F396602

General Info

Members Datasets Scaffolds Average Seq Length
302 190 604 165

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0000113|Ga0395905_0000113_47324_47899
Length 191
Sequence MRECCGIFMPQCSPLQLDGKISEASRLKEVFMSDLYAIPVKTIDGKATTLASFKGKTLLIVNTASECGFTPQYDGLEKLYAEFKNKGFAVLGFPSNDFGAQEPGSDAEIKDFCQTRFHVDFPLFAKAGVKGSAKQPLYDHLTKEAKPAGEVQWNFEKFLIGPDGRIVGRFGSKVKPEDAELRSAIENNLPR

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
186 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
187 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
188 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
189 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
190 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.02
Metatranscriptomes 0.99
Isolates 1.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.66
Rhizosphere 96.03
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0000113 3300037471 Bacteria 134436
2 Ga0070658_10475897 3300005327 Bacteria 1078
3 Ga0070658_10812184 3300005327 Bacteria 812
4 Ga0070666_10005366 3300005335 Bacteria 7860
5 Ga0070680_100212601 3300005336 Bacteria 1632
6 Ga0070680_100966420 3300005336 Bacteria 735
7 Ga0070682_100036905 3300005337 Bacteria 2989
8 Ga0070668_100062680 3300005347 Bacteria 2881
9 Ga0070674_100164046 3300005356 Bacteria 1688
10 Ga0070659_100145444 3300005366 Bacteria 1931
11 Ga0070667_100018443 3300005367 Bacteria 5787
12 Ga0070714_100100709 3300005435 Bacteria 2545
13 Ga0070714_101313847 3300005435 Bacteria 706
14 Ga0070706_100052321 3300005467 Bacteria 3769
15 Ga0070698_100001465 3300005471 Bacteria 26201
16 Ga0070699_100022271 3300005518 Bacteria 5460
17 Ga0070679_100003778 3300005530 Bacteria 13896
18 Ga0070679_100105565 3300005530 Bacteria 2803
19 Ga0070696_100152344 3300005546 Bacteria 1698
20 Ga0070665_100023680 3300005548 Bacteria 6183
21 Ga0068855_100039156 3300005563 Bacteria 5628
22 Ga0070664_100795347 3300005564 Bacteria 884
23 Ga0068857_100136564 3300005577 Bacteria 2214
24 Ga0068861_101124030 3300005719 Bacteria 756
25 Ga0068863_100010297 3300005841 Bacteria 9085
26 Ga0068858_100029994 3300005842 Bacteria 5050
27 Ga0068860_100000147 3300005843 Bacteria 115672
28 Ga0068860_100815437 3300005843 Bacteria 947
29 Ga0068862_100366394 3300005844 Bacteria 1340
30 Ga0070717_10068199 3300006028 Bacteria 2960
31 Ga0070712_100912180 3300006175 Bacteria 758
32 Ga0105240_10001415 3300009093 Bacteria 41148
33 Ga0105241_10646777 3300009174 Bacteria 960
34 Ga0105242_10078444 3300009176 Bacteria 2757
35 Ga0105238_10011484 3300009551 Bacteria 8922
36 Ga0105239_11758873 3300010375 Bacteria 718
37 Ga0157370_10249238 3300013104 Bacteria 1643
38 Ga0157369_10012043 3300013105 Bacteria 9820
39 Ga0163162_10225190 3300013306 Bacteria 2005
40 Ga0163162_11161927 3300013306 Bacteria 875
41 Ga0163163_12260773 3300014325 Bacteria 603
42 Ga0157380_10702061 3300014326 Bacteria 1017
43 Ga0157380_11354504 3300014326 Bacteria 761
44 Ga0157377_11074791 3300014745 Bacteria 615
45 Ga0157379_10014982 3300014968 Bacteria 6801
46 Ga0182006_1006054 3300015261 Bacteria 5662
47 Ga0197907_10514792 3300020069 Bacteria 1016
48 Ga0206353_10450051 3300020082 Bacteria 2096
49 Ga0207680_10002811 3300025903 Bacteria 8148
50 Ga0207647_10086699 3300025904 Bacteria 1871
51 Ga0207643_10779555 3300025908 Bacteria 619
52 Ga0207684_10147499 3300025910 Bacteria 2024
53 Ga0207695_10001223 3300025913 Bacteria 44028
54 Ga0207693_10630467 3300025915 Bacteria 833
55 Ga0207660_10099239 3300025917 Bacteria 2172
56 Ga0207660_10742979 3300025917 Bacteria 801
57 Ga0207652_10002400 3300025921 Bacteria 15825
58 Ga0207652_10008097 3300025921 Bacteria 8438
59 Ga0207694_10039883 3300025924 Bacteria 3614
60 Ga0207700_10037565 3300025928 Bacteria 3508
61 Ga0207690_10119911 3300025932 Bacteria 1909
62 Ga0207670_10686235 3300025936 Bacteria 847
63 Ga0207691_11403054 3300025940 Bacteria 574
64 Ga0207689_10273195 3300025942 Bacteria 1399
65 Ga0207667_10516552 3300025949 Bacteria 1210
66 Ga0207668_10055202 3300025972 Bacteria 2760
67 Ga0207703_10139484 3300026035 Bacteria 2103
68 Ga0207639_11335622 3300026041 Bacteria 673
69 Ga0207641_10002047 3300026088 Bacteria 19179
70 Ga0207674_10352647 3300026116 Bacteria 1422
71 Ga0268266_10005304 3300028379 Bacteria 12085
72 Ga0268265_10417532 3300028380 Bacteria 1245
73 Ga0268264_10000033 3300028381 Bacteria 404123
74 Ga0268264_10000138 3300028381 Bacteria 172597
75 Ga0265337_1000738 3300028556 Bacteria 17244
76 Ga0265326_10002336 3300028558 Bacteria 6408
77 Ga0265319_1022850 3300028563 Bacteria 2272
78 Ga0265334_10000913 3300028573 Bacteria 14757
79 Ga0265318_10004049 3300028577 Bacteria 7191
80 Ga0265323_10005289 3300028653 Bacteria 5485
81 Ga0265322_10021242 3300028654 Bacteria 1859
82 Ga0265336_10004809 3300028666 Bacteria 5059
83 Ga0265338_10006593 3300028800 Bacteria 14716
84 Ga0265338_10083447 3300028800 Bacteria 2673
85 Ga0265324_10005106 3300029957 Bacteria 5745
86 Ga0265332_10003873 3300031238 Bacteria 7145
87 Ga0265325_10013699 3300031241 Bacteria 4605
88 Ga0265329_10201100 3300031242 Bacteria 656
89 Ga0265340_10008845 3300031247 Bacteria 5424
90 Ga0265327_10048349 3300031251 Bacteria 2238
91 Ga0265327_10064239 3300031251 Bacteria 1861
92 Ga0265316_10058049 3300031344 Bacteria 3016
93 Ga0307408_100841732 3300031548 Bacteria 836
94 Ga0265313_10014045 3300031595 Bacteria 4766
95 Ga0265313_10019776 3300031595 Bacteria 3736
96 Ga0316579_10319317 3300031691 Bacteria 751
97 Ga0265314_10017826 3300031711 Bacteria 5562
98 Ga0265314_10216696 3300031711 Bacteria 1120
99 Ga0265342_10011386 3300031712 Bacteria 6093
100 Ga0307405_10032759 3300031731 Bacteria 3075
101 Ga0307405_10636081 3300031731 Bacteria 875
102 Ga0307413_10001099 3300031824 Bacteria 9887
103 Ga0307413_10043261 3300031824 Bacteria 2653
104 Ga0307413_10649831 3300031824 Bacteria 870
105 Ga0307410_10000920 3300031852 Bacteria 12575
106 Ga0307410_11022372 3300031852 Bacteria 713
107 Ga0326468_10022291 3300031889 Bacteria 769
108 Ga0307407_10001805 3300031903 Bacteria 8016
109 Ga0307407_10128108 3300031903 Bacteria 1620
110 Ga0307412_10076623 3300031911 Bacteria 2298
111 Ga0307409_100001126 3300031995 Bacteria 12675
112 Ga0307409_100092781 3300031995 Bacteria 2479
113 Ga0307409_100453197 3300031995 Bacteria 1239
114 Ga0307409_100738087 3300031995 Bacteria 987
115 Ga0307416_100821756 3300032002 Bacteria 1026
116 Ga0307414_10029025 3300032004 Bacteria 3596
117 Ga0307411_10064771 3300032005 Bacteria 2448
118 Ga0307411_10305661 3300032005 Bacteria 1277
119 Ga0307415_100462347 3300032126 Unclassified 1100
120 Ga0373934_0006519 3300035086 Bacteria 4331
121 Ga0373934_0027925 3300035086 Bacteria 2195
122 Ga0373934_0043152 3300035086 Bacteria 1782
123 Ga0373923_0006031 3300035111 Bacteria 4158
124 Ga0373923_0247868 3300035111 Bacteria 833
125 Ga0373936_0003023 3300035113 Bacteria 6286
126 Ga0373936_0009111 3300035113 Bacteria 3743
127 Ga0373953_0009967 3300035117 Bacteria 3293
128 Ga0373953_0277983 3300035117 Bacteria 729
129 Ga0373954_0022061 3300035118 Bacteria 2887
130 Ga0373954_0026768 3300035118 Bacteria 2645
131 Ga0373954_0512259 3300035118 Bacteria 594
132 Ga0373956_0010400 3300035119 Bacteria 3814
133 Ga0373956_0020482 3300035119 Bacteria 2815
134 Ga0373957_0010011 3300035120 Bacteria 3120
135 Ga0373957_0096033 3300035120 Bacteria 1182
136 Ga0373943_0263997 3300035170 Bacteria 970
137 Ga0373946_0141824 3300035171 Bacteria 1114
138 Ga0373955_0067381 3300035172 Bacteria 1992
139 Ga0373955_0086444 3300035172 Bacteria 1781
140 Ga0373955_0139589 3300035172 Bacteria 1420
141 Ga0373955_0180155 3300035172 Bacteria 1253
142 Ga0373924_0017516 3300035410 Bacteria 2750
143 Ga0373924_0018608 3300035410 Bacteria 2679
144 Ga0373935_0025353 3300035692 Bacteria 3654
145 Ga0373935_0033280 3300035692 Bacteria 3206
146 Ga0373927_0119182 3300035695 Bacteria 1722
147 Ga0373927_0620936 3300035695 Bacteria 714
148 Ga0373933_0004732 3300035724 Bacteria 7441
149 Ga0373933_0011986 3300035724 Bacteria 4786
150 Ga0373933_0149712 3300035724 Bacteria 1477
151 Ga0373933_0474971 3300035724 Bacteria 818
152 Ga0373947_0044445 3300035725 Bacteria 2655
153 Ga0373947_0241064 3300035725 Bacteria 1193
154 Ga0373937_0001805 3300036401 Bacteria 17978
155 Ga0373937_0021138 3300036401 Bacteria 5840
156 Ga0373937_0068429 3300036401 Bacteria 3273
157 Ga0372808_005221 3300036459 Bacteria 1703
158 Ga0316584_0138819 3300036712 Unclassified 1814
159 Ga0373925_0086721 3300037068 Bacteria 2388
160 Ga0373925_0141957 3300037068 Bacteria 1880
161 Ga0373925_0507171 3300037068 Bacteria 990
162 Ga0436364_1331007 3300037853 Bacteria 986
163 Ga0451576_0000023 3300045051 Bacteria 477965
164 Ga0466967_0408165 3300045976 Bacteria 1322
165 Ga0495592_0056979 3300046454 Bacteria 2885
166 Ga0495592_0091035 3300046454 Bacteria 2187
167 Ga0495592_0353009 3300046454 Bacteria 942
168 Ga0495592_0499096 3300046454 Bacteria 755
169 Ga0495603_0027640 3300046455 Bacteria 3423
170 Ga0495629_0023845 3300046459 Bacteria 4357
171 Ga0495629_0033816 3300046459 Bacteria 3615
172 Ga0495641_0031678 3300046461 Bacteria 2524
173 Ga0495641_0042748 3300046461 Bacteria 2098
174 Ga0495641_0112995 3300046461 Bacteria 1211
175 Ga0495651_0043558 3300046462 Bacteria 3481
176 Ga0495651_0054276 3300046462 Bacteria 3082
177 Ga0495651_0083969 3300046462 Bacteria 2400
178 Ga0495653_0056050 3300046463 Bacteria 3006
179 Ga0495653_0067723 3300046463 Bacteria 2679
180 Ga0495653_0121838 3300046463 Bacteria 1857
181 Ga0495580_0152740 3300046472 Bacteria 1599
182 Ga0495580_0161477 3300046472 Bacteria 1551
183 Ga0495582_0015300 3300046473 Bacteria 4216
184 Ga0495582_0201851 3300046473 Bacteria 1135
185 Ga0495639_0012608 3300046475 Bacteria 3648
186 Ga0495639_0038069 3300046475 Bacteria 2158
187 Ga0495662_0002120 3300046476 Bacteria 9951
188 Ga0495662_0434217 3300046476 Bacteria 644
189 Ga0495664_0028986 3300046477 Bacteria 3235
190 Ga0495664_0050351 3300046477 Bacteria 2473
191 Ga0495594_0571846 3300046499 Bacteria 641
192 Ga0495608_0065304 3300046511 Bacteria 2383
193 Ga0495618_0036036 3300046514 Bacteria 3104
194 Ga0495618_0041396 3300046514 Bacteria 2901
195 Ga0495618_0304722 3300046514 Bacteria 989
196 Ga0495628_0041937 3300046516 Bacteria 3651
197 Ga0495630_0066229 3300046517 Bacteria 2714
198 Ga0495630_0558731 3300046517 Bacteria 877
199 Ga0495630_0591903 3300046517 Bacteria 850
200 Ga0495630_1090330 3300046517 Bacteria 605
201 Ga0495666_0020457 3300046526 Bacteria 3278
202 Ga0495666_0098991 3300046526 Bacteria 1374
203 Ga0495652_0043130 3300046529 Bacteria 3887
204 Ga0495652_0130146 3300046529 Bacteria 1993
205 Ga0495652_0192091 3300046529 Bacteria 1557
206 Ga0495665_0023315 3300046531 Bacteria 3323
207 Ga0495665_0057332 3300046531 Bacteria 2056
208 Ga0495665_0078212 3300046531 Bacteria 1740
209 Ga0495640_0027006 3300046533 Bacteria 4143
210 Ga0495640_0063861 3300046533 Bacteria 2491
211 Ga0495640_0105535 3300046533 Bacteria 1845
212 Ga0495586_0002888 3300046535 Bacteria 9283
213 Ga0495586_0225019 3300046535 Bacteria 1067
214 Ga0495587_0069756 3300046536 Bacteria 2046
215 Ga0495587_0082361 3300046536 Bacteria 1864
216 Ga0495587_0083404 3300046536 Bacteria 1851
217 Ga0495645_0055071 3300046543 Bacteria 2888
218 Ga0495645_0099204 3300046543 Bacteria 2072
219 Ga0495645_0126040 3300046543 Bacteria 1799
220 Ga0495667_0021114 3300046559 Bacteria 4392
221 Ga0495667_0066300 3300046559 Bacteria 2360
222 Ga0495634_0014534 3300046642 Bacteria 5674
223 Ga0495634_0028196 3300046642 Bacteria 3899
224 Ga0495634_0034703 3300046642 Bacteria 3459
225 Ga0495635_0228094 3300046663 Bacteria 1258
226 Ga0495657_0046786 3300046675 Bacteria 2927
227 Ga0495657_0208208 3300046675 Bacteria 1189
228 Ga0495599_0058182 3300046678 Bacteria 2418
229 Ga0495623_0181671 3300046679 Bacteria 1221
230 Ga0495646_0011785 3300046680 Bacteria 5559
231 Ga0495647_0172925 3300046681 Bacteria 936
232 Ga0495658_0181949 3300046683 Bacteria 1304
233 Ga0495658_0226075 3300046683 Bacteria 1173
234 Ga0495658_0401912 3300046683 Bacteria 873
235 Ga0495613_0050378 3300046689 Bacteria 3071
236 Ga0495613_0082450 3300046689 Bacteria 2335
237 Ga0495613_0085615 3300046689 Bacteria 2286
238 Ga0495624_0003494 3300046690 Bacteria 11647
239 Ga0495624_0022687 3300046690 Bacteria 4144
240 Ga0495624_0518249 3300046690 Bacteria 713
241 Ga0495600_0006404 3300046809 Bacteria 7165
242 Ga0495600_0021551 3300046809 Bacteria 4128
243 Ga0495581_0027383 3300047315 Bacteria 3305
244 Ga0495581_0040463 3300047315 Bacteria 2697
245 Ga0495581_0164171 3300047315 Bacteria 1298
246 Ga0495604_0009518 3300047317 Bacteria 7681
247 Ga0495604_0042108 3300047317 Bacteria 3580
248 Ga0495604_0073625 3300047317 Bacteria 2577
249 Ga0495604_0179124 3300047317 Bacteria 1484
250 Ga0495674_0045698 3300047319 Bacteria 3888
251 Ga0495674_0153289 3300047319 Bacteria 1931
252 Ga0495674_0360153 3300047319 Bacteria 1179
253 Ga0495676_0103682 3300047321 Bacteria 2099
254 Ga0495676_0226358 3300047321 Bacteria 1286
255 Ga0495680_0084981 3300047322 Bacteria 2383
256 Ga0495680_0091354 3300047322 Bacteria 2282
257 Ga0495680_0139559 3300047322 Bacteria 1774
258 Ga0495675_0003239 3300047444 Bacteria 9771
259 Ga0495675_0016134 3300047444 Bacteria 4724
260 Ga0495675_0056386 3300047444 Bacteria 2491
261 Ga0495684_0081868 3300047471 Bacteria 2449
262 Ga0495684_0123067 3300047471 Bacteria 1952
263 Ga0495593_0034392 3300047673 Bacteria 2756
264 Ga0495593_0116615 3300047673 Bacteria 1360
265 Ga0495593_0133691 3300047673 Bacteria 1258
266 Ga0495602_0029127 3300048088 Bacteria 5269
267 Ga0495602_0052382 3300048088 Bacteria 3625
268 Ga0495602_0094327 3300048088 Bacteria 2473
269 Ga0495602_0129658 3300048088 Bacteria 2013
270 Ga0495614_0038761 3300048089 Bacteria 2045
271 Ga0496102_0000453 3300048905 Bacteria 46525
272 Ga0496105_1172592 3300048908 Bacteria 567
273 Ga0496108_0867650 3300048911 Bacteria 776
274 Ga0496109_0694796 3300048912 Bacteria 955
275 Ga0496110_0542973 3300048913 Bacteria 1057
276 Ga0496124_0110397 3300048927 Bacteria 2214
277 Ga0496126_0000035 3300048929 Bacteria 361590
278 Ga0501031_0036487 3300049568 Bacteria 3207
279 Ga0501034_0039624 3300049571 Bacteria 4772
280 Ga0501039_0339716 3300049575 Bacteria 1180
281 Ga0501042_0115542 3300049578 Bacteria 1932
282 Ga0501070_0496344 3300049586 Bacteria 981
283 Ga0501073_0704763 3300049589 Bacteria 696
284 Ga0501035_0063723 3300049822 Bacteria 3278
285 nmdc:mga09592_661554_c1 3300050508 Bacteria 891
286 nmdc:mga0a205_10803_c1 3300050515 Bacteria 8400
287 Ga0495601_0024542 3300053077 Bacteria 3713
288 Ga0495601_0325561 3300053077 Bacteria 1000
289 Ga0495612_0014580 3300053078 Bacteria 3159
290 Ga0495612_0052203 3300053078 Bacteria 1681
291 Ga0495595_0006264 3300053084 Bacteria 4846
292 Ga0495595_0021906 3300053084 Bacteria 2798
293 Ga0495619_0042698 3300053085 Bacteria 2970
294 Ga0495619_0053685 3300053085 Bacteria 2666
295 Ga0495619_0503866 3300053085 Bacteria 832
296 Ga0501082_1238571 3300060353 Bacteria 652
297 2862710211 2862705112 Bacteria 6563286
298 2915772922 2915768154 Bacteria 8424322
299 8008486856 8008485437 Bacteria 7198341
300 8011351289 8011350971 Bacteria 6158957
301 8025526113 8025524527 Bacteria 7197316
302 8053950705 8053945823 Bacteria 8962862
303 Ga0395905_0000113
304 Ga0070658_10475897
305 Ga0070658_10812184
306 Ga0070666_10005366
307 Ga0070680_100212601
308 Ga0070680_100966420
309 Ga0070682_100036905
310 Ga0070668_100062680
311 Ga0070674_100164046
312 Ga0070659_100145444
313 Ga0070667_100018443
314 Ga0070714_100100709
315 Ga0070714_101313847
316 Ga0070706_100052321
317 Ga0070698_100001465
318 Ga0070699_100022271
319 Ga0070679_100003778
320 Ga0070679_100105565
321 Ga0070696_100152344
322 Ga0070665_100023680
323 Ga0068855_100039156
324 Ga0070664_100795347
325 Ga0068857_100136564
326 Ga0068861_101124030
327 Ga0068863_100010297
328 Ga0068858_100029994
329 Ga0068860_100000147
330 Ga0068860_100815437
331 Ga0068862_100366394
332 Ga0070717_10068199
333 Ga0070712_100912180
334 Ga0105240_10001415
335 Ga0105241_10646777
336 Ga0105242_10078444
337 Ga0105238_10011484
338 Ga0105239_11758873
339 Ga0157370_10249238
340 Ga0157369_10012043
341 Ga0163162_10225190
342 Ga0163162_11161927
343 Ga0163163_12260773
344 Ga0157380_10702061
345 Ga0157380_11354504
346 Ga0157377_11074791
347 Ga0157379_10014982
348 Ga0182006_1006054
349 Ga0197907_10514792
350 Ga0206353_10450051
351 Ga0207680_10002811
352 Ga0207647_10086699
353 Ga0207643_10779555
354 Ga0207684_10147499
355 Ga0207695_10001223
356 Ga0207693_10630467
357 Ga0207660_10099239
358 Ga0207660_10742979
359 Ga0207652_10002400
360 Ga0207652_10008097
361 Ga0207694_10039883
362 Ga0207700_10037565
363 Ga0207690_10119911
364 Ga0207670_10686235
365 Ga0207691_11403054
366 Ga0207689_10273195
367 Ga0207667_10516552
368 Ga0207668_10055202
369 Ga0207703_10139484
370 Ga0207639_11335622
371 Ga0207641_10002047
372 Ga0207674_10352647
373 Ga0268266_10005304
374 Ga0268265_10417532
375 Ga0268264_10000033
376 Ga0268264_10000138
377 Ga0265337_1000738
378 Ga0265326_10002336
379 Ga0265319_1022850
380 Ga0265334_10000913
381 Ga0265318_10004049
382 Ga0265323_10005289
383 Ga0265322_10021242
384 Ga0265336_10004809
385 Ga0265338_10006593
386 Ga0265338_10083447
387 Ga0265324_10005106
388 Ga0265332_10003873
389 Ga0265325_10013699
390 Ga0265329_10201100
391 Ga0265340_10008845
392 Ga0265327_10048349
393 Ga0265327_10064239
394 Ga0265316_10058049
395 Ga0307408_100841732
396 Ga0265313_10014045
397 Ga0265313_10019776
398 Ga0316579_10319317
399 Ga0265314_10017826
400 Ga0265314_10216696
401 Ga0265342_10011386
402 Ga0307405_10032759
403 Ga0307405_10636081
404 Ga0307413_10001099
405 Ga0307413_10043261
406 Ga0307413_10649831
407 Ga0307410_10000920
408 Ga0307410_11022372
409 Ga0326468_10022291
410 Ga0307407_10001805
411 Ga0307407_10128108
412 Ga0307412_10076623
413 Ga0307409_100001126
414 Ga0307409_100092781
415 Ga0307409_100453197
416 Ga0307409_100738087
417 Ga0307416_100821756
418 Ga0307414_10029025
419 Ga0307411_10064771
420 Ga0307411_10305661
421 Ga0307415_100462347
422 Ga0373934_0006519
423 Ga0373934_0027925
424 Ga0373934_0043152
425 Ga0373923_0006031
426 Ga0373923_0247868
427 Ga0373936_0003023
428 Ga0373936_0009111
429 Ga0373953_0009967
430 Ga0373953_0277983
431 Ga0373954_0022061
432 Ga0373954_0026768
433 Ga0373954_0512259
434 Ga0373956_0010400
435 Ga0373956_0020482
436 Ga0373957_0010011
437 Ga0373957_0096033
438 Ga0373943_0263997
439 Ga0373946_0141824
440 Ga0373955_0067381
441 Ga0373955_0086444
442 Ga0373955_0139589
443 Ga0373955_0180155
444 Ga0373924_0017516
445 Ga0373924_0018608
446 Ga0373935_0025353
447 Ga0373935_0033280
448 Ga0373927_0119182
449 Ga0373927_0620936
450 Ga0373933_0004732
451 Ga0373933_0011986
452 Ga0373933_0149712
453 Ga0373933_0474971
454 Ga0373947_0044445
455 Ga0373947_0241064
456 Ga0373937_0001805
457 Ga0373937_0021138
458 Ga0373937_0068429
459 Ga0372808_005221
460 Ga0316584_0138819
461 Ga0373925_0086721
462 Ga0373925_0141957
463 Ga0373925_0507171
464 Ga0436364_1331007
465 Ga0451576_0000023
466 Ga0466967_0408165
467 Ga0495592_0056979
468 Ga0495592_0091035
469 Ga0495592_0353009
470 Ga0495592_0499096
471 Ga0495603_0027640
472 Ga0495629_0023845
473 Ga0495629_0033816
474 Ga0495641_0031678
475 Ga0495641_0042748
476 Ga0495641_0112995
477 Ga0495651_0043558
478 Ga0495651_0054276
479 Ga0495651_0083969
480 Ga0495653_0056050
481 Ga0495653_0067723
482 Ga0495653_0121838
483 Ga0495580_0152740
484 Ga0495580_0161477
485 Ga0495582_0015300
486 Ga0495582_0201851
487 Ga0495639_0012608
488 Ga0495639_0038069
489 Ga0495662_0002120
490 Ga0495662_0434217
491 Ga0495664_0028986
492 Ga0495664_0050351
493 Ga0495594_0571846
494 Ga0495608_0065304
495 Ga0495618_0036036
496 Ga0495618_0041396
497 Ga0495618_0304722
498 Ga0495628_0041937
499 Ga0495630_0066229
500 Ga0495630_0558731
501 Ga0495630_0591903
502 Ga0495630_1090330
503 Ga0495666_0020457
504 Ga0495666_0098991
505 Ga0495652_0043130
506 Ga0495652_0130146
507 Ga0495652_0192091
508 Ga0495665_0023315
509 Ga0495665_0057332
510 Ga0495665_0078212
511 Ga0495640_0027006
512 Ga0495640_0063861
513 Ga0495640_0105535
514 Ga0495586_0002888
515 Ga0495586_0225019
516 Ga0495587_0069756
517 Ga0495587_0082361
518 Ga0495587_0083404
519 Ga0495645_0055071
520 Ga0495645_0099204
521 Ga0495645_0126040
522 Ga0495667_0021114
523 Ga0495667_0066300
524 Ga0495634_0014534
525 Ga0495634_0028196
526 Ga0495634_0034703
527 Ga0495635_0228094
528 Ga0495657_0046786
529 Ga0495657_0208208
530 Ga0495599_0058182
531 Ga0495623_0181671
532 Ga0495646_0011785
533 Ga0495647_0172925
534 Ga0495658_0181949
535 Ga0495658_0226075
536 Ga0495658_0401912
537 Ga0495613_0050378
538 Ga0495613_0082450
539 Ga0495613_0085615
540 Ga0495624_0003494
541 Ga0495624_0022687
542 Ga0495624_0518249
543 Ga0495600_0006404
544 Ga0495600_0021551
545 Ga0495581_0027383
546 Ga0495581_0040463
547 Ga0495581_0164171
548 Ga0495604_0009518
549 Ga0495604_0042108
550 Ga0495604_0073625
551 Ga0495604_0179124
552 Ga0495674_0045698
553 Ga0495674_0153289
554 Ga0495674_0360153
555 Ga0495676_0103682
556 Ga0495676_0226358
557 Ga0495680_0084981
558 Ga0495680_0091354
559 Ga0495680_0139559
560 Ga0495675_0003239
561 Ga0495675_0016134
562 Ga0495675_0056386
563 Ga0495684_0081868
564 Ga0495684_0123067
565 Ga0495593_0034392
566 Ga0495593_0116615
567 Ga0495593_0133691
568 Ga0495602_0029127
569 Ga0495602_0052382
570 Ga0495602_0094327
571 Ga0495602_0129658
572 Ga0495614_0038761
573 Ga0496102_0000453
574 Ga0496105_1172592
575 Ga0496108_0867650
576 Ga0496109_0694796
577 Ga0496110_0542973
578 Ga0496124_0110397
579 Ga0496126_0000035
580 Ga0501031_0036487
581 Ga0501034_0039624
582 Ga0501039_0339716
583 Ga0501042_0115542
584 Ga0501070_0496344
585 Ga0501073_0704763
586 Ga0501035_0063723
587 nmdc:mga09592_661554_c1
588 nmdc:mga0a205_10803_c1
589 Ga0495601_0024542
590 Ga0495601_0325561
591 Ga0495612_0014580
592 Ga0495612_0052203
593 Ga0495595_0006264
594 Ga0495595_0021906
595 Ga0495619_0042698
596 Ga0495619_0053685
597 Ga0495619_0503866
598 Ga0501082_1238571
599 2862710211
600 2915772922
601 8008486856
602 8011351289
603 8025526113
604 8053950705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

35

142

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cmi-assembly1.cif.gz_A crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae 0.918 2 161
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9075 1 161
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.9032 1 161
7l8l-assembly1.cif.gz_A crystal structure of human r152h gpx4-u46c 0.902 1 162
2p31-assembly2.cif.gz_B crystal structure of human glutathione peroxidase 7 0.8929 2 161
ID Description Score Start End Superfamily
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9182 1 162 3.40.30.10
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9157 3 161 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9127 1 162 3.40.30.10
af_Q4CY93_66_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9088 9 161 3.40.30.10
af_A0A1D6K2D3_10_119_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9059 59 161 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1H3K3R3-F1-model_v4 Glutathione peroxidase 0.9662 1 161 GO:0004601
GO:0034599
AF-F8B149-F1-model_v4 Glutathione peroxidase 0.9604 1 162 GO:0004601
GO:0034599
AF-A0A6G9YQD5-F1-model_v4 Glutathione peroxidase 0.9591 1 162 GO:0004601
GO:0034599
AF-A0A7I9YSB1-F1-model_v4 Glutathione peroxidase 0.9589 4 162 GO:0004601
GO:0034599
AF-A0A1I9YY44-F1-model_v4 deleted 0.9579 7 162

Map