
291 nmdc:mga0a205_31397_c1 3300050515 Bacteria 5089
292 nmdc:mga0a205_333846_c1 3300050515 Bacteria 1385
293 Ga0500644_0029728 3300053088 Bacteria 1721
294 Ga0500562_005222 3300053108 Bacteria 3262
295 Ga0500616_0034565 3300053153 Bacteria 2753
296 Ga0501084_0034880 3300054114 Bacteria 4207
297 Ga0501084_0250950 3300054114 Bacteria 1494
298 Ga0590071_017874 3300059421 Bacteria 1667
299 Ga0590071_126084 3300059421 Bacteria 656
300 Ga0590077_043325 3300059426 Bacteria 1003
301 Ga0501082_0032664 3300060353 Bacteria 4489
302 Ga0530510_0053369 3300061734 Bacteria 2921
303 Ga0451577_0005919
304 rootL2_10329609
305 Ga0065704_10698246
306 Ga0065715_10002055
307 Ga0065707_10270674
308 Ga0070683_100035230
309 Ga0070670_100045769
310 Ga0070680_100004858
311 Ga0070680_100010484
312 Ga0070680_100030997
313 Ga0070661_100021300
314 Ga0070661_101586584
315 Ga0070668_100148910
316 Ga0070669_100855121
317 Ga0070669_100899639
318 Ga0070675_100443114
319 Ga0070673_100009100
320 Ga0070659_100002214
321 Ga0070703_10000383
322 Ga0070709_10002128
323 Ga0070709_10177230
324 Ga0070714_100037794
325 Ga0070714_100406874
326 Ga0070713_100000731
327 Ga0070711_100031620
328 Ga0070705_100032588
329 Ga0070700_100046870
330 Ga0070694_100027016
331 Ga0070694_100042196
332 Ga0070694_100477183
333 Ga0070708_100016198
334 Ga0070708_100034307
335 Ga0070708_100165474
336 Ga0070678_100321145
337 Ga0070662_100143943
338 Ga0070681_10038620
339 Ga0070685_10670787
340 Ga0070706_100009212
341 Ga0070706_100059098
342 Ga0070706_100104322
343 Ga0070707_100001948
344 Ga0070707_100192858
345 Ga0070698_100058736
346 Ga0070698_100062120
347 Ga0070679_100009455
348 Ga0070679_100014439
349 Ga0070679_100175830
350 Ga0070684_100341544
351 Ga0070697_100012898
352 Ga0070697_100042330
353 Ga0068853_100514708
354 Ga0070672_100771915
355 Ga0070695_100000489
356 Ga0070695_100167767
357 Ga0070696_100170274
358 Ga0070696_100285342
359 Ga0070693_100000061
360 Ga0070704_100184263
361 Ga0070704_100310945
362 Ga0068855_100157515
363 Ga0068855_100379124
364 Ga0068855_101911708
365 Ga0070664_100004019
366 Ga0068857_100007975
367 Ga0068854_100255013
368 Ga0068854_100536637
369 Ga0068854_100656615
370 Ga0068854_100783425
371 Ga0068852_100606058
372 Ga0068859_100090494
373 Ga0068859_101653466
374 Ga0068864_100020426
375 Ga0068864_100032522
376 Ga0068861_100219413
377 Ga0068863_100261844
378 Ga0068858_100406012
379 Ga0068860_100052159
380 Ga0068860_100072471
381 Ga0068862_100251098
382 Ga0081539_10137094
383 Ga0070717_10320520
384 Ga0070717_10330991
385 Ga0070717_10350377
386 Ga0070717_10840993
387 Ga0070715_10031100
388 Ga0070712_100000253
389 Ga0075428_100002084
390 Ga0075428_100011107
391 Ga0075430_100006255
392 Ga0075431_100009032
393 Ga0075431_100136204
394 Ga0075433_10018512
395 Ga0075433_10098693
396 Ga0075434_100039219
397 Ga0075434_100843892
398 Ga0075429_100001951
399 Ga0075429_100006794
400 Ga0075429_100294084
401 Ga0075436_100013465
402 Ga0075436_100082779
403 Ga0097620_100090493
404 Ga0097620_101653939
405 Ga0075435_100032408
406 Ga0075435_100322788
407 Ga0075435_100695648
408 Ga0075435_100701748
409 Ga0105240_10003364
410 Ga0111539_10003660
411 Ga0111539_10067845
412 Ga0111539_10150073
413 Ga0111539_10859606
414 Ga0114129_10000252
415 Ga0114129_10046140
416 Ga0114129_10156380
417 Ga0105248_10034472
418 Ga0105248_10673583
419 Ga0105249_10321488
420 Ga0105249_11051379
421 Ga0105249_12110741
422 Ga0099796_10375403
423 Ga0105239_10556269
424 Ga0105246_11256213
425 Ga0157373_10022617
426 Ga0157370_10020889
427 Ga0163162_10002406
428 Ga0157372_10023004
429 Ga0157372_10477603
430 Ga0163163_10010316
431 Ga0163163_10271797
432 Ga0157380_10327622
433 Ga0157380_11497702
434 Ga0157379_10347329
435 Ga0213876_10167558
436 Ga0207653_10000165
437 Ga0207653_10024857
438 Ga0207692_10029830
439 Ga0207685_10107508
440 Ga0207699_10020221
441 Ga0207699_10078817
442 Ga0207699_10136753
443 Ga0207684_10002910
444 Ga0207684_10220588
445 Ga0207684_10681515
446 Ga0207707_10008832
447 Ga0207695_10175368
448 Ga0207693_10000909
449 Ga0207663_10090624
450 Ga0207660_10031642
451 Ga0207660_10037950
452 Ga0207660_10570012
453 Ga0207649_10043630
454 Ga0207652_10104496
455 Ga0207652_10121767
456 Ga0207652_11310195
457 Ga0207646_10001994
458 Ga0207646_10373107
459 Ga0207646_10836367
460 Ga0207650_10199548
461 Ga0207650_10281907
462 Ga0207659_10742403
463 Ga0207700_10001992
464 Ga0207664_10025984
465 Ga0207664_10448908
466 Ga0207690_10111268
467 Ga0207706_10159529
468 Ga0207706_10212762
469 Ga0207686_10861531
470 Ga0207669_10661838
471 Ga0207665_10065452
472 Ga0207665_10531481
473 Ga0207691_10212904
474 Ga0207711_10169525
475 Ga0207711_10266277
476 Ga0207661_10001438
477 Ga0207679_10046493
478 Ga0207667_11624955
479 Ga0207712_10393332
480 Ga0207712_10464590
481 Ga0207712_10637504
482 Ga0207668_10275230
483 Ga0207640_10806510
484 Ga0207658_10614594
485 Ga0207703_10902810
486 Ga0207639_12079411
487 Ga0207678_10752726
488 Ga0207708_10237945
489 Ga0207648_10316215
490 Ga0207676_10022023
491 Ga0207674_10013293
492 Ga0207683_10560798
493 Ga0207683_12046307
494 Ga0207698_10233719
495 Ga0207698_10961925
496 Ga0207428_10001837
497 Ga0207428_10253671
498 Ga0268265_10129324
499 Ga0268264_10075170
500 Ga0307515_10091060
501 Ga0265338_10002470
502 Ga0265339_10062103
503 Ga0307408_100058637
504 Ga0307408_100299373
505 Ga0307516_10569011
506 Ga0307405_10053250
507 Ga0307412_11267597
508 Ga0307409_100844858
509 Ga0307409_102682593
510 Ga0307416_100057105
511 Ga0307416_100207796
512 Ga0307416_102156715
513 Ga0373936_0036292
514 Ga0373956_0315813
515 Ga0373935_0231744
516 Ga0373927_0628252
517 Ga0373933_0791398
518 Ga0373937_0043939
519 Ga0373925_0013481
520 Ga0436365_1449720
521 Ga0439431_0088567
522 Ga0439435_0002732
523 Ga0439460_0016100
524 Ga0451577_0022188
525 Ga0451577_0269331
526 Ga0453683_0304168
527 Ga0466965_0366852
528 Ga0466966_0139701
529 Ga0466961_0145251
530 Ga0453684_0367021
531 Ga0451576_0009874
532 Ga0451576_0163786
533 Ga0495629_0087663
534 Ga0495580_0060543
535 Ga0495580_0602413
536 Ga0495594_0042798
537 Ga0495586_0175702
538 Ga0495667_0819816
539 Ga0495658_0656884
540 Ga0496102_1192569
541 Ga0501033_0282684
542 Ga0501036_0445149
543 Ga0501039_0002996
544 Ga0501040_0277233
545 Ga0501040_1279623
546 Ga0501041_0147620
547 Ga0501041_0152221
548 Ga0501042_0013840
549 Ga0501042_0850510
550 Ga0501043_0378179
551 Ga0501046_0005540
552 Ga0501068_0288053
553 Ga0501069_0089840
554 Ga0501070_0503188
555 Ga0501071_0006060
556 Ga0501072_0050353
557 Ga0501075_0077770
558 Ga0501076_0083285
559 Ga0501076_0378061
560 Ga0501076_0402385
561 Ga0501077_0159567
562 Ga0501206_104025
563 Ga0501217_048653
564 Ga0501228_046632
565 Ga0501261_119840
566 Ga0501221_091013
567 Ga0501225_0035015
568 Ga0501079_0199547
569 Ga0501080_0047452
570 Ga0501080_0075818
571 Ga0501080_1580403
572 Ga0501081_0002057
573 Ga0501044_0009013
574 Ga0501045_0289974
575 Ga0501045_0371438
576 nmdc:mga05p37_105261_c1
577 nmdc:mga05p37_1392_c1
578 nmdc:mga05p37_92541_c1
579 nmdc:mga09592_2518_c1
580 nmdc:mga09592_4048_c1
581 nmdc:mga09592_690603_c1
582 nmdc:mga09592_7829_c1
583 nmdc:mga0qj67_1018558_c1
584 nmdc:mga0qj67_2381_c1
585 nmdc:mga06r32_131400_c1
586 nmdc:mga06r32_8880_c1
587 nmdc:mga08y16_186705_c1
588 nmdc:mga08y16_9516_c1
589 nmdc:mga0rr50_154865_c1
590 nmdc:mga0rr50_211338_c1
591 nmdc:mga08x19_13673_c1
592 nmdc:mga0a205_211598_c1
593 nmdc:mga0a205_31397_c1
594 nmdc:mga0a205_333846_c1
595 Ga0500644_0029728
596 Ga0500562_005222
597 Ga0500616_0034565
598 Ga0501084_0034880
599 Ga0501084_0250950
600 Ga0590071_017874
601 Ga0590071_126084
602 Ga0590077_043325
603 Ga0501082_0032664
604 Ga0530510_0053369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

14

135

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7037 1 112
2vc1-assembly1.cif.gz_B feast or famine regulatory protein (rv3291c)from m. tuberculosis complexed with l-methionine 0.6502 2 112
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6436 1 112
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6275 1 112
3i4p-assembly1.cif.gz_A crystal structure of asnc family transcriptional regulator from agrobacterium tumefaciens 0.6272 2 112
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7037 1 112 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6436 1 112 3.30.70.1060
3i4pA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6405 2 108 3.30.70.920
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6295 1 112 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6191 1 112 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A4R7TI30-F1-model_v4 YCII-related domain-containing protein 0.8055 1 118
AF-A0A3C0XB99-F1-model_v4 deleted 0.8046 1 136
AF-A0A6N7FTD3-F1-model_v4 YCII-related domain-containing protein 0.8008 1 112
AF-A0A3N1KK36-F1-model_v4 deleted 0.7979 1 112
AF-A0A536M2Z6-F1-model_v4 YciI family protein 0.7977 1 116

Map