F396559

General Info

Members Datasets Scaffolds Average Seq Length
302 201 604 315

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10339191|Ga0268265_103391912
Length 360
Sequence MRWERIRVARAPSAESRIPGPESRYRSELLDESGASVILFNPDLRMDAAIFDDLTALADATRSRMLLVLERQELTVGELCAVLQLPQSTVSRHLKTLADAGWVASRRDGTSRYYTLALDERGHATRRLWLLLREQVSLTSGADQDARRLKGVLARRQTASQEFFASGAGQWDRLRAEMFGSASYLQALPGLLDESWTIGDLGCGTGPAAAALAPFVASVIAVDRSHDMLQAARRRLREFENVEVRRGELEALPLDDASLDAATLLLVLHHVPDPGSALREAARVLRPGGRLLICDMLPHDHEDYRQQMGHVWLGFGADQMRKLLAAAGFDKVRIANLGADPAAKGPALFVASAVRAVASS

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
122 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.31
Nodule 0
Rhizoplane 2.98
Rhizosphere 93.38
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_10339191 3300028380 Bacteria 1368
2 Ga0065712_10080103 3300005290 Bacteria 3145
3 Ga0065712_10087818 3300005290 Unclassified 2553
4 Ga0065712_10100873 3300005290 Bacteria 2024
5 Ga0065712_10151842 3300005290 Bacteria 1364
6 Ga0065715_10033224 3300005293 Bacteria 2421
7 Ga0065707_10009747 3300005295 Bacteria 2600
8 Ga0070683_100021009 3300005329 Bacteria 5821
9 Ga0070683_100394673 3300005329 Bacteria 1319
10 Ga0070670_100021240 3300005331 Bacteria 5585
11 Ga0068869_100115853 3300005334 Bacteria 2044
12 Ga0070682_100148227 3300005337 Bacteria 1607
13 Ga0070689_100015946 3300005340 Bacteria 5491
14 Ga0070689_100228947 3300005340 Unclassified 1527
15 Ga0070661_100016188 3300005344 Bacteria 5266
16 Ga0070668_100331824 3300005347 Bacteria 1283
17 Ga0070669_100100867 3300005353 Bacteria 2177
18 Ga0070671_100094049 3300005355 Bacteria 2512
19 Ga0070671_100195655 3300005355 Bacteria 1714
20 Ga0070674_100127420 3300005356 Bacteria 1893
21 Ga0070674_100254767 3300005356 Unclassified 1380
22 Ga0070673_100008943 3300005364 Bacteria 6696
23 Ga0070673_100196833 3300005364 Bacteria 1734
24 Ga0070659_100047996 3300005366 Bacteria 3352
25 Ga0070659_100291883 3300005366 Bacteria 1358
26 Ga0070667_100182177 3300005367 Bacteria 1858
27 Ga0070709_10050604 3300005434 Bacteria 2604
28 Ga0070714_100190266 3300005435 Unclassified 1872
29 Ga0070713_100097068 3300005436 Bacteria 2546
30 Ga0070713_100412005 3300005436 Bacteria 1264
31 Ga0070701_10059092 3300005438 Bacteria 2014
32 Ga0070705_100296382 3300005440 Unclassified 1157
33 Ga0070700_100004998 3300005441 Bacteria 6986
34 Ga0070694_100224479 3300005444 Bacteria 1410
35 Ga0070663_100166033 3300005455 Bacteria 1703
36 Ga0070663_100386438 3300005455 Unclassified 1141
37 Ga0070678_100155316 3300005456 Bacteria 1848
38 Ga0068867_100033570 3300005459 Bacteria 3717
39 Ga0070698_100135699 3300005471 Bacteria 2414
40 Ga0070698_100209220 3300005471 Bacteria 1886
41 Ga0070679_100203611 3300005530 Bacteria 1944
42 Ga0070684_100000373 3300005535 Bacteria 30982
43 Ga0070684_100025307 3300005535 Bacteria 4988
44 Ga0070672_100093079 3300005543 Bacteria 2434
45 Ga0070695_100084916 3300005545 Bacteria 2101
46 Ga0070695_100294360 3300005545 Bacteria 1198
47 Ga0070693_100048094 3300005547 Bacteria 2428
48 Ga0070693_100072144 3300005547 Unclassified 2036
49 Ga0070664_100009399 3300005564 Bacteria 7927
50 Ga0070664_100089800 3300005564 Bacteria 2659
51 Ga0068857_100106655 3300005577 Bacteria 2516
52 Ga0070702_100038504 3300005615 Bacteria 2663
53 Ga0068852_100298625 3300005616 Unclassified 1558
54 Ga0068859_100053872 3300005617 Bacteria 4045
55 Ga0068859_100062709 3300005617 Bacteria 3748
56 Ga0068866_10030278 3300005718 Bacteria 2597
57 Ga0068861_100255701 3300005719 Bacteria 1497
58 Ga0068861_100334370 3300005719 Bacteria 1323
59 Ga0068858_100050851 3300005842 Bacteria 3835
60 Ga0068860_100257403 3300005843 Bacteria 1701
61 Ga0068862_100257601 3300005844 Bacteria 1591
62 Ga0081539_10016073 3300005985 Bacteria 5380
63 Ga0075365_10002001 3300006038 Bacteria 9658
64 Ga0075365_10073023 3300006038 Bacteria 2312
65 Ga0075363_100127833 3300006048 Bacteria 1424
66 Ga0075364_10007830 3300006051 Bacteria 6360
67 Ga0070712_100478212 3300006175 Bacteria 1041
68 Ga0075362_10007945 3300006177 Bacteria 4038
69 Ga0097621_100481926 3300006237 Bacteria 1121
70 Ga0068871_100133421 3300006358 Bacteria 2107
71 Ga0075428_100013714 3300006844 Bacteria 9024
72 Ga0075428_100259591 3300006844 Bacteria 1871
73 Ga0075430_100091465 3300006846 Bacteria 2544
74 Ga0075431_100233845 3300006847 Bacteria 1872
75 Ga0075431_100238201 3300006847 Bacteria 1852
76 Ga0075431_100436960 3300006847 Bacteria 1306
77 Ga0075433_10051125 3300006852 Bacteria 3598
78 Ga0075433_10109140 3300006852 Bacteria 2455
79 Ga0075433_10335245 3300006852 Bacteria 1337
80 Ga0075429_100010551 3300006880 Bacteria 7990
81 Ga0075429_100190472 3300006880 Bacteria 1797
82 Ga0075429_100241151 3300006880 Bacteria 1583
83 Ga0097620_100053874 3300006931 Bacteria 4045
84 Ga0097620_100062710 3300006931 Bacteria 3748
85 Ga0075435_100028415 3300007076 Bacteria 4387
86 Ga0105240_10096676 3300009093 Bacteria 3599
87 Ga0105240_10446779 3300009093 Bacteria 1448
88 Ga0105240_10645958 3300009093 Bacteria 1160
89 Ga0111539_10002170 3300009094 Bacteria 26233
90 Ga0111539_10019524 3300009094 Bacteria 8362
91 Ga0111539_10024104 3300009094 Bacteria 7473
92 Ga0111539_10327080 3300009094 Bacteria 1784
93 Ga0111539_10331171 3300009094 Bacteria 1772
94 Ga0105245_10293395 3300009098 Bacteria 1593
95 Ga0114129_10001222 3300009147 Bacteria 34134
96 Ga0114129_10034191 3300009147 Bacteria 7177
97 Ga0114129_10391366 3300009147 Bacteria 1833
98 Ga0114129_10508357 3300009147 Unclassified 1573
99 Ga0105241_10036931 3300009174 Bacteria 3678
100 Ga0105242_10076563 3300009176 Bacteria 2789
101 Ga0105248_10070654 3300009177 Bacteria 3920
102 Ga0105248_10110077 3300009177 Bacteria 3106
103 Ga0105248_10231201 3300009177 Bacteria 2082
104 Ga0105238_10000093 3300009551 Bacteria 100560
105 Ga0105238_10023988 3300009551 Bacteria 6220
106 Ga0105249_10001123 3300009553 Bacteria 23830
107 Ga0157372_10026313 3300013307 Bacteria 6330
108 Ga0157372_10456177 3300013307 Bacteria 1490
109 Ga0163163_10000003 3300014325 Bacteria 455102
110 Ga0163163_10016617 3300014325 Bacteria 6842
111 Ga0157376_10124473 3300014969 Bacteria 2290
112 Ga0206354_10379724 3300020081 Bacteria 1739
113 Ga0207697_10000133 3300025315 Bacteria 35922
114 Ga0207688_10082420 3300025901 Bacteria 1838
115 Ga0207705_10111330 3300025909 Bacteria 2023
116 Ga0207705_10155837 3300025909 Bacteria 1714
117 Ga0207654_10069481 3300025911 Bacteria 2087
118 Ga0207695_10277289 3300025913 Bacteria 1571
119 Ga0207695_10321550 3300025913 Bacteria 1437
120 Ga0207671_10422757 3300025914 Bacteria 1060
121 Ga0207693_10410164 3300025915 Bacteria 1059
122 Ga0207662_10010154 3300025918 Bacteria 5190
123 Ga0207662_10047556 3300025918 Bacteria 2541
124 Ga0207694_10000017 3300025924 Bacteria 342100
125 Ga0207650_10015553 3300025925 Bacteria 5301
126 Ga0207650_10040115 3300025925 Bacteria 3424
127 Ga0207687_10255166 3300025927 Bacteria 1396
128 Ga0207700_10028769 3300025928 Bacteria 3913
129 Ga0207700_10392946 3300025928 Bacteria 1214
130 Ga0207664_10305962 3300025929 Bacteria 1399
131 Ga0207644_10092449 3300025931 Bacteria 2257
132 Ga0207644_10171041 3300025931 Bacteria 1696
133 Ga0207644_10191145 3300025931 Bacteria 1609
134 Ga0207690_10032077 3300025932 Bacteria 3368
135 Ga0207690_10341052 3300025932 Unclassified 1183
136 Ga0207706_10055418 3300025933 Bacteria 3496
137 Ga0207670_10053529 3300025936 Bacteria 2719
138 Ga0207691_10022529 3300025940 Bacteria 5939
139 Ga0207691_10146561 3300025940 Bacteria 2078
140 Ga0207711_10075851 3300025941 Bacteria 2927
141 Ga0207711_10272857 3300025941 Bacteria 1556
142 Ga0207689_10046897 3300025942 Bacteria 3569
143 Ga0207689_10207739 3300025942 Bacteria 1617
144 Ga0207661_10056423 3300025944 Bacteria 3153
145 Ga0207661_10104799 3300025944 Unclassified 2382
146 Ga0207679_10166169 3300025945 Bacteria 1812
147 Ga0207679_10377804 3300025945 Bacteria 1241
148 Ga0207712_10068771 3300025961 Bacteria 2539
149 Ga0207640_10082763 3300025981 Bacteria 2198
150 Ga0207703_10029179 3300026035 Bacteria 4352
151 Ga0207703_10529242 3300026035 Bacteria 1109
152 Ga0207708_10008692 3300026075 Bacteria 7518
153 Ga0207648_10053592 3300026089 Bacteria 3525
154 Ga0207674_10062997 3300026116 Bacteria 3744
155 Ga0207675_100351298 3300026118 Unclassified 1445
156 Ga0207675_100384850 3300026118 Bacteria 1380
157 Ga0207428_10019422 3300027907 Bacteria 5795
158 Ga0207428_10204397 3300027907 Unclassified 1486
159 Ga0268264_10120513 3300028381 Bacteria 2311
160 Ga0268264_10552013 3300028381 Unclassified 1130
161 Ga0307408_100312216 3300031548 Bacteria 1321
162 Ga0307408_100340795 3300031548 Bacteria 1269
163 Ga0307413_10055127 3300031824 Bacteria 2417
164 Ga0307410_10353444 3300031852 Bacteria 1175
165 Ga0307409_100117200 3300031995 Bacteria 2247
166 Ga0307416_100129696 3300032002 Bacteria 2267
167 Ga0307415_100153828 3300032126 Bacteria 1774
168 Ga0307415_100186155 3300032126 Bacteria 1634
169 Ga0373959_0000170 3300034820 Bacteria 14689
170 Ga0373926_0027055 3300035083 Bacteria 2008
171 Ga0373934_0000534 3300035086 Bacteria 13433
172 Ga0373953_0018691 3300035117 Bacteria 2568
173 Ga0373954_0024538 3300035118 Bacteria 2750
174 Ga0373954_0116064 3300035118 Bacteria 1297
175 Ga0373956_0063480 3300035119 Bacteria 1675
176 Ga0373957_0018029 3300035120 Bacteria 2467
177 Ga0373955_0168255 3300035172 Bacteria 1296
178 Ga0373931_0260747 3300035691 Bacteria 1057
179 Ga0373933_0014444 3300035724 Bacteria 4394
180 Ga0373933_0100471 3300035724 Bacteria 1794
181 Ga0373947_0165135 3300035725 Bacteria 1434
182 Ga0373937_0000232 3300036401 Bacteria 54273
183 Ga0373937_0006167 3300036401 Bacteria 10326
184 Ga0373937_0022585 3300036401 Bacteria 5659
185 Ga0451839_0098068 3300041496 Bacteria 1289
186 Ga0439433_0013731 3300041999 Bacteria 1780
187 Ga0439433_0039932 3300041999 Bacteria 1090
188 Ga0439445_0033927 3300042004 Bacteria 1335
189 Ga0439446_0017343 3300042156 Bacteria 2012
190 Ga0439434_0028707 3300042435 Bacteria 1686
191 Ga0439460_0056057 3300042461 Bacteria 1193
192 Ga0451577_0001691 3300042876 Bacteria 28469
193 Ga0451577_0047611 3300042876 Bacteria 3833
194 Ga0466961_0004018 3300044693 Bacteria 9212
195 Ga0453684_0000294 3300044712 Bacteria 212051
196 Ga0451576_0010290 3300045051 Bacteria 10741
197 Ga0466967_0487062 3300045976 Unclassified 1209
198 Ga0495592_0028624 3300046454 Bacteria 4219
199 Ga0495651_0065640 3300046462 Bacteria 2771
200 Ga0495653_0019637 3300046463 Bacteria 5481
201 Ga0495580_0142158 3300046472 Bacteria 1663
202 Ga0495664_0113280 3300046477 Bacteria 1638
203 Ga0495594_0213153 3300046499 Bacteria 1101
204 Ga0495608_0085505 3300046511 Bacteria 2044
205 Ga0495608_0211806 3300046511 Bacteria 1218
206 Ga0495628_0133710 3300046516 Bacteria 1896
207 Ga0495643_0000059 3300046522 Bacteria 192508
208 Ga0495665_0014388 3300046531 Bacteria 4268
209 Ga0495586_0153328 3300046535 Bacteria 1297
210 Ga0495587_0000350 3300046536 Bacteria 32964
211 Ga0495667_0001991 3300046559 Bacteria 13532
212 Ga0495657_0061564 3300046675 Bacteria 2482
213 Ga0495599_0002031 3300046678 Bacteria 11712
214 Ga0495604_0135469 3300047317 Bacteria 1765
215 Ga0495680_0286925 3300047322 Bacteria 1159
216 Ga0495602_0228012 3300048088 Bacteria 1401
217 Ga0496104_0011026 3300048907 Bacteria 8086
218 Ga0496108_0088816 3300048911 Unclassified 2626
219 Ga0496109_0018747 3300048912 Bacteria 6085
220 Ga0496109_0521778 3300048912 Unclassified 1121
221 Ga0496110_0011957 3300048913 Bacteria 7130
222 Ga0496110_0039838 3300048913 Unclassified 4093
223 Ga0496112_0020498 3300048915 Bacteria 6268
224 Ga0496112_0118223 3300048915 Bacteria 2621
225 Ga0496113_0198604 3300048916 Bacteria 1594
226 Ga0501033_0077525 3300049570 Bacteria 2439
227 Ga0501034_0122770 3300049571 Bacteria 2583
228 Ga0501034_0260614 3300049571 Bacteria 1676
229 Ga0501034_0651184 3300049571 Bacteria 955
230 Ga0501036_0102102 3300049572 Bacteria 2426
231 Ga0501037_0097120 3300049573 Bacteria 2129
232 Ga0501037_0161320 3300049573 Bacteria 1598
233 Ga0501038_0024311 3300049574 Bacteria 5406
234 Ga0501038_0188594 3300049574 Bacteria 1660
235 Ga0501038_0377209 3300049574 Bacteria 1101
236 Ga0501040_0436393 3300049576 Unclassified 942
237 Ga0501042_0052074 3300049578 Bacteria 2920
238 Ga0501043_0004442 3300049579 Bacteria 11394
239 Ga0501043_0056400 3300049579 Bacteria 3086
240 Ga0501046_0011908 3300049580 Bacteria 7419
241 Ga0501046_0229616 3300049580 Unclassified 1372
242 Ga0501047_0000967 3300049581 Bacteria 29040
243 Ga0501047_0006790 3300049581 Bacteria 10752
244 Ga0501047_0034499 3300049581 Bacteria 4885
245 Ga0501047_0058554 3300049581 Bacteria 3721
246 Ga0501048_0205571 3300049582 Bacteria 1396
247 Ga0501067_0050517 3300049583 Bacteria 2304
248 Ga0501068_0165074 3300049584 Bacteria 1396
249 Ga0501070_0256631 3300049586 Bacteria 1429
250 Ga0501071_0022649 3300049587 Bacteria 4381
251 Ga0501072_0056558 3300049588 Bacteria 3091
252 Ga0501073_0016322 3300049589 Bacteria 5381
253 Ga0501073_0304982 3300049589 Unclassified 1098
254 Ga0501075_0066087 3300049591 Bacteria 2729
255 Ga0501075_0226717 3300049591 Bacteria 1425
256 Ga0501076_0236917 3300049592 Bacteria 1492
257 Ga0501077_0219980 3300049593 Bacteria 1207
258 Ga0501080_0030854 3300049742 Bacteria 4995
259 Ga0501083_0011953 3300049744 Bacteria 6081
260 Ga0501083_0272014 3300049744 Bacteria 1102
261 Ga0501035_0002491 3300049822 Bacteria 17989
262 Ga0501035_0202868 3300049822 Bacteria 1700
263 Ga0501044_0004437 3300049823 Bacteria 15700
264 nmdc:mga03683_25948_c1 3300050489 Bacteria 2307
265 nmdc:mga00v17_28463_c1 3300050491 Bacteria 3273
266 nmdc:mga0yw44_48368_c1 3300050492 Bacteria 2564
267 nmdc:mga06z11_44976_c1 3300050494 Bacteria 2230
268 nmdc:mga04h51_86174_c1 3300050495 Bacteria 1123
269 nmdc:mga05p37_115723_c1 3300050507 Bacteria 3296
270 nmdc:mga05p37_16912_c1 3300050507 Bacteria 8795
271 nmdc:mga05p37_416580_c1 3300050507 Bacteria 1564
272 nmdc:mga05p37_5_c1 3300050507 Bacteria 158201
273 nmdc:mga05p37_746035_c1 3300050507 Unclassified 1080
274 nmdc:mga05p37_8808_c1 3300050507 Bacteria 11924
275 nmdc:mga09592_14013_c1 3300050508 Bacteria 6544
276 nmdc:mga09592_37344_c1 3300050508 Bacteria 4075
277 nmdc:mga09592_75395_c1 3300050508 Bacteria 2867
278 nmdc:mga0qj67_194019_c1 3300050509 Unclassified 1650
279 nmdc:mga0qj67_255862_c1 3300050509 Bacteria 1421
280 nmdc:mga0qj67_71044_c1 3300050509 Bacteria 2778
281 nmdc:mga06r32_216917_c1 3300050510 Bacteria 1901
282 nmdc:mga06r32_368133_c1 3300050510 Bacteria 1421
283 nmdc:mga06r32_61677_c1 3300050510 Bacteria 3610
284 nmdc:mga08y16_523942_c1 3300050511 Bacteria 1202
285 nmdc:mga08y16_87718_c1 3300050511 Bacteria 3242
286 nmdc:mga0rr50_55630_c1 3300050513 Bacteria 2953
287 nmdc:mga0a205_129222_c1 3300050515 Bacteria 2427
288 nmdc:mga0a205_18396_c1 3300050515 Bacteria 6569
289 Ga0495601_0052285 3300053077 Bacteria 2579
290 Ga0495601_0073738 3300053077 Bacteria 2183
291 Ga0495612_0023993 3300053078 Bacteria 2449
292 Ga0495595_0043457 3300053084 Bacteria 2061
293 Ga0495619_0055843 3300053085 Bacteria 2617
294 Ga0501084_0022688 3300054114 Bacteria 5238
295 Ga0501084_0314323 3300054114 Bacteria 1323
296 Ga0590071_000223 3300059421 Bacteria 16790
297 Ga0590074_001310 3300059423 Bacteria 3962
298 Ga0590075_000583 3300059424 Bacteria 9850
299 Ga0590077_000139 3300059426 Bacteria 19862
300 Ga0590077_017136 3300059426 Bacteria 1522
301 Ga0501082_0021328 3300060353 Bacteria 5588
302 Ga0501082_0136653 3300060353 Bacteria 2127
303 Ga0268265_10339191
304 Ga0065712_10080103
305 Ga0065712_10087818
306 Ga0065712_10100873
307 Ga0065712_10151842
308 Ga0065715_10033224
309 Ga0065707_10009747
310 Ga0070683_100021009
311 Ga0070683_100394673
312 Ga0070670_100021240
313 Ga0068869_100115853
314 Ga0070682_100148227
315 Ga0070689_100015946
316 Ga0070689_100228947
317 Ga0070661_100016188
318 Ga0070668_100331824
319 Ga0070669_100100867
320 Ga0070671_100094049
321 Ga0070671_100195655
322 Ga0070674_100127420
323 Ga0070674_100254767
324 Ga0070673_100008943
325 Ga0070673_100196833
326 Ga0070659_100047996
327 Ga0070659_100291883
328 Ga0070667_100182177
329 Ga0070709_10050604
330 Ga0070714_100190266
331 Ga0070713_100097068
332 Ga0070713_100412005
333 Ga0070701_10059092
334 Ga0070705_100296382
335 Ga0070700_100004998
336 Ga0070694_100224479
337 Ga0070663_100166033
338 Ga0070663_100386438
339 Ga0070678_100155316
340 Ga0068867_100033570
341 Ga0070698_100135699
342 Ga0070698_100209220
343 Ga0070679_100203611
344 Ga0070684_100000373
345 Ga0070684_100025307
346 Ga0070672_100093079
347 Ga0070695_100084916
348 Ga0070695_100294360
349 Ga0070693_100048094
350 Ga0070693_100072144
351 Ga0070664_100009399
352 Ga0070664_100089800
353 Ga0068857_100106655
354 Ga0070702_100038504
355 Ga0068852_100298625
356 Ga0068859_100053872
357 Ga0068859_100062709
358 Ga0068866_10030278
359 Ga0068861_100255701
360 Ga0068861_100334370
361 Ga0068858_100050851
362 Ga0068860_100257403
363 Ga0068862_100257601
364 Ga0081539_10016073
365 Ga0075365_10002001
366 Ga0075365_10073023
367 Ga0075363_100127833
368 Ga0075364_10007830
369 Ga0070712_100478212
370 Ga0075362_10007945
371 Ga0097621_100481926
372 Ga0068871_100133421
373 Ga0075428_100013714
374 Ga0075428_100259591
375 Ga0075430_100091465
376 Ga0075431_100233845
377 Ga0075431_100238201
378 Ga0075431_100436960
379 Ga0075433_10051125
380 Ga0075433_10109140
381 Ga0075433_10335245
382 Ga0075429_100010551
383 Ga0075429_100190472
384 Ga0075429_100241151
385 Ga0097620_100053874
386 Ga0097620_100062710
387 Ga0075435_100028415
388 Ga0105240_10096676
389 Ga0105240_10446779
390 Ga0105240_10645958
391 Ga0111539_10002170
392 Ga0111539_10019524
393 Ga0111539_10024104
394 Ga0111539_10327080
395 Ga0111539_10331171
396 Ga0105245_10293395
397 Ga0114129_10001222
398 Ga0114129_10034191
399 Ga0114129_10391366
400 Ga0114129_10508357
401 Ga0105241_10036931
402 Ga0105242_10076563
403 Ga0105248_10070654
404 Ga0105248_10110077
405 Ga0105248_10231201
406 Ga0105238_10000093
407 Ga0105238_10023988
408 Ga0105249_10001123
409 Ga0157372_10026313
410 Ga0157372_10456177
411 Ga0163163_10000003
412 Ga0163163_10016617
413 Ga0157376_10124473
414 Ga0206354_10379724
415 Ga0207697_10000133
416 Ga0207688_10082420
417 Ga0207705_10111330
418 Ga0207705_10155837
419 Ga0207654_10069481
420 Ga0207695_10277289
421 Ga0207695_10321550
422 Ga0207671_10422757
423 Ga0207693_10410164
424 Ga0207662_10010154
425 Ga0207662_10047556
426 Ga0207694_10000017
427 Ga0207650_10015553
428 Ga0207650_10040115
429 Ga0207687_10255166
430 Ga0207700_10028769
431 Ga0207700_10392946
432 Ga0207664_10305962
433 Ga0207644_10092449
434 Ga0207644_10171041
435 Ga0207644_10191145
436 Ga0207690_10032077
437 Ga0207690_10341052
438 Ga0207706_10055418
439 Ga0207670_10053529
440 Ga0207691_10022529
441 Ga0207691_10146561
442 Ga0207711_10075851
443 Ga0207711_10272857
444 Ga0207689_10046897
445 Ga0207689_10207739
446 Ga0207661_10056423
447 Ga0207661_10104799
448 Ga0207679_10166169
449 Ga0207679_10377804
450 Ga0207712_10068771
451 Ga0207640_10082763
452 Ga0207703_10029179
453 Ga0207703_10529242
454 Ga0207708_10008692
455 Ga0207648_10053592
456 Ga0207674_10062997
457 Ga0207675_100351298
458 Ga0207675_100384850
459 Ga0207428_10019422
460 Ga0207428_10204397
461 Ga0268264_10120513
462 Ga0268264_10552013
463 Ga0307408_100312216
464 Ga0307408_100340795
465 Ga0307413_10055127
466 Ga0307410_10353444
467 Ga0307409_100117200
468 Ga0307416_100129696
469 Ga0307415_100153828
470 Ga0307415_100186155
471 Ga0373959_0000170
472 Ga0373926_0027055
473 Ga0373934_0000534
474 Ga0373953_0018691
475 Ga0373954_0024538
476 Ga0373954_0116064
477 Ga0373956_0063480
478 Ga0373957_0018029
479 Ga0373955_0168255
480 Ga0373931_0260747
481 Ga0373933_0014444
482 Ga0373933_0100471
483 Ga0373947_0165135
484 Ga0373937_0000232
485 Ga0373937_0006167
486 Ga0373937_0022585
487 Ga0451839_0098068
488 Ga0439433_0013731
489 Ga0439433_0039932
490 Ga0439445_0033927
491 Ga0439446_0017343
492 Ga0439434_0028707
493 Ga0439460_0056057
494 Ga0451577_0001691
495 Ga0451577_0047611
496 Ga0466961_0004018
497 Ga0453684_0000294
498 Ga0451576_0010290
499 Ga0466967_0487062
500 Ga0495592_0028624
501 Ga0495651_0065640
502 Ga0495653_0019637
503 Ga0495580_0142158
504 Ga0495664_0113280
505 Ga0495594_0213153
506 Ga0495608_0085505
507 Ga0495608_0211806
508 Ga0495628_0133710
509 Ga0495643_0000059
510 Ga0495665_0014388
511 Ga0495586_0153328
512 Ga0495587_0000350
513 Ga0495667_0001991
514 Ga0495657_0061564
515 Ga0495599_0002031
516 Ga0495604_0135469
517 Ga0495680_0286925
518 Ga0495602_0228012
519 Ga0496104_0011026
520 Ga0496108_0088816
521 Ga0496109_0018747
522 Ga0496109_0521778
523 Ga0496110_0011957
524 Ga0496110_0039838
525 Ga0496112_0020498
526 Ga0496112_0118223
527 Ga0496113_0198604
528 Ga0501033_0077525
529 Ga0501034_0122770
530 Ga0501034_0260614
531 Ga0501034_0651184
532 Ga0501036_0102102
533 Ga0501037_0097120
534 Ga0501037_0161320
535 Ga0501038_0024311
536 Ga0501038_0188594
537 Ga0501038_0377209
538 Ga0501040_0436393
539 Ga0501042_0052074
540 Ga0501043_0004442
541 Ga0501043_0056400
542 Ga0501046_0011908
543 Ga0501046_0229616
544 Ga0501047_0000967
545 Ga0501047_0006790
546 Ga0501047_0034499
547 Ga0501047_0058554
548 Ga0501048_0205571
549 Ga0501067_0050517
550 Ga0501068_0165074
551 Ga0501070_0256631
552 Ga0501071_0022649
553 Ga0501072_0056558
554 Ga0501073_0016322
555 Ga0501073_0304982
556 Ga0501075_0066087
557 Ga0501075_0226717
558 Ga0501076_0236917
559 Ga0501077_0219980
560 Ga0501080_0030854
561 Ga0501083_0011953
562 Ga0501083_0272014
563 Ga0501035_0002491
564 Ga0501035_0202868
565 Ga0501044_0004437
566 nmdc:mga03683_25948_c1
567 nmdc:mga00v17_28463_c1
568 nmdc:mga0yw44_48368_c1
569 nmdc:mga06z11_44976_c1
570 nmdc:mga04h51_86174_c1
571 nmdc:mga05p37_115723_c1
572 nmdc:mga05p37_16912_c1
573 nmdc:mga05p37_416580_c1
574 nmdc:mga05p37_5_c1
575 nmdc:mga05p37_746035_c1
576 nmdc:mga05p37_8808_c1
577 nmdc:mga09592_14013_c1
578 nmdc:mga09592_37344_c1
579 nmdc:mga09592_75395_c1
580 nmdc:mga0qj67_194019_c1
581 nmdc:mga0qj67_255862_c1
582 nmdc:mga0qj67_71044_c1
583 nmdc:mga06r32_216917_c1
584 nmdc:mga06r32_368133_c1
585 nmdc:mga06r32_61677_c1
586 nmdc:mga08y16_523942_c1
587 nmdc:mga08y16_87718_c1
588 nmdc:mga0rr50_55630_c1
589 nmdc:mga0a205_129222_c1
590 nmdc:mga0a205_18396_c1
591 Ga0495601_0052285
592 Ga0495601_0073738
593 Ga0495612_0023993
594 Ga0495595_0043457
595 Ga0495619_0055843
596 Ga0501084_0022688
597 Ga0501084_0314323
598 Ga0590071_000223
599 Ga0590074_001310
600 Ga0590075_000583
601 Ga0590077_000139
602 Ga0590077_017136
603 Ga0501082_0021328
604 Ga0501082_0136653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

199

293

0.98

PF08242

Methyltransf_12

Methyltransferase domain

200

291

0.97

PF12840

HTH_20

Helix-turn-helix domain

57

106

0.96

PF01022

HTH_5

Bacterial regulatory protein, arsR family

59

105

0.95

PF13649

Methyltransf_25

Methyltransferase domain

198

289

0.94

PF09339

HTH_IclR

IclR helix-turn-helix domain

54

107

0.93

PF12802

MarR_2

MarR family

58

112

0.92

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

189

307

0.91

PF01047

MarR

MarR family

63

112

0.9

PF13847

Methyltransf_31

Methyltransferase domain

192

328

0.87

PF13489

Methyltransf_23

Methyltransferase domain

169

334

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9223 1 73
3cuq-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.9186 27 72
6wlf-assembly2.cif.gz_B phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.8981 142 255
4ooi-assembly1.cif.gz_B reduced hlyu from vibrio cholerae n16961 0.8936 2 91
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.8933 17 73
ID Description Score Start End Superfamily
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9649 13 72 1.10.10.10
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9379 147 206 3.40.50.150
4nb5B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9324 29 74 1.10.10.10
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9266 5 72 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9225 18 73 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A561UTZ4-F1-model_v4 Methyltransferase family protein 0.9242 158 251 GO:0008168
GO:0032259
AF-A0A163SW12-F1-model_v4 HTH-type transcriptional regulator KmtR 0.92 2 88 GO:0003700
AF-A0A383DLZ6-F1-model_v4 HTH arsR-type domain-containing protein 0.9155 7 126 GO:0003700
AF-H1PJ79-F1-model_v4 HTH arsR-type domain-containing protein 0.9094 2 93 GO:0003700
AF-A0A4R1F4E6-F1-model_v4 ArsR family transcriptional regulator 0.9083 11 107 GO:0003700
GO:0046685

Map