F396571

General Info

Members Datasets Scaffolds Average Seq Length
302 207 604 171

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100203436|Ga0307408_1002034363
Length 176
Sequence MLSFDIRDLDTKAAQVDDDLAADDPVWQETDVRPAGGLHVTGRLSSAGQGRWYFSGHIEGEATSACRRCLNEVRAGVDEDVHLFFAEEGDETASDDPDVYPIDPRARELDLRPAIREEWLLDVPAYALCREDCKGLCPSCGTDLNAGDCDCPPATDTRWDALRGVKGAMPDARRDA

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
160 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
182 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
183 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
184 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
185 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
186 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
187 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
188 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
189 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
190 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
191 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
192 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
193 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
194 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.66
Rhizosphere 97.68
Stem 0
Stem Tuber 0
Unclassified 25.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100203436 3300031548 Bacteria 1604
2 MBSR1b_contig_10136398 2162886012 Bacteria 1472
3 JGI25406J46586_10009907 3300003203 Bacteria 4254
4 Ga0070658_10003179 3300005327 Bacteria 13563
5 Ga0070658_11363249 3300005327 Bacteria 616
6 Ga0070676_10346344 3300005328 Bacteria 1020
7 Ga0070683_100107339 3300005329 Bacteria 2632
8 Ga0070683_101113528 3300005329 Unclassified 758
9 Ga0070690_100013930 3300005330 Bacteria 4766
10 Ga0070690_100173901 3300005330 Unclassified 1484
11 Ga0070670_100018049 3300005331 Bacteria 6056
12 Ga0070670_100079811 3300005331 Bacteria 2812
13 Ga0068869_100023404 3300005334 Bacteria 4265
14 Ga0070666_10083082 3300005335 Bacteria 2191
15 Ga0070666_10969264 3300005335 Unclassified 630
16 Ga0070680_100016681 3300005336 Bacteria 5782
17 Ga0070680_100084981 3300005336 Bacteria 2614
18 Ga0070680_100317711 3300005336 Bacteria 1322
19 Ga0070680_101143574 3300005336 Unclassified 673
20 Ga0070682_100018309 3300005337 Bacteria 4092
21 Ga0068868_100161129 3300005338 Bacteria 1853
22 Ga0070660_100010396 3300005339 Bacteria 6579
23 Ga0070660_100254112 3300005339 Bacteria 1434
24 Ga0070660_100318413 3300005339 Bacteria 1277
25 Ga0070689_100152072 3300005340 Bacteria 1867
26 Ga0070689_100329947 3300005340 Bacteria 1276
27 Ga0070661_100000287 3300005344 Bacteria 40709
28 Ga0070661_100125036 3300005344 Unclassified 1929
29 Ga0070661_100502265 3300005344 Bacteria 971
30 Ga0070692_10007826 3300005345 Bacteria 4733
31 Ga0070692_10026009 3300005345 Bacteria 2890
32 Ga0070692_10485374 3300005345 Bacteria 798
33 Ga0070692_10519599 3300005345 Unclassified 775
34 Ga0070669_100152411 3300005353 Bacteria 1790
35 Ga0070675_100677583 3300005354 Unclassified 938
36 Ga0070671_100057264 3300005355 Bacteria 3243
37 Ga0070673_100027113 3300005364 Bacteria 4243
38 Ga0070673_101027501 3300005364 Bacteria 768
39 Ga0070688_100226594 3300005365 Bacteria 1320
40 Ga0070688_100648040 3300005365 Unclassified 813
41 Ga0070659_101176410 3300005366 Bacteria 678
42 Ga0070667_100089229 3300005367 Bacteria 2648
43 Ga0070709_10002878 3300005434 Bacteria 9285
44 Ga0070700_100154902 3300005441 Bacteria 1571
45 Ga0070700_100254842 3300005441 Bacteria 1261
46 Ga0070694_100388437 3300005444 Bacteria 1090
47 Ga0070708_100000086 3300005445 Bacteria 61026
48 Ga0070663_100294101 3300005455 Bacteria 1298
49 Ga0070678_100260659 3300005456 Bacteria 1458
50 Ga0070662_100010600 3300005457 Bacteria 6058
51 Ga0070662_100836922 3300005457 Unclassified 783
52 Ga0070681_10000220 3300005458 Bacteria 44725
53 Ga0068867_100361210 3300005459 Bacteria 1215
54 Ga0070707_100009596 3300005468 Bacteria 8991
55 Ga0070698_100055473 3300005471 Bacteria 4018
56 Ga0070699_100162521 3300005518 Bacteria 1977
57 Ga0070699_100408661 3300005518 Bacteria 1228
58 Ga0070679_100140633 3300005530 Bacteria 2393
59 Ga0070679_100148848 3300005530 Unclassified 2318
60 Ga0070684_100176507 3300005535 Bacteria 1941
61 Ga0070684_100284355 3300005535 Bacteria 1516
62 Ga0070672_100024930 3300005543 Bacteria 4428
63 Ga0070672_100209843 3300005543 Bacteria 1631
64 Ga0070672_100867990 3300005543 Unclassified 796
65 Ga0070686_100372996 3300005544 Bacteria 1078
66 Ga0070696_100003407 3300005546 Bacteria 10604
67 Ga0070693_100015190 3300005547 Bacteria 3962
68 Ga0070693_100927609 3300005547 Unclassified 654
69 Ga0070693_101061005 3300005547 Bacteria 616
70 Ga0070704_100174598 3300005549 Bacteria 1713
71 Ga0068855_100038592 3300005563 Bacteria 5674
72 Ga0068855_100158318 3300005563 Unclassified 2572
73 Ga0068855_100207649 3300005563 Unclassified 2203
74 Ga0070664_100086957 3300005564 Bacteria 2701
75 Ga0070664_100355899 3300005564 Unclassified 1333
76 Ga0070664_100646377 3300005564 Unclassified 983
77 Ga0068856_100013251 3300005614 Bacteria 7984
78 Ga0070702_100000691 3300005615 Bacteria 12687
79 Ga0070702_100475681 3300005615 Bacteria 912
80 Ga0068852_100415700 3300005616 Bacteria 1326
81 Ga0068859_100003718 3300005617 Bacteria 15552
82 Ga0068859_100080985 3300005617 Bacteria 3288
83 Ga0068864_100005316 3300005618 Bacteria 10546
84 Ga0068861_100060099 3300005719 Unclassified 2912
85 Ga0068870_10077159 3300005840 Bacteria 1832
86 Ga0068863_100001868 3300005841 Bacteria 20951
87 Ga0068858_100186976 3300005842 Bacteria 1957
88 Ga0068858_100411259 3300005842 Unclassified 1300
89 Ga0068860_100047224 3300005843 Bacteria 4105
90 Ga0081539_10000103 3300005985 Bacteria 197839
91 Ga0081539_10008895 3300005985 Bacteria 8572
92 Ga0070716_100002271 3300006173 Bacteria 8855
93 Ga0097621_100045582 3300006237 Bacteria 3543
94 Ga0068871_100318212 3300006358 Bacteria 1369
95 Ga0075430_100001593 3300006846 Bacteria 18540
96 Ga0075430_100182189 3300006846 Bacteria 1747
97 Ga0075431_100188277 3300006847 Bacteria 2115
98 Ga0075433_10074830 3300006852 Bacteria 2980
99 Ga0075434_101034789 3300006871 Bacteria 835
100 Ga0075429_100015173 3300006880 Bacteria 6678
101 Ga0068865_101458575 3300006881 Unclassified 612
102 Ga0097620_100003718 3300006931 Bacteria 15552
103 Ga0097620_100080985 3300006931 Bacteria 3288
104 Ga0075435_100272418 3300007076 Bacteria 1444
105 Ga0075435_100556233 3300007076 Bacteria 994
106 Ga0105240_10539217 3300009093 Bacteria 1292
107 Ga0111539_10172388 3300009094 Bacteria 2527
108 Ga0105245_11982858 3300009098 Unclassified 635
109 Ga0114129_11728810 3300009147 Unclassified 763
110 Ga0105241_10074800 3300009174 Bacteria 2638
111 Ga0105242_10815781 3300009176 Unclassified 925
112 Ga0105248_10003770 3300009177 Bacteria 16785
113 Ga0105248_10197601 3300009177 Bacteria 2266
114 Ga0105238_10543832 3300009551 Bacteria 1165
115 Ga0105249_10920699 3300009553 Unclassified 942
116 Ga0105239_10010959 3300010375 Bacteria 10124
117 Ga0105246_10001860 3300011119 Bacteria 12702
118 Ga0105246_10471367 3300011119 Bacteria 1060
119 Ga0157373_10021069 3300013100 Bacteria 4733
120 Ga0157373_10048981 3300013100 Bacteria 3012
121 Ga0157373_11264048 3300013100 Unclassified 558
122 Ga0157371_10008239 3300013102 Bacteria 8332
123 Ga0157371_10123082 3300013102 Unclassified 1844
124 Ga0157369_11712448 3300013105 Unclassified 639
125 Ga0157374_10002627 3300013296 Bacteria 15149
126 Ga0157378_11275554 3300013297 Unclassified 775
127 Ga0157372_10001141 3300013307 Bacteria 28828
128 Ga0157372_10041455 3300013307 Bacteria 5091
129 Ga0157372_10068710 3300013307 Unclassified 3983
130 Ga0157372_10226025 3300013307 Bacteria 2170
131 Ga0157372_10424964 3300013307 Unclassified 1548
132 Ga0157372_10485208 3300013307 Bacteria 1441
133 Ga0157372_11217679 3300013307 Bacteria 870
134 Ga0157375_10116780 3300013308 Unclassified 2773
135 Ga0157375_11182139 3300013308 Unclassified 897
136 Ga0163163_10137377 3300014325 Bacteria 2486
137 Ga0163163_10890913 3300014325 Unclassified 953
138 Ga0157377_10009454 3300014745 Bacteria 4783
139 Ga0157376_10020258 3300014969 Bacteria 5141
140 Ga0207680_10218412 3300025903 Unclassified 1306
141 Ga0207699_10012910 3300025906 Bacteria 4258
142 Ga0207645_10518831 3300025907 Bacteria 807
143 Ga0207643_10013455 3300025908 Bacteria 4432
144 Ga0207705_10002455 3300025909 Bacteria 14287
145 Ga0207654_10009396 3300025911 Bacteria 4965
146 Ga0207707_10001633 3300025912 Bacteria 20685
147 Ga0207663_10913096 3300025916 Unclassified 702
148 Ga0207660_10003920 3300025917 Bacteria 9700
149 Ga0207660_10050120 3300025917 Bacteria 2964
150 Ga0207660_10935513 3300025917 Unclassified 707
151 Ga0207662_10891064 3300025918 Unclassified 630
152 Ga0207657_10048102 3300025919 Unclassified 3725
153 Ga0207657_10051524 3300025919 Bacteria 3578
154 Ga0207657_10083317 3300025919 Bacteria 2683
155 Ga0207649_10005833 3300025920 Bacteria 6667
156 Ga0207649_10046737 3300025920 Bacteria 2661
157 Ga0207649_10197561 3300025920 Unclassified 1418
158 Ga0207652_10006293 3300025921 Bacteria 9584
159 Ga0207652_10118195 3300025921 Bacteria 2356
160 Ga0207646_10009095 3300025922 Bacteria 9863
161 Ga0207681_10211454 3300025923 Bacteria 1495
162 Ga0207650_10068695 3300025925 Bacteria 2661
163 Ga0207650_10415613 3300025925 Unclassified 1115
164 Ga0207687_10049221 3300025927 Bacteria 2930
165 Ga0207644_10278460 3300025931 Bacteria 1342
166 Ga0207690_10040763 3300025932 Bacteria 3038
167 Ga0207706_10023545 3300025933 Bacteria 5529
168 Ga0207706_10138788 3300025933 Bacteria 2138
169 Ga0207706_10392178 3300025933 Unclassified 1204
170 Ga0207670_10112109 3300025936 Unclassified 1967
171 Ga0207670_10623421 3300025936 Unclassified 887
172 Ga0207704_10580214 3300025938 Bacteria 915
173 Ga0207665_10000198 3300025939 Bacteria 40191
174 Ga0207691_10009280 3300025940 Bacteria 9437
175 Ga0207691_10247026 3300025940 Bacteria 1541
176 Ga0207711_10008705 3300025941 Bacteria 8487
177 Ga0207711_10120389 3300025941 Bacteria 2343
178 Ga0207689_10021078 3300025942 Bacteria 5477
179 Ga0207661_10369731 3300025944 Bacteria 1296
180 Ga0207661_10398904 3300025944 Bacteria 1247
181 Ga0207661_10609179 3300025944 Bacteria 1003
182 Ga0207679_10001487 3300025945 Bacteria 14673
183 Ga0207679_10513293 3300025945 Unclassified 1071
184 Ga0207679_10701653 3300025945 Unclassified 918
185 Ga0207667_10194397 3300025949 Unclassified 2081
186 Ga0207651_10140174 3300025960 Unclassified 1866
187 Ga0207658_10048871 3300025986 Bacteria 3105
188 Ga0207677_10094826 3300026023 Bacteria 2179
189 Ga0207678_10842862 3300026067 Unclassified 810
190 Ga0207708_10196141 3300026075 Unclassified 1609
191 Ga0207708_10451170 3300026075 Bacteria 1071
192 Ga0207708_10510807 3300026075 Bacteria 1008
193 Ga0207641_10011787 3300026088 Bacteria 7178
194 Ga0207648_11042450 3300026089 Unclassified 766
195 Ga0207676_10001153 3300026095 Bacteria 19908
196 Ga0207674_10000603 3300026116 Bacteria 47253
197 Ga0207675_100259201 3300026118 Unclassified 1685
198 Ga0207683_11013882 3300026121 Unclassified 770
199 Ga0207698_10368412 3300026142 Bacteria 1363
200 Ga0209969_1015868 3300027360 Unclassified 1102
201 Ga0210000_1009840 3300027462 Unclassified 1410
202 Ga0209999_1022414 3300027543 Unclassified 1162
203 Ga0209971_1035052 3300027682 Bacteria 1207
204 Ga0209998_10000661 3300027717 Bacteria 9220
205 Ga0209974_10076364 3300027876 Bacteria 1148
206 Ga0207428_10176497 3300027907 Bacteria 1615
207 Ga0207428_10516493 3300027907 Bacteria 866
208 Ga0268264_10080400 3300028381 Bacteria 2783
209 Ga0307408_100283430 3300031548 Bacteria 1381
210 Ga0307408_100402953 3300031548 Archaea 1175
211 Ga0307405_10370259 3300031731 Unclassified 1112
212 Ga0307405_10988060 3300031731 Bacteria 717
213 Ga0307413_10287488 3300031824 Unclassified 1240
214 Ga0307413_10876170 3300031824 Bacteria 761
215 Ga0307410_10352887 3300031852 Bacteria 1176
216 Ga0307410_10639526 3300031852 Unclassified 891
217 Ga0307406_10061785 3300031901 Unclassified 2421
218 Ga0307406_10104006 3300031901 Bacteria 1940
219 Ga0307406_10550182 3300031901 Bacteria 944
220 Ga0307407_10536989 3300031903 Unclassified 862
221 Ga0307412_10073763 3300031911 Bacteria 2336
222 Ga0307412_10112346 3300031911 Bacteria 1947
223 Ga0307409_100072409 3300031995 Bacteria 2744
224 Ga0307409_100296574 3300031995 Bacteria 1502
225 Ga0307409_101269860 3300031995 Bacteria 761
226 Ga0307416_100010989 3300032002 Bacteria 6010
227 Ga0307416_100111863 3300032002 Bacteria 2409
228 Ga0307416_100115705 3300032002 Bacteria 2375
229 Ga0307416_100989571 3300032002 Unclassified 944
230 Ga0307414_10033390 3300032004 Bacteria 3401
231 Ga0307414_11438956 3300032004 Unclassified 641
232 Ga0307411_11086759 3300032005 Bacteria 720
233 Ga0307415_100102227 3300032126 Bacteria 2105
234 Ga0307415_100948082 3300032126 Unclassified 796
235 Ga0307415_101665394 3300032126 Unclassified 614
236 Ga0373959_0063890 3300034820 Unclassified 820
237 Ga0373929_0060810 3300035085 Bacteria 884
238 Ga0373939_0090559 3300035114 Unclassified 1033
239 Ga0373941_0027332 3300035115 Bacteria 1665
240 Ga0373943_0610844 3300035170 Unclassified 643
241 Ga0373961_0117735 3300035241 Unclassified 877
242 Ga0373931_0723515 3300035691 Unclassified 659
243 Ga0373937_0747092 3300036401 Unclassified 926
244 Ga0242420_010640 3300038996 Bacteria 1532
245 Ga0436365_1029712 3300039437 Bacteria 3574
246 Ga0439439_0028002 3300041406 Unclassified 1425
247 Ga0451841_0781810 3300041498 Bacteria 694
248 Ga0439433_0134159 3300041999 Bacteria 631
249 Ga0439434_0147246 3300042435 Bacteria 778
250 Ga0451576_0519671 3300045051 Bacteria 1251
251 Ga0451576_0855947 3300045051 Unclassified 954
252 Ga0466967_0234071 3300045976 Bacteria 1750
253 Ga0495629_0011640 3300046459 Bacteria 6387
254 Ga0495582_0091637 3300046473 Bacteria 1695
255 Ga0495645_0164860 3300046543 Unclassified 1529
256 Ga0495659_0176094 3300046664 Unclassified 869
257 Ga0495658_0016486 3300046683 Bacteria 3802
258 Ga0495581_0039242 3300047315 Bacteria 2741
259 Ga0496101_0175252 3300048904 Bacteria 1649
260 Ga0496106_0345554 3300048909 Bacteria 1195
261 Ga0496106_1120512 3300048909 Unclassified 616
262 Ga0496112_0028125 3300048915 Bacteria 5424
263 Ga0496115_0098357 3300048918 Bacteria 2396
264 Ga0501033_0108168 3300049570 Bacteria 2025
265 Ga0501036_0072705 3300049572 Bacteria 2907
266 Ga0501037_0284828 3300049573 Bacteria 1151
267 Ga0501038_0166902 3300049574 Bacteria 1785
268 Ga0501047_0194935 3300049581 Bacteria 1888
269 Ga0501072_0128411 3300049588 Bacteria 2020
270 Ga0501198_033215 3300049649 Bacteria 869
271 Ga0501224_009866 3300049664 Bacteria 1398
272 Ga0501235_014753 3300049669 Bacteria 1722
273 Ga0501239_030097 3300049672 Bacteria 709
274 Ga0501242_006821 3300049674 Bacteria 1309
275 Ga0501249_068517 3300049679 Bacteria 827
276 Ga0501249_091065 3300049679 Unclassified 723
277 Ga0501252_013331 3300049682 Bacteria 1004
278 Ga0501259_007848 3300049688 Bacteria 1711
279 Ga0501221_023713 3300049704 Bacteria 1225
280 Ga0501234_014383 3300049707 Bacteria 1243
281 Ga0501266_007362 3300049763 Bacteria 1378
282 Ga0501268_081812 3300049765 Bacteria 668
283 Ga0501272_001401 3300049769 Bacteria 2282
284 Ga0501279_010852 3300049775 Bacteria 1229
285 Ga0501035_0037229 3300049822 Bacteria 4407
286 Ga0501044_0084251 3300049823 Bacteria 3213
287 Ga0501045_1097881 3300049824 Unclassified 582
288 Ga0501212_029601 3300049851 Bacteria 879
289 nmdc:mga09592_48769_c1 3300050508 Bacteria 3570
290 nmdc:mga0qj67_7084_c1 3300050509 Bacteria 8272
291 nmdc:mga0qj67_73073_c1 3300050509 Bacteria 2739
292 nmdc:mga0qj67_78239_c1 3300050509 Bacteria 2647
293 nmdc:mga06r32_27309_c1 3300050510 Bacteria 5331
294 nmdc:mga06r32_32491_c1 3300050510 Bacteria 4911
295 nmdc:mga08y16_130878_c1 3300050511 Bacteria 2609
296 nmdc:mga0n895_124419_c1 3300050512 Bacteria 2602
297 nmdc:mga0n895_559022_c1 3300050512 Bacteria 1149
298 nmdc:mga0rr50_483088_c1 3300050513 Bacteria 1052
299 nmdc:mga08x19_31311_c1 3300050514 Bacteria 3346
300 nmdc:mga08x19_454027_c1 3300050514 Unclassified 902
301 nmdc:mga0a205_113251_c1 3300050515 Bacteria 2612
302 Ga0590071_007818 3300059421 Bacteria 2528
303 Ga0307408_100203436
304 MBSR1b_contig_10136398
305 JGI25406J46586_10009907
306 Ga0070658_10003179
307 Ga0070658_11363249
308 Ga0070676_10346344
309 Ga0070683_100107339
310 Ga0070683_101113528
311 Ga0070690_100013930
312 Ga0070690_100173901
313 Ga0070670_100018049
314 Ga0070670_100079811
315 Ga0068869_100023404
316 Ga0070666_10083082
317 Ga0070666_10969264
318 Ga0070680_100016681
319 Ga0070680_100084981
320 Ga0070680_100317711
321 Ga0070680_101143574
322 Ga0070682_100018309
323 Ga0068868_100161129
324 Ga0070660_100010396
325 Ga0070660_100254112
326 Ga0070660_100318413
327 Ga0070689_100152072
328 Ga0070689_100329947
329 Ga0070661_100000287
330 Ga0070661_100125036
331 Ga0070661_100502265
332 Ga0070692_10007826
333 Ga0070692_10026009
334 Ga0070692_10485374
335 Ga0070692_10519599
336 Ga0070669_100152411
337 Ga0070675_100677583
338 Ga0070671_100057264
339 Ga0070673_100027113
340 Ga0070673_101027501
341 Ga0070688_100226594
342 Ga0070688_100648040
343 Ga0070659_101176410
344 Ga0070667_100089229
345 Ga0070709_10002878
346 Ga0070700_100154902
347 Ga0070700_100254842
348 Ga0070694_100388437
349 Ga0070708_100000086
350 Ga0070663_100294101
351 Ga0070678_100260659
352 Ga0070662_100010600
353 Ga0070662_100836922
354 Ga0070681_10000220
355 Ga0068867_100361210
356 Ga0070707_100009596
357 Ga0070698_100055473
358 Ga0070699_100162521
359 Ga0070699_100408661
360 Ga0070679_100140633
361 Ga0070679_100148848
362 Ga0070684_100176507
363 Ga0070684_100284355
364 Ga0070672_100024930
365 Ga0070672_100209843
366 Ga0070672_100867990
367 Ga0070686_100372996
368 Ga0070696_100003407
369 Ga0070693_100015190
370 Ga0070693_100927609
371 Ga0070693_101061005
372 Ga0070704_100174598
373 Ga0068855_100038592
374 Ga0068855_100158318
375 Ga0068855_100207649
376 Ga0070664_100086957
377 Ga0070664_100355899
378 Ga0070664_100646377
379 Ga0068856_100013251
380 Ga0070702_100000691
381 Ga0070702_100475681
382 Ga0068852_100415700
383 Ga0068859_100003718
384 Ga0068859_100080985
385 Ga0068864_100005316
386 Ga0068861_100060099
387 Ga0068870_10077159
388 Ga0068863_100001868
389 Ga0068858_100186976
390 Ga0068858_100411259
391 Ga0068860_100047224
392 Ga0081539_10000103
393 Ga0081539_10008895
394 Ga0070716_100002271
395 Ga0097621_100045582
396 Ga0068871_100318212
397 Ga0075430_100001593
398 Ga0075430_100182189
399 Ga0075431_100188277
400 Ga0075433_10074830
401 Ga0075434_101034789
402 Ga0075429_100015173
403 Ga0068865_101458575
404 Ga0097620_100003718
405 Ga0097620_100080985
406 Ga0075435_100272418
407 Ga0075435_100556233
408 Ga0105240_10539217
409 Ga0111539_10172388
410 Ga0105245_11982858
411 Ga0114129_11728810
412 Ga0105241_10074800
413 Ga0105242_10815781
414 Ga0105248_10003770
415 Ga0105248_10197601
416 Ga0105238_10543832
417 Ga0105249_10920699
418 Ga0105239_10010959
419 Ga0105246_10001860
420 Ga0105246_10471367
421 Ga0157373_10021069
422 Ga0157373_10048981
423 Ga0157373_11264048
424 Ga0157371_10008239
425 Ga0157371_10123082
426 Ga0157369_11712448
427 Ga0157374_10002627
428 Ga0157378_11275554
429 Ga0157372_10001141
430 Ga0157372_10041455
431 Ga0157372_10068710
432 Ga0157372_10226025
433 Ga0157372_10424964
434 Ga0157372_10485208
435 Ga0157372_11217679
436 Ga0157375_10116780
437 Ga0157375_11182139
438 Ga0163163_10137377
439 Ga0163163_10890913
440 Ga0157377_10009454
441 Ga0157376_10020258
442 Ga0207680_10218412
443 Ga0207699_10012910
444 Ga0207645_10518831
445 Ga0207643_10013455
446 Ga0207705_10002455
447 Ga0207654_10009396
448 Ga0207707_10001633
449 Ga0207663_10913096
450 Ga0207660_10003920
451 Ga0207660_10050120
452 Ga0207660_10935513
453 Ga0207662_10891064
454 Ga0207657_10048102
455 Ga0207657_10051524
456 Ga0207657_10083317
457 Ga0207649_10005833
458 Ga0207649_10046737
459 Ga0207649_10197561
460 Ga0207652_10006293
461 Ga0207652_10118195
462 Ga0207646_10009095
463 Ga0207681_10211454
464 Ga0207650_10068695
465 Ga0207650_10415613
466 Ga0207687_10049221
467 Ga0207644_10278460
468 Ga0207690_10040763
469 Ga0207706_10023545
470 Ga0207706_10138788
471 Ga0207706_10392178
472 Ga0207670_10112109
473 Ga0207670_10623421
474 Ga0207704_10580214
475 Ga0207665_10000198
476 Ga0207691_10009280
477 Ga0207691_10247026
478 Ga0207711_10008705
479 Ga0207711_10120389
480 Ga0207689_10021078
481 Ga0207661_10369731
482 Ga0207661_10398904
483 Ga0207661_10609179
484 Ga0207679_10001487
485 Ga0207679_10513293
486 Ga0207679_10701653
487 Ga0207667_10194397
488 Ga0207651_10140174
489 Ga0207658_10048871
490 Ga0207677_10094826
491 Ga0207678_10842862
492 Ga0207708_10196141
493 Ga0207708_10451170
494 Ga0207708_10510807
495 Ga0207641_10011787
496 Ga0207648_11042450
497 Ga0207676_10001153
498 Ga0207674_10000603
499 Ga0207675_100259201
500 Ga0207683_11013882
501 Ga0207698_10368412
502 Ga0209969_1015868
503 Ga0210000_1009840
504 Ga0209999_1022414
505 Ga0209971_1035052
506 Ga0209998_10000661
507 Ga0209974_10076364
508 Ga0207428_10176497
509 Ga0207428_10516493
510 Ga0268264_10080400
511 Ga0307408_100283430
512 Ga0307408_100402953
513 Ga0307405_10370259
514 Ga0307405_10988060
515 Ga0307413_10287488
516 Ga0307413_10876170
517 Ga0307410_10352887
518 Ga0307410_10639526
519 Ga0307406_10061785
520 Ga0307406_10104006
521 Ga0307406_10550182
522 Ga0307407_10536989
523 Ga0307412_10073763
524 Ga0307412_10112346
525 Ga0307409_100072409
526 Ga0307409_100296574
527 Ga0307409_101269860
528 Ga0307416_100010989
529 Ga0307416_100111863
530 Ga0307416_100115705
531 Ga0307416_100989571
532 Ga0307414_10033390
533 Ga0307414_11438956
534 Ga0307411_11086759
535 Ga0307415_100102227
536 Ga0307415_100948082
537 Ga0307415_101665394
538 Ga0373959_0063890
539 Ga0373929_0060810
540 Ga0373939_0090559
541 Ga0373941_0027332
542 Ga0373943_0610844
543 Ga0373961_0117735
544 Ga0373931_0723515
545 Ga0373937_0747092
546 Ga0242420_010640
547 Ga0436365_1029712
548 Ga0439439_0028002
549 Ga0451841_0781810
550 Ga0439433_0134159
551 Ga0439434_0147246
552 Ga0451576_0519671
553 Ga0451576_0855947
554 Ga0466967_0234071
555 Ga0495629_0011640
556 Ga0495582_0091637
557 Ga0495645_0164860
558 Ga0495659_0176094
559 Ga0495658_0016486
560 Ga0495581_0039242
561 Ga0496101_0175252
562 Ga0496106_0345554
563 Ga0496106_1120512
564 Ga0496112_0028125
565 Ga0496115_0098357
566 Ga0501033_0108168
567 Ga0501036_0072705
568 Ga0501037_0284828
569 Ga0501038_0166902
570 Ga0501047_0194935
571 Ga0501072_0128411
572 Ga0501198_033215
573 Ga0501224_009866
574 Ga0501235_014753
575 Ga0501239_030097
576 Ga0501242_006821
577 Ga0501249_068517
578 Ga0501249_091065
579 Ga0501252_013331
580 Ga0501259_007848
581 Ga0501221_023713
582 Ga0501234_014383
583 Ga0501266_007362
584 Ga0501268_081812
585 Ga0501272_001401
586 Ga0501279_010852
587 Ga0501035_0037229
588 Ga0501044_0084251
589 Ga0501045_1097881
590 Ga0501212_029601
591 nmdc:mga09592_48769_c1
592 nmdc:mga0qj67_7084_c1
593 nmdc:mga0qj67_73073_c1
594 nmdc:mga0qj67_78239_c1
595 nmdc:mga06r32_27309_c1
596 nmdc:mga06r32_32491_c1
597 nmdc:mga08y16_130878_c1
598 nmdc:mga0n895_124419_c1
599 nmdc:mga0n895_559022_c1
600 nmdc:mga0rr50_483088_c1
601 nmdc:mga08x19_31311_c1
602 nmdc:mga08x19_454027_c1
603 nmdc:mga0a205_113251_c1
604 Ga0590071_007818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02620

YceD

Large ribosomal RNA subunit accumulation protein YceD

54

166

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g76-assembly1.cif.gz_A structure of paem, a colicin m-like bacteriocin produced by pseudomonas aeruginosa 0.5687 6 63
6fp6-assembly10.cif.gz_T complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.5669 10 64
5wd6-assembly1.cif.gz_A bovine salivary protein form 30b 0.5559 38 84
3ub1-assembly1.cif.gz_A ntf2 like protein involved in plasmid conjugation 0.5323 33 109
4n59-assembly3.cif.gz_A the crystal structure of pectocin m2 at 2.3 angstroms 0.5311 5 84
ID Description Score Start End Superfamily
4g76A02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Colicin M, catalytic domain 0.5499 6 63 3.30.450.400
af_I1N391_100_230_2.40.480.10 Mainly Beta;Beta Barrel;AOC barrel-like;Allene oxide cyclase-like 0.5427 13 80 2.40.480.10
af_P34686_90_270_3.90.1150.210 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;F-actin capping protein, beta subunit 0.5358 37 92 3.90.1150.210
4n59A02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Colicin M, catalytic domain 0.5185 5 84 3.30.450.400
3ub1A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.508 33 105 3.10.450.540
ID Description Score Start End GO Terms
AF-A0A7W0W2M4-F1-model_v4 DUF177 domain-containing protein 0.9384 1 115
AF-A0A7W0W2M4-F1-model_v4 DUF177 domain-containing protein 0.923 1 115
AF-A0A7V9T2G8-F1-model_v4 DUF177 domain-containing protein 0.8271 5 101
AF-A0A2V7M0H6-F1-model_v4 DUF177 domain-containing protein 0.8012 5 84
AF-A0A7V9T2G8-F1-model_v4 DUF177 domain-containing protein 0.7982 5 101

Map