F396380
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 302 | 212 | 286 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100023335|Ga0070665_1000233352 |
| Length | 162 |
| Sequence | MSLASVRAFFATHAPDIDVLVTEASSATVQLAAEAHGVKPEQIAKTICLRAGDRAMLIVTCGTARLDNRKFKDRFGGQKPRMLDADEVTRLTSHPVGGVCPFGLPQPMPVYCDVSLKAFDEVVPAAGATHAAVRIAPNRMAVLVDAEWIDVCQPPALAEPSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 4 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 5 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 6 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 7 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 8 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 9 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 10 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 11 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 12 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 13 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 14 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 15 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 16 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 17 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 18 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 19 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 80 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 81 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 132 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 133 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 138 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 139 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 143 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 144 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 146 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 147 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 148 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 149 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 152 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 181 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 182 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 183 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 184 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 200 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 201 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 202 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 203 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 204 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 205 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 206 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 207 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 208 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 210 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 211 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 212 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.37 |
| Metatranscriptomes | 0.33 |
| Isolates | 5.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.91 |
| Nodule | 1.32 |
| Rhizoplane | 1.32 |
| Rhizosphere | 74.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1000535 | 3300002738 | Bacteria | 18965 |
| 2 | JGI25150J39212_1004563 | 3300002774 | Bacteria | 3060 |
| 3 | JGI25406J46586_10000268 | 3300003203 | Bacteria | 23155 |
| 4 | Ga0055526_1000019 | 3300003771 | Bacteria | 189698 |
| 5 | Ga0055526_1000148 | 3300003771 | Bacteria | 61933 |
| 6 | Ga0055526_1000528 | 3300003771 | Bacteria | 30285 |
| 7 | Ga0055524_1010161 | 3300003775 | Bacteria | 3767 |
| 8 | Ga0070658_10007364 | 3300005327 | Bacteria | 8889 |
| 9 | Ga0070658_11041510 | 3300005327 | Bacteria | 712 |
| 10 | Ga0070676_10332071 | 3300005328 | Bacteria | 1040 |
| 11 | Ga0070683_100129394 | 3300005329 | Bacteria | 2388 |
| 12 | Ga0070690_100040236 | 3300005330 | Bacteria | 2956 |
| 13 | Ga0070670_100003405 | 3300005331 | Bacteria | 13186 |
| 14 | Ga0070680_100020445 | 3300005336 | Bacteria | 5254 |
| 15 | Ga0070691_10052074 | 3300005341 | Bacteria | 1957 |
| 16 | Ga0070661_100068629 | 3300005344 | Bacteria | 2605 |
| 17 | Ga0070671_100127796 | 3300005355 | Bacteria | 2140 |
| 18 | Ga0070674_100653862 | 3300005356 | Bacteria | 894 |
| 19 | Ga0070659_100067579 | 3300005366 | Bacteria | 2834 |
| 20 | Ga0070713_100062036 | 3300005436 | Bacteria | 3130 |
| 21 | Ga0070710_10331453 | 3300005437 | Bacteria | 1002 |
| 22 | Ga0070711_100645425 | 3300005439 | Bacteria | 887 |
| 23 | Ga0070678_100047959 | 3300005456 | Bacteria | 3073 |
| 24 | Ga0070681_10008181 | 3300005458 | Bacteria | 10237 |
| 25 | Ga0068867_100069268 | 3300005459 | Bacteria | 2635 |
| 26 | Ga0070679_100038200 | 3300005530 | Bacteria | 4772 |
| 27 | Ga0070684_100172547 | 3300005535 | Bacteria | 1964 |
| 28 | Ga0068853_100088386 | 3300005539 | Bacteria | 2720 |
| 29 | Ga0070693_100196323 | 3300005547 | Bacteria | 1308 |
| 30 | Ga0070665_100003905 | 3300005548 | Bacteria | 15758 |
| 31 | Ga0070665_100023335 | 3300005548 | Bacteria | 6228 |
| 32 | Ga0070665_100023966 | 3300005548 | Bacteria | 6146 |
| 33 | Ga0070665_100188933 | 3300005548 | Bacteria | 2061 |
| 34 | Ga0070665_100227225 | 3300005548 | Bacteria | 1866 |
| 35 | Ga0070665_100231292 | 3300005548 | Bacteria | 1848 |
| 36 | Ga0068855_100014728 | 3300005563 | Bacteria | 9421 |
| 37 | Ga0068855_100378990 | 3300005563 | Bacteria | 1553 |
| 38 | Ga0068855_100475701 | 3300005563 | Bacteria | 1360 |
| 39 | Ga0070664_100005729 | 3300005564 | Bacteria | 10012 |
| 40 | Ga0068857_100288127 | 3300005577 | Bacteria | 1512 |
| 41 | Ga0068856_100222240 | 3300005614 | Bacteria | 1904 |
| 42 | Ga0068856_100311249 | 3300005614 | Bacteria | 1592 |
| 43 | Ga0068852_100410630 | 3300005616 | Bacteria | 1334 |
| 44 | Ga0068851_10088070 | 3300005834 | Bacteria | 1631 |
| 45 | Ga0068860_101722350 | 3300005843 | Bacteria | 649 |
| 46 | Ga0081455_10012065 | 3300005937 | Bacteria | 8644 |
| 47 | Ga0081540_1160228 | 3300005983 | Bacteria | 874 |
| 48 | Ga0081539_10001411 | 3300005985 | Bacteria | 41377 |
| 49 | Ga0075365_11018294 | 3300006038 | Bacteria | 583 |
| 50 | Ga0075368_10187156 | 3300006042 | Bacteria | 874 |
| 51 | Ga0075368_10414489 | 3300006042 | Bacteria | 593 |
| 52 | Ga0075363_100241286 | 3300006048 | Bacteria | 1039 |
| 53 | Ga0075364_10086501 | 3300006051 | Bacteria | 2077 |
| 54 | Ga0070715_10071536 | 3300006163 | Bacteria | 1551 |
| 55 | Ga0075362_10050795 | 3300006177 | Bacteria | 1855 |
| 56 | Ga0075362_10116783 | 3300006177 | Bacteria | 1260 |
| 57 | Ga0075367_10042577 | 3300006178 | Bacteria | 2657 |
| 58 | Ga0075366_10047680 | 3300006195 | Bacteria | 2540 |
| 59 | Ga0105244_10018555 | 3300009036 | Bacteria | 3899 |
| 60 | Ga0105240_10031486 | 3300009093 | Bacteria | 6880 |
| 61 | Ga0105240_10245190 | 3300009093 | Bacteria | 2075 |
| 62 | Ga0105247_10244366 | 3300009101 | Bacteria | 1224 |
| 63 | Ga0105241_10380586 | 3300009174 | Bacteria | 1233 |
| 64 | Ga0105237_10000203 | 3300009545 | Bacteria | 84732 |
| 65 | Ga0105239_10042354 | 3300010375 | Bacteria | 4990 |
| 66 | Ga0105239_10044953 | 3300010375 | Bacteria | 4840 |
| 67 | Ga0105239_10687669 | 3300010375 | Bacteria | 1169 |
| 68 | Ga0157371_10045502 | 3300013102 | Bacteria | 3123 |
| 69 | Ga0157370_10918889 | 3300013104 | Bacteria | 794 |
| 70 | Ga0157369_10087860 | 3300013105 | Bacteria | 3319 |
| 71 | Ga0163162_10378103 | 3300013306 | Bacteria | 1549 |
| 72 | Ga0157372_10275222 | 3300013307 | Bacteria | 1957 |
| 73 | Ga0157372_10777062 | 3300013307 | Bacteria | 1113 |
| 74 | Ga0157375_11136298 | 3300013308 | Bacteria | 915 |
| 75 | Ga0163163_12169095 | 3300014325 | Bacteria | 615 |
| 76 | Ga0182008_10092113 | 3300014497 | Bacteria | 1495 |
| 77 | Ga0157377_10344821 | 3300014745 | Bacteria | 997 |
| 78 | Ga0182007_10132329 | 3300015262 | Bacteria | 839 |
| 79 | Ga0182007_10193316 | 3300015262 | Bacteria | 708 |
| 80 | Ga0206356_10292831 | 3300020070 | Bacteria | 1481 |
| 81 | Ga0213872_10000026 | 3300021361 | Bacteria | 149852 |
| 82 | Ga0213876_10484723 | 3300021384 | Bacteria | 658 |
| 83 | Ga0209437_102012 | 3300025233 | Bacteria | 4161 |
| 84 | Ga0207425_1000348 | 3300025245 | Bacteria | 32202 |
| 85 | Ga0209646_1000007 | 3300025246 | Bacteria | 670994 |
| 86 | Ga0209026_1015403 | 3300025250 | Bacteria | 1255 |
| 87 | Ga0209565_1028017 | 3300025263 | Bacteria | 1116 |
| 88 | Ga0209025_1002513 | 3300025294 | Bacteria | 19198 |
| 89 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 90 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 91 | Ga0209564_1000752 | 3300025295 | Bacteria | 45914 |
| 92 | Ga0209256_1000378 | 3300025299 | Bacteria | 71376 |
| 93 | Ga0207426_1036980 | 3300025302 | Bacteria | 1548 |
| 94 | Ga0209051_1062265 | 3300025303 | Bacteria | 1168 |
| 95 | Ga0207656_10139653 | 3300025321 | Bacteria | 1141 |
| 96 | Ga0207655_1027078 | 3300025728 | Bacteria | 2739 |
| 97 | Ga0207688_10011513 | 3300025901 | Bacteria | 4814 |
| 98 | Ga0207647_10080801 | 3300025904 | Bacteria | 1949 |
| 99 | Ga0207685_10126815 | 3300025905 | Bacteria | 1128 |
| 100 | Ga0207645_10058123 | 3300025907 | Bacteria | 2469 |
| 101 | Ga0207645_10424785 | 3300025907 | Bacteria | 896 |
| 102 | Ga0207705_10092721 | 3300025909 | Bacteria | 2213 |
| 103 | Ga0207707_10007348 | 3300025912 | Bacteria | 9596 |
| 104 | Ga0207695_10075514 | 3300025913 | Bacteria | 3429 |
| 105 | Ga0207671_10000177 | 3300025914 | Bacteria | 97072 |
| 106 | Ga0207660_10008039 | 3300025917 | Bacteria | 6821 |
| 107 | Ga0207657_10137810 | 3300025919 | Bacteria | 1995 |
| 108 | Ga0207652_10079248 | 3300025921 | Bacteria | 2869 |
| 109 | Ga0207652_10578921 | 3300025921 | Bacteria | 1008 |
| 110 | Ga0207694_10027772 | 3300025924 | Bacteria | 4311 |
| 111 | Ga0207650_10056269 | 3300025925 | Bacteria | 2922 |
| 112 | Ga0207659_10143948 | 3300025926 | Bacteria | 1854 |
| 113 | Ga0207690_10271177 | 3300025932 | Bacteria | 1318 |
| 114 | Ga0207669_10095608 | 3300025937 | Bacteria | 1948 |
| 115 | Ga0207661_10232946 | 3300025944 | Bacteria | 1631 |
| 116 | Ga0207679_10162396 | 3300025945 | Bacteria | 1830 |
| 117 | Ga0207667_10104209 | 3300025949 | Bacteria | 2926 |
| 118 | Ga0207667_10132476 | 3300025949 | Bacteria | 2568 |
| 119 | Ga0207667_10158188 | 3300025949 | Bacteria | 2331 |
| 120 | Ga0207640_10675220 | 3300025981 | Bacteria | 883 |
| 121 | Ga0207640_11566608 | 3300025981 | Bacteria | 593 |
| 122 | Ga0207658_10887368 | 3300025986 | Bacteria | 812 |
| 123 | Ga0207678_11409424 | 3300026067 | Bacteria | 616 |
| 124 | Ga0207702_10033995 | 3300026078 | Bacteria | 4261 |
| 125 | Ga0207702_10201280 | 3300026078 | Bacteria | 1846 |
| 126 | Ga0207648_10603576 | 3300026089 | Bacteria | 1012 |
| 127 | Ga0207674_10206372 | 3300026116 | Bacteria | 1914 |
| 128 | Ga0207674_10604676 | 3300026116 | Bacteria | 1059 |
| 129 | Ga0207675_100118676 | 3300026118 | Bacteria | 2502 |
| 130 | Ga0207683_10068662 | 3300026121 | Bacteria | 3129 |
| 131 | Ga0207683_10438965 | 3300026121 | Bacteria | 1203 |
| 132 | Ga0207698_10042262 | 3300026142 | Bacteria | 3403 |
| 133 | Ga0268266_10003595 | 3300028379 | Bacteria | 15341 |
| 134 | Ga0268266_10139292 | 3300028379 | Bacteria | 2176 |
| 135 | Ga0268266_10481150 | 3300028379 | Bacteria | 1183 |
| 136 | Ga0268266_11098808 | 3300028379 | Bacteria | 769 |
| 137 | Ga0268265_10227422 | 3300028380 | Bacteria | 1637 |
| 138 | Ga0307408_100119940 | 3300031548 | Bacteria | 2036 |
| 139 | Ga0307408_100193880 | 3300031548 | Bacteria | 1639 |
| 140 | Ga0307408_100396181 | 3300031548 | Bacteria | 1184 |
| 141 | Ga0307405_10302295 | 3300031731 | Bacteria | 1214 |
| 142 | Ga0307410_10070158 | 3300031852 | Bacteria | 2426 |
| 143 | Ga0307410_10352359 | 3300031852 | Bacteria | 1177 |
| 144 | Ga0307407_10014299 | 3300031903 | Bacteria | 3882 |
| 145 | Ga0307412_10096255 | 3300031911 | Bacteria | 2083 |
| 146 | Ga0307412_10987660 | 3300031911 | Bacteria | 743 |
| 147 | Ga0307416_100074420 | 3300032002 | Bacteria | 2837 |
| 148 | Ga0307416_100431582 | 3300032002 | Bacteria | 1365 |
| 149 | Ga0307414_10295974 | 3300032004 | Bacteria | 1367 |
| 150 | Ga0307415_100625707 | 3300032126 | Bacteria | 961 |
| 151 | Ga0373961_0091194 | 3300035241 | Bacteria | 974 |
| 152 | Ga0373924_0039259 | 3300035410 | Bacteria | 1934 |
| 153 | Ga0373931_0314531 | 3300035691 | Bacteria | 971 |
| 154 | Ga0373931_0318727 | 3300035691 | Bacteria | 965 |
| 155 | Ga0373927_0120699 | 3300035695 | Bacteria | 1711 |
| 156 | Ga0373937_0255856 | 3300036401 | Bacteria | 1651 |
| 157 | Ga0373937_0448692 | 3300036401 | Bacteria | 1225 |
| 158 | Ga0373925_0361531 | 3300037068 | Bacteria | 1180 |
| 159 | Ga0373925_0535288 | 3300037068 | Bacteria | 963 |
| 160 | Ga0395899_0002769 | 3300037312 | Bacteria | 14150 |
| 161 | Ga0395899_0015673 | 3300037312 | Bacteria | 5780 |
| 162 | Ga0395900_0004636 | 3300037418 | Bacteria | 14500 |
| 163 | Ga0395900_0005759 | 3300037418 | Bacteria | 12949 |
| 164 | Ga0395898_0047948 | 3300037466 | Bacteria | 4190 |
| 165 | Ga0395905_0477138 | 3300037471 | Unclassified | 1146 |
| 166 | Ga0395901_0004425 | 3300038443 | Bacteria | 14169 |
| 167 | Ga0395901_0005311 | 3300038443 | Bacteria | 13017 |
| 168 | Ga0436361_0287447 | 3300039447 | Bacteria | 113524 |
| 169 | Ga0451797_0031610 | 3300041453 | Bacteria | 592 |
| 170 | Ga0451807_2245727 | 3300041486 | Bacteria | 628 |
| 171 | Ga0451845_0997305 | 3300041501 | Bacteria | 667 |
| 172 | Ga0439431_0088384 | 3300041997 | Bacteria | 842 |
| 173 | Ga0439445_0041455 | 3300042004 | Bacteria | 1224 |
| 174 | Ga0466965_0219698 | 3300044683 | Bacteria | 1012 |
| 175 | Ga0466963_0166329 | 3300044694 | Bacteria | 1536 |
| 176 | Ga0466957_0007211 | 3300044842 | Bacteria | 6284 |
| 177 | Ga0466967_0199490 | 3300045976 | Bacteria | 1894 |
| 178 | Ga0495627_079421 | 3300046453 | Bacteria | 952 |
| 179 | Ga0495590_0000005 | 3300046457 | Bacteria | 384276 |
| 180 | Ga0495638_0000436 | 3300046460 | Bacteria | 50390 |
| 181 | Ga0495638_0225103 | 3300046460 | Bacteria | 1046 |
| 182 | Ga0495650_0000648 | 3300046471 | Bacteria | 45807 |
| 183 | Ga0495650_0001609 | 3300046471 | Bacteria | 21115 |
| 184 | Ga0495650_0003360 | 3300046471 | Bacteria | 11741 |
| 185 | Ga0495605_0000038 | 3300046474 | Bacteria | 197063 |
| 186 | Ga0495607_0032592 | 3300046501 | Bacteria | 3179 |
| 187 | Ga0495583_0000709 | 3300046506 | Bacteria | 42771 |
| 188 | Ga0495606_0000053 | 3300046507 | Bacteria | 200818 |
| 189 | Ga0495606_0001197 | 3300046507 | Bacteria | 36483 |
| 190 | Ga0495606_0010494 | 3300046507 | Bacteria | 7677 |
| 191 | Ga0495610_0000181 | 3300046512 | Bacteria | 70215 |
| 192 | Ga0495610_0017276 | 3300046512 | Bacteria | 4117 |
| 193 | Ga0495610_0077999 | 3300046512 | Bacteria | 1528 |
| 194 | Ga0495610_0131025 | 3300046512 | Bacteria | 1089 |
| 195 | Ga0495610_0288596 | 3300046512 | Bacteria | 636 |
| 196 | Ga0495610_0311795 | 3300046512 | Bacteria | 603 |
| 197 | Ga0495643_0000195 | 3300046522 | Bacteria | 96110 |
| 198 | Ga0495643_0000516 | 3300046522 | Bacteria | 48137 |
| 199 | Ga0495643_0103381 | 3300046522 | Bacteria | 1457 |
| 200 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 201 | Ga0495648_0060615 | 3300046524 | Bacteria | 2250 |
| 202 | Ga0495648_0316912 | 3300046524 | Bacteria | 724 |
| 203 | Ga0495642_0004406 | 3300046528 | Bacteria | 5467 |
| 204 | Ga0495609_0017476 | 3300046538 | Bacteria | 3331 |
| 205 | Ga0495609_0048806 | 3300046538 | Bacteria | 1890 |
| 206 | Ga0495609_0148075 | 3300046538 | Bacteria | 999 |
| 207 | Ga0495597_0000322 | 3300046542 | Bacteria | 43315 |
| 208 | Ga0495597_0000530 | 3300046542 | Bacteria | 31626 |
| 209 | Ga0495622_0000471 | 3300046557 | Bacteria | 25560 |
| 210 | Ga0495633_0000567 | 3300046558 | Bacteria | 36076 |
| 211 | Ga0495633_0005198 | 3300046558 | Bacteria | 8038 |
| 212 | Ga0495633_0006408 | 3300046558 | Bacteria | 6981 |
| 213 | Ga0495633_0034889 | 3300046558 | Bacteria | 2418 |
| 214 | Ga0495668_0000968 | 3300046616 | Bacteria | 31788 |
| 215 | Ga0495668_0005696 | 3300046616 | Bacteria | 8339 |
| 216 | Ga0495625_0000124 | 3300046660 | Bacteria | 120849 |
| 217 | Ga0495625_0000468 | 3300046660 | Bacteria | 60719 |
| 218 | Ga0495625_0008806 | 3300046660 | Bacteria | 8543 |
| 219 | Ga0495625_0013263 | 3300046660 | Bacteria | 6631 |
| 220 | Ga0495625_0258735 | 3300046660 | Bacteria | 1127 |
| 221 | Ga0495658_0448620 | 3300046683 | Bacteria | 824 |
| 222 | Ga0495671_0005616 | 3300046692 | Bacteria | 7316 |
| 223 | Ga0495671_0058590 | 3300046692 | Bacteria | 1905 |
| 224 | Ga0495649_0004375 | 3300046694 | Bacteria | 9243 |
| 225 | Ga0495649_0026971 | 3300046694 | Bacteria | 3190 |
| 226 | Ga0495649_0103299 | 3300046694 | Bacteria | 1513 |
| 227 | Ga0495660_0009394 | 3300046810 | Bacteria | 5704 |
| 228 | Ga0495672_0000398 | 3300047320 | Bacteria | 52924 |
| 229 | Ga0495687_000768 | 3300047443 | Bacteria | 34771 |
| 230 | Ga0495687_001376 | 3300047443 | Bacteria | 22480 |
| 231 | Ga0495677_0092091 | 3300047445 | Bacteria | 1143 |
| 232 | Ga0495677_0106204 | 3300047445 | Bacteria | 1065 |
| 233 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 234 | Ga0495673_0000199 | 3300047469 | Bacteria | 93637 |
| 235 | Ga0495673_0211048 | 3300047469 | Bacteria | 722 |
| 236 | Ga0495686_0007750 | 3300047472 | Bacteria | 7999 |
| 237 | Ga0495615_0002001 | 3300048090 | Bacteria | 3168 |
| 238 | Ga0496112_1170420 | 3300048915 | Bacteria | 686 |
| 239 | Ga0496114_0460487 | 3300048917 | Bacteria | 1126 |
| 240 | Ga0496119_0126999 | 3300048922 | Bacteria | 1394 |
| 241 | Ga0496122_0191405 | 3300048925 | Bacteria | 1207 |
| 242 | Ga0496123_0172112 | 3300048926 | Bacteria | 1141 |
| 243 | Ga0496123_0173739 | 3300048926 | Bacteria | 1133 |
| 244 | Ga0496124_0071115 | 3300048927 | Bacteria | 2885 |
| 245 | Ga0496124_0691225 | 3300048927 | Bacteria | 648 |
| 246 | Ga0496125_0000099 | 3300048928 | Bacteria | 203333 |
| 247 | Ga0496125_0004213 | 3300048928 | Bacteria | 16756 |
| 248 | Ga0496126_0092475 | 3300048929 | Bacteria | 2657 |
| 249 | Ga0496126_0126416 | 3300048929 | Bacteria | 2212 |
| 250 | Ga0496126_0754189 | 3300048929 | Bacteria | 751 |
| 251 | Ga0496126_0937380 | 3300048929 | Bacteria | 654 |
| 252 | Ga0495678_000291 | 3300049459 | Bacteria | 55271 |
| 253 | Ga0495678_001981 | 3300049459 | Bacteria | 14750 |
| 254 | Ga0495678_003460 | 3300049459 | Bacteria | 9782 |
| 255 | Ga0501033_0563573 | 3300049570 | Bacteria | 784 |
| 256 | Ga0501034_0000708 | 3300049571 | Bacteria | 50605 |
| 257 | Ga0501034_0003790 | 3300049571 | Bacteria | 17063 |
| 258 | Ga0501034_0981775 | 3300049571 | Bacteria | 729 |
| 259 | Ga0501036_0738754 | 3300049572 | Bacteria | 812 |
| 260 | Ga0501037_0355403 | 3300049573 | Bacteria | 1010 |
| 261 | Ga0501046_0403286 | 3300049580 | Bacteria | 987 |
| 262 | Ga0501047_0297302 | 3300049581 | Bacteria | 1457 |
| 263 | Ga0501068_0010955 | 3300049584 | Bacteria | 5104 |
| 264 | Ga0501070_0070467 | 3300049586 | Bacteria | 2895 |
| 265 | Ga0501035_1144547 | 3300049822 | Bacteria | 606 |
| 266 | Ga0501035_1225827 | 3300049822 | Bacteria | 581 |
| 267 | Ga0501044_0093314 | 3300049823 | Bacteria | 3035 |
| 268 | Ga0501044_0396504 | 3300049823 | Bacteria | 1293 |
| 269 | nmdc:mga03683_73522_c1 | 3300050489 | Bacteria | 1465 |
| 270 | nmdc:mga03683_77772_c1 | 3300050489 | Bacteria | 1428 |
| 271 | nmdc:mga03683_89333_c1 | 3300050489 | Bacteria | 1341 |
| 272 | nmdc:mga03n38_180839_c1 | 3300050490 | Bacteria | 1080 |
| 273 | nmdc:mga03n38_454645_c1 | 3300050490 | Bacteria | 713 |
| 274 | nmdc:mga0yw44_280627_c1 | 3300050492 | Bacteria | 1113 |
| 275 | nmdc:mga0yw44_44198_c1 | 3300050492 | Bacteria | 2664 |
| 276 | nmdc:mga0k408_43779_c1 | 3300050493 | Bacteria | 2581 |
| 277 | nmdc:mga06z11_864677_c1 | 3300050494 | Bacteria | 551 |
| 278 | nmdc:mga04h51_152815_c1 | 3300050495 | Bacteria | 883 |
| 279 | nmdc:mga0sz30_212355_c1 | 3300050516 | Bacteria | 860 |
| 280 | Ga0500610_0280549 | 3300053079 | Bacteria | 748 |
| 281 | Ga0500647_0027056 | 3300053091 | Bacteria | 2709 |
| 282 | Ga0500618_000332 | 3300053125 | Bacteria | 34213 |
| 283 | Ga0500586_001122 | 3300053145 | Bacteria | 5534 |
| 284 | Ga0500616_0002469 | 3300053153 | Bacteria | 15343 |
| 285 | Ga0500634_0212239 | 3300053161 | Bacteria | 839 |
| 286 | Ga0500609_019142 | 3300053731 | Bacteria | 933 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300015262 | Ga0182007_10132329 | Ga0182007_101323292 | 131 |
| 2 | 3300053079 | Ga0500610_0280549 | Ga0500610_0280549_12_461 | 147 |
| 3 | iso_pu_bacteria | 2508501050 | 2508735091 | 147 |
| 4 | iso_pu_bacteria | 2508501114 | 2509078720 | 147 |
| 5 | iso_pu_bacteria | 2835312727 | 2835319296 | 147 |
| 6 | iso_pu_bacteria | 2857558681 | 2857560100 | 147 |
| 7 | iso_pu_bacteria | 2891373044 | 2891374844 | 147 |
| 8 | iso_pu_bacteria | 2894232714 | 2894236315 | 147 |
| 9 | iso_pu_bacteria | 2924762789 | 2924763472 | 147 |
| 10 | iso_pu_bacteria | 2987666974 | 2987667701 | 147 |
| 11 | iso_pu_bacteria | 2818991467 | 2819721168 | 148 |
| 12 | iso_pu_bacteria | 2643221733 | 2644729041 | 149 |
| 13 | iso_pu_bacteria | 2643221734 | 2644734078 | 149 |
| 14 | iso_pu_bacteria | 2773857925 | 2774872490 | 149 |
| 15 | iso_pu_bacteria | 2882456835 | 2882460013 | 149 |
| 16 | iso_pu_bacteria | 2884298095 | 2884300327 | 149 |
| 17 | iso_pu_bacteria | 2917699015 | 2917703164 | 149 |
| 18 | iso_pu_bacteria | 3003665799 | 3003666960 | 149 |
| 19 | 3300006042 | Ga0075368_10414489 | Ga0075368_104144891 | 150 |
| 20 | 3300006195 | Ga0075366_10047680 | Ga0075366_100476805 | 150 |
| 21 | 3300036401 | Ga0373937_0448692 | Ga0373937_0448692_491_946 | 150 |
| 22 | 3300050493 | nmdc:mga0k408_43779_c1 | nmdc:mga0k408_43779_c1_1694_2149 | 150 |
| 23 | 3300050494 | nmdc:mga06z11_864677_c1 | nmdc:mga06z11_864677_c1_37_492 | 150 |
| 24 | 3300002774 | JGI25150J39212_1004563 | JGI25150J39212_10045632 | 151 |
| 25 | 3300003771 | Ga0055526_1000019 | Ga0055526_1000019132 | 151 |
| 26 | 3300003771 | Ga0055526_1000148 | Ga0055526_100014840 | 151 |
| 27 | 3300005327 | Ga0070658_10007364 | Ga0070658_100073647 | 151 |
| 28 | 3300005331 | Ga0070670_100003405 | Ga0070670_10000340516 | 151 |
| 29 | 3300005336 | Ga0070680_100020445 | Ga0070680_1000204453 | 151 |
| 30 | 3300005341 | Ga0070691_10052074 | Ga0070691_100520742 | 151 |
| 31 | 3300005458 | Ga0070681_10008181 | Ga0070681_1000818110 | 151 |
| 32 | 3300005530 | Ga0070679_100038200 | Ga0070679_1000382002 | 151 |
| 33 | 3300005563 | Ga0068855_100014728 | Ga0068855_1000147283 | 151 |
| 34 | 3300005614 | Ga0068856_100222240 | Ga0068856_1002222403 | 151 |
| 35 | 3300006038 | Ga0075365_11018294 | Ga0075365_110182941 | 151 |
| 36 | 3300006042 | Ga0075368_10187156 | Ga0075368_101871562 | 151 |
| 37 | 3300006051 | Ga0075364_10086501 | Ga0075364_100865012 | 151 |
| 38 | 3300006177 | Ga0075362_10050795 | Ga0075362_100507952 | 151 |
| 39 | 3300009036 | Ga0105244_10018555 | Ga0105244_100185554 | 151 |
| 40 | 3300009093 | Ga0105240_10031486 | Ga0105240_100314866 | 151 |
| 41 | 3300015262 | Ga0182007_10193316 | Ga0182007_101933161 | 151 |
| 42 | 3300021361 | Ga0213872_10000026 | Ga0213872_1000002613 | 151 |
| 43 | 3300025233 | Ga0209437_102012 | Ga0209437_1020121 | 151 |
| 44 | 3300025245 | Ga0207425_1000348 | Ga0207425_100034825 | 151 |
| 45 | 3300025263 | Ga0209565_1028017 | Ga0209565_10280172 | 151 |
| 46 | 3300025294 | Ga0209025_1002513 | Ga0209025_100251316 | 151 |
| 47 | 3300025295 | Ga0209564_1000002 | Ga0209564_1000002753 | 151 |
| 48 | 3300025295 | Ga0209564_1000007 | Ga0209564_100000795 | 151 |
| 49 | 3300025728 | Ga0207655_1027078 | Ga0207655_10270783 | 151 |
| 50 | 3300025909 | Ga0207705_10092721 | Ga0207705_100927213 | 151 |
| 51 | 3300025912 | Ga0207707_10007348 | Ga0207707_100073483 | 151 |
| 52 | 3300025913 | Ga0207695_10075514 | Ga0207695_100755143 | 151 |
| 53 | 3300025917 | Ga0207660_10008039 | Ga0207660_100080397 | 151 |
| 54 | 3300025921 | Ga0207652_10079248 | Ga0207652_100792483 | 151 |
| 55 | 3300025925 | Ga0207650_10056269 | Ga0207650_100562692 | 151 |
| 56 | 3300025949 | Ga0207667_10104209 | Ga0207667_101042092 | 151 |
| 57 | 3300025981 | Ga0207640_10675220 | Ga0207640_106752201 | 151 |
| 58 | 3300026067 | Ga0207678_11409424 | Ga0207678_114094241 | 151 |
| 59 | 3300026078 | Ga0207702_10201280 | Ga0207702_102012803 | 151 |
| 60 | 3300026118 | Ga0207675_100118676 | Ga0207675_1001186762 | 151 |
| 61 | 3300031548 | Ga0307408_100119940 | Ga0307408_1001199402 | 151 |
| 62 | 3300031548 | Ga0307408_100193880 | Ga0307408_1001938802 | 151 |
| 63 | 3300031548 | Ga0307408_100396181 | Ga0307408_1003961811 | 151 |
| 64 | 3300031731 | Ga0307405_10302295 | Ga0307405_103022952 | 151 |
| 65 | 3300031852 | Ga0307410_10070158 | Ga0307410_100701582 | 151 |
| 66 | 3300031903 | Ga0307407_10014299 | Ga0307407_100142992 | 151 |
| 67 | 3300031911 | Ga0307412_10096255 | Ga0307412_100962553 | 151 |
| 68 | 3300032002 | Ga0307416_100074420 | Ga0307416_1000744203 | 151 |
| 69 | 3300032002 | Ga0307416_100431582 | Ga0307416_1004315821 | 151 |
| 70 | 3300032004 | Ga0307414_10295974 | Ga0307414_102959742 | 151 |
| 71 | 3300032126 | Ga0307415_100625707 | Ga0307415_1006257072 | 151 |
| 72 | 3300035241 | Ga0373961_0091194 | Ga0373961_0091194_182_640 | 151 |
| 73 | 3300039447 | Ga0436361_0287447 | Ga0436361_0287447_102507_102962 | 151 |
| 74 | 3300041486 | Ga0451807_2245727 | Ga0451807_2245727_114_572 | 151 |
| 75 | 3300046453 | Ga0495627_079421 | Ga0495627_079421_448_903 | 151 |
| 76 | 3300046457 | Ga0495590_0000005 | Ga0495590_0000005_46898_47353 | 151 |
| 77 | 3300046460 | Ga0495638_0000436 | Ga0495638_0000436_36640_37095 | 151 |
| 78 | 3300046460 | Ga0495638_0225103 | Ga0495638_0225103_52_507 | 151 |
| 79 | 3300046471 | Ga0495650_0000648 | Ga0495650_0000648_14327_14782 | 151 |
| 80 | 3300046471 | Ga0495650_0001609 | Ga0495650_0001609_17935_18390 | 151 |
| 81 | 3300046471 | Ga0495650_0003360 | Ga0495650_0003360_3512_3967 | 151 |
| 82 | 3300046474 | Ga0495605_0000038 | Ga0495605_0000038_35814_36269 | 151 |
| 83 | 3300046501 | Ga0495607_0032592 | Ga0495607_0032592_1675_2130 | 151 |
| 84 | 3300046506 | Ga0495583_0000709 | Ga0495583_0000709_36494_36949 | 151 |
| 85 | 3300046507 | Ga0495606_0000053 | Ga0495606_0000053_33084_33539 | 151 |
| 86 | 3300046507 | Ga0495606_0010494 | Ga0495606_0010494_4198_4653 | 151 |
| 87 | 3300046512 | Ga0495610_0000181 | Ga0495610_0000181_48505_48960 | 151 |
| 88 | 3300046512 | Ga0495610_0017276 | Ga0495610_0017276_675_1130 | 151 |
| 89 | 3300046512 | Ga0495610_0077999 | Ga0495610_0077999_135_590 | 151 |
| 90 | 3300046512 | Ga0495610_0131025 | Ga0495610_0131025_411_866 | 151 |
| 91 | 3300046512 | Ga0495610_0288596 | Ga0495610_0288596_142_597 | 151 |
| 92 | 3300046522 | Ga0495643_0000195 | Ga0495643_0000195_41923_42378 | 151 |
| 93 | 3300046522 | Ga0495643_0000516 | Ga0495643_0000516_5668_6123 | 151 |
| 94 | 3300046522 | Ga0495643_0103381 | Ga0495643_0103381_614_1072 | 151 |
| 95 | 3300046524 | Ga0495648_0000002 | Ga0495648_0000002_359511_359966 | 151 |
| 96 | 3300046524 | Ga0495648_0060615 | Ga0495648_0060615_1604_2059 | 151 |
| 97 | 3300046524 | Ga0495648_0316912 | Ga0495648_0316912_192_647 | 151 |
| 98 | 3300046528 | Ga0495642_0004406 | Ga0495642_0004406_467_922 | 151 |
| 99 | 3300046538 | Ga0495609_0017476 | Ga0495609_0017476_1121_1576 | 151 |
| 100 | 3300046538 | Ga0495609_0048806 | Ga0495609_0048806_915_1370 | 151 |
| 101 | 3300046538 | Ga0495609_0148075 | Ga0495609_0148075_147_602 | 151 |
| 102 | 3300046542 | Ga0495597_0000322 | Ga0495597_0000322_2955_3410 | 151 |
| 103 | 3300046542 | Ga0495597_0000530 | Ga0495597_0000530_11816_12271 | 151 |
| 104 | 3300046557 | Ga0495622_0000471 | Ga0495622_0000471_5808_6263 | 151 |
| 105 | 3300046558 | Ga0495633_0000567 | Ga0495633_0000567_29862_30317 | 151 |
| 106 | 3300046558 | Ga0495633_0005198 | Ga0495633_0005198_2599_3054 | 151 |
| 107 | 3300046558 | Ga0495633_0006408 | Ga0495633_0006408_1940_2395 | 151 |
| 108 | 3300046558 | Ga0495633_0034889 | Ga0495633_0034889_1402_1857 | 151 |
| 109 | 3300046616 | Ga0495668_0000968 | Ga0495668_0000968_17470_17925 | 151 |
| 110 | 3300046616 | Ga0495668_0005696 | Ga0495668_0005696_7866_8321 | 151 |
| 111 | 3300046660 | Ga0495625_0000124 | Ga0495625_0000124_83894_84349 | 151 |
| 112 | 3300046660 | Ga0495625_0000468 | Ga0495625_0000468_46875_47330 | 151 |
| 113 | 3300046660 | Ga0495625_0008806 | Ga0495625_0008806_3099_3554 | 151 |
| 114 | 3300046660 | Ga0495625_0013263 | Ga0495625_0013263_5951_6406 | 151 |
| 115 | 3300046660 | Ga0495625_0258735 | Ga0495625_0258735_592_1047 | 151 |
| 116 | 3300046692 | Ga0495671_0058590 | Ga0495671_0058590_216_671 | 151 |
| 117 | 3300046694 | Ga0495649_0004375 | Ga0495649_0004375_6949_7404 | 151 |
| 118 | 3300046694 | Ga0495649_0026971 | Ga0495649_0026971_837_1292 | 151 |
| 119 | 3300046694 | Ga0495649_0103299 | Ga0495649_0103299_777_1232 | 151 |
| 120 | 3300046810 | Ga0495660_0009394 | Ga0495660_0009394_2302_2757 | 151 |
| 121 | 3300047320 | Ga0495672_0000398 | Ga0495672_0000398_11187_11642 | 151 |
| 122 | 3300047443 | Ga0495687_000768 | Ga0495687_000768_12798_13253 | 151 |
| 123 | 3300047443 | Ga0495687_001376 | Ga0495687_001376_12804_13259 | 151 |
| 124 | 3300047445 | Ga0495677_0092091 | Ga0495677_0092091_128_583 | 151 |
| 125 | 3300047445 | Ga0495677_0106204 | Ga0495677_0106204_41_496 | 151 |
| 126 | 3300047469 | Ga0495673_0000199 | Ga0495673_0000199_65129_65584 | 151 |
| 127 | 3300047469 | Ga0495673_0211048 | Ga0495673_0211048_163_618 | 151 |
| 128 | 3300047472 | Ga0495686_0007750 | Ga0495686_0007750_5644_6099 | 151 |
| 129 | 3300048090 | Ga0495615_0002001 | Ga0495615_0002001_2700_3155 | 151 |
| 130 | 3300048922 | Ga0496119_0126999 | Ga0496119_0126999_772_1230 | 151 |
| 131 | 3300048927 | Ga0496124_0071115 | Ga0496124_0071115_1323_1778 | 151 |
| 132 | 3300048927 | Ga0496124_0691225 | Ga0496124_0691225_120_575 | 151 |
| 133 | 3300048929 | Ga0496126_0937380 | Ga0496126_0937380_120_575 | 151 |
| 134 | 3300049459 | Ga0495678_000291 | Ga0495678_000291_41247_41702 | 151 |
| 135 | 3300049459 | Ga0495678_001981 | Ga0495678_001981_11001_11456 | 151 |
| 136 | 3300049459 | Ga0495678_003460 | Ga0495678_003460_5727_6182 | 151 |
| 137 | 3300049571 | Ga0501034_0003790 | Ga0501034_0003790_8901_9359 | 151 |
| 138 | 3300050489 | nmdc:mga03683_77772_c1 | nmdc:mga03683_77772_c1_578_1036 | 151 |
| 139 | 3300050489 | nmdc:mga03683_89333_c1 | nmdc:mga03683_89333_c1_789_1247 | 151 |
| 140 | 3300050490 | nmdc:mga03n38_454645_c1 | nmdc:mga03n38_454645_c1_237_695 | 151 |
| 141 | 3300050492 | nmdc:mga0yw44_44198_c1 | nmdc:mga0yw44_44198_c1_121_579 | 151 |
| 142 | 3300050516 | nmdc:mga0sz30_212355_c1 | nmdc:mga0sz30_212355_c1_288_746 | 151 |
| 143 | 3300053091 | Ga0500647_0027056 | Ga0500647_0027056_1888_2346 | 151 |
| 144 | 3300053145 | Ga0500586_001122 | Ga0500586_001122_1360_1815 | 151 |
| 145 | 3300003771 | Ga0055526_1000528 | Ga0055526_10005287 | 152 |
| 146 | 3300005344 | Ga0070661_100068629 | Ga0070661_1000686294 | 152 |
| 147 | 3300005436 | Ga0070713_100062036 | Ga0070713_1000620366 | 152 |
| 148 | 3300005437 | Ga0070710_10331453 | Ga0070710_103314532 | 152 |
| 149 | 3300005439 | Ga0070711_100645425 | Ga0070711_1006454251 | 152 |
| 150 | 3300005548 | Ga0070665_100003905 | Ga0070665_10000390511 | 152 |
| 151 | 3300005548 | Ga0070665_100023966 | Ga0070665_1000239662 | 152 |
| 152 | 3300005563 | Ga0068855_100378990 | Ga0068855_1003789903 | 152 |
| 153 | 3300005843 | Ga0068860_101722350 | Ga0068860_1017223502 | 152 |
| 154 | 3300005937 | Ga0081455_10012065 | Ga0081455_100120653 | 152 |
| 155 | 3300005983 | Ga0081540_1160228 | Ga0081540_11602281 | 152 |
| 156 | 3300006177 | Ga0075362_10116783 | Ga0075362_101167832 | 152 |
| 157 | 3300006178 | Ga0075367_10042577 | Ga0075367_100425772 | 152 |
| 158 | 3300009093 | Ga0105240_10245190 | Ga0105240_102451904 | 152 |
| 159 | 3300009101 | Ga0105247_10244366 | Ga0105247_102443663 | 152 |
| 160 | 3300010375 | Ga0105239_10687669 | Ga0105239_106876692 | 152 |
| 161 | 3300013307 | Ga0157372_10777062 | Ga0157372_107770621 | 152 |
| 162 | 3300013308 | Ga0157375_11136298 | Ga0157375_111362982 | 152 |
| 163 | 3300014325 | Ga0163163_12169095 | Ga0163163_121690951 | 152 |
| 164 | 3300021384 | Ga0213876_10484723 | Ga0213876_104847231 | 152 |
| 165 | 3300025295 | Ga0209564_1000752 | Ga0209564_100075226 | 152 |
| 166 | 3300025302 | Ga0207426_1036980 | Ga0207426_10369802 | 152 |
| 167 | 3300025907 | Ga0207645_10424785 | Ga0207645_104247852 | 152 |
| 168 | 3300025949 | Ga0207667_10158188 | Ga0207667_101581884 | 152 |
| 169 | 3300025986 | Ga0207658_10887368 | Ga0207658_108873682 | 152 |
| 170 | 3300026116 | Ga0207674_10206372 | Ga0207674_102063722 | 152 |
| 171 | 3300026121 | Ga0207683_10438965 | Ga0207683_104389653 | 152 |
| 172 | 3300028379 | Ga0268266_10139292 | Ga0268266_101392922 | 152 |
| 173 | 3300036401 | Ga0373937_0255856 | Ga0373937_0255856_121_621 | 152 |
| 174 | 3300037068 | Ga0373925_0361531 | Ga0373925_0361531_306_773 | 152 |
| 175 | 3300037068 | Ga0373925_0535288 | Ga0373925_0535288_283_747 | 152 |
| 176 | 3300041501 | Ga0451845_0997305 | Ga0451845_0997305_65_535 | 152 |
| 177 | 3300048915 | Ga0496112_1170420 | Ga0496112_1170420_110_574 | 152 |
| 178 | 3300049570 | Ga0501033_0563573 | Ga0501033_0563573_288_752 | 152 |
| 179 | 3300049571 | Ga0501034_0000708 | Ga0501034_0000708_32806_33270 | 152 |
| 180 | 3300049571 | Ga0501034_0981775 | Ga0501034_0981775_110_574 | 152 |
| 181 | 3300049572 | Ga0501036_0738754 | Ga0501036_0738754_317_781 | 152 |
| 182 | 3300049573 | Ga0501037_0355403 | Ga0501037_0355403_531_995 | 152 |
| 183 | 3300049580 | Ga0501046_0403286 | Ga0501046_0403286_378_842 | 152 |
| 184 | 3300049581 | Ga0501047_0297302 | Ga0501047_0297302_616_1080 | 152 |
| 185 | 3300049584 | Ga0501068_0010955 | Ga0501068_0010955_362_826 | 152 |
| 186 | 3300049586 | Ga0501070_0070467 | Ga0501070_0070467_663_1127 | 152 |
| 187 | 3300049822 | Ga0501035_1225827 | Ga0501035_1225827_47_511 | 152 |
| 188 | 3300049823 | Ga0501044_0093314 | Ga0501044_0093314_1984_2448 | 152 |
| 189 | 3300049823 | Ga0501044_0396504 | Ga0501044_0396504_539_1003 | 152 |
| 190 | 3300050489 | nmdc:mga03683_73522_c1 | nmdc:mga03683_73522_c1_289_753 | 152 |
| 191 | 3300050492 | nmdc:mga0yw44_280627_c1 | nmdc:mga0yw44_280627_c1_231_695 | 152 |
| 192 | 3300053153 | Ga0500616_0002469 | Ga0500616_0002469_14774_15238 | 152 |
| 193 | 3300053161 | Ga0500634_0212239 | Ga0500634_0212239_119_580 | 152 |
| 194 | 3300053731 | Ga0500609_019142 | Ga0500609_019142_217_681 | 152 |
| 195 | 3300003203 | JGI25406J46586_10000268 | JGI25406J46586_1000026813 | 153 |
| 196 | 3300003775 | Ga0055524_1010161 | Ga0055524_10101613 | 153 |
| 197 | 3300005327 | Ga0070658_11041510 | Ga0070658_110415101 | 153 |
| 198 | 3300005328 | Ga0070676_10332071 | Ga0070676_103320711 | 153 |
| 199 | 3300005329 | Ga0070683_100129394 | Ga0070683_1001293943 | 153 |
| 200 | 3300005330 | Ga0070690_100040236 | Ga0070690_1000402364 | 153 |
| 201 | 3300005355 | Ga0070671_100127796 | Ga0070671_1001277962 | 153 |
| 202 | 3300005356 | Ga0070674_100653862 | Ga0070674_1006538621 | 153 |
| 203 | 3300005366 | Ga0070659_100067579 | Ga0070659_1000675793 | 153 |
| 204 | 3300005456 | Ga0070678_100047959 | Ga0070678_1000479594 | 153 |
| 205 | 3300005459 | Ga0068867_100069268 | Ga0068867_1000692682 | 153 |
| 206 | 3300005535 | Ga0070684_100172547 | Ga0070684_1001725473 | 153 |
| 207 | 3300005539 | Ga0068853_100088386 | Ga0068853_1000883863 | 153 |
| 208 | 3300005547 | Ga0070693_100196323 | Ga0070693_1001963232 | 153 |
| 209 | 3300005548 | Ga0070665_100023335 | Ga0070665_1000233352 | 153 |
| 210 | 3300005548 | Ga0070665_100188933 | Ga0070665_1001889331 | 153 |
| 211 | 3300005548 | Ga0070665_100227225 | Ga0070665_1002272252 | 153 |
| 212 | 3300005548 | Ga0070665_100231292 | Ga0070665_1002312923 | 153 |
| 213 | 3300005563 | Ga0068855_100475701 | Ga0068855_1004757012 | 153 |
| 214 | 3300005564 | Ga0070664_100005729 | Ga0070664_1000057298 | 153 |
| 215 | 3300005577 | Ga0068857_100288127 | Ga0068857_1002881272 | 153 |
| 216 | 3300005614 | Ga0068856_100311249 | Ga0068856_1003112492 | 153 |
| 217 | 3300005616 | Ga0068852_100410630 | Ga0068852_1004106303 | 153 |
| 218 | 3300005834 | Ga0068851_10088070 | Ga0068851_100880703 | 153 |
| 219 | 3300005985 | Ga0081539_10001411 | Ga0081539_1000141124 | 153 |
| 220 | 3300006048 | Ga0075363_100241286 | Ga0075363_1002412861 | 153 |
| 221 | 3300006163 | Ga0070715_10071536 | Ga0070715_100715363 | 153 |
| 222 | 3300009174 | Ga0105241_10380586 | Ga0105241_103805863 | 153 |
| 223 | 3300009545 | Ga0105237_10000203 | Ga0105237_1000020335 | 153 |
| 224 | 3300010375 | Ga0105239_10042354 | Ga0105239_100423542 | 153 |
| 225 | 3300010375 | Ga0105239_10044953 | Ga0105239_100449535 | 153 |
| 226 | 3300013102 | Ga0157371_10045502 | Ga0157371_100455025 | 153 |
| 227 | 3300013104 | Ga0157370_10918889 | Ga0157370_109188892 | 153 |
| 228 | 3300013105 | Ga0157369_10087860 | Ga0157369_100878605 | 153 |
| 229 | 3300013306 | Ga0163162_10378103 | Ga0163162_103781032 | 153 |
| 230 | 3300013307 | Ga0157372_10275222 | Ga0157372_102752223 | 153 |
| 231 | 3300014497 | Ga0182008_10092113 | Ga0182008_100921132 | 153 |
| 232 | 3300014745 | Ga0157377_10344821 | Ga0157377_103448212 | 153 |
| 233 | 3300020070 | Ga0206356_10292831 | Ga0206356_102928312 | 153 |
| 234 | 3300025299 | Ga0209256_1000378 | Ga0209256_100037828 | 153 |
| 235 | 3300025303 | Ga0209051_1062265 | Ga0209051_10622652 | 153 |
| 236 | 3300025321 | Ga0207656_10139653 | Ga0207656_101396532 | 153 |
| 237 | 3300025901 | Ga0207688_10011513 | Ga0207688_100115135 | 153 |
| 238 | 3300025904 | Ga0207647_10080801 | Ga0207647_100808012 | 153 |
| 239 | 3300025905 | Ga0207685_10126815 | Ga0207685_101268151 | 153 |
| 240 | 3300025907 | Ga0207645_10058123 | Ga0207645_100581234 | 153 |
| 241 | 3300025914 | Ga0207671_10000177 | Ga0207671_1000017735 | 153 |
| 242 | 3300025919 | Ga0207657_10137810 | Ga0207657_101378102 | 153 |
| 243 | 3300025921 | Ga0207652_10578921 | Ga0207652_105789212 | 153 |
| 244 | 3300025924 | Ga0207694_10027772 | Ga0207694_100277723 | 153 |
| 245 | 3300025926 | Ga0207659_10143948 | Ga0207659_101439482 | 153 |
| 246 | 3300025932 | Ga0207690_10271177 | Ga0207690_102711773 | 153 |
| 247 | 3300025937 | Ga0207669_10095608 | Ga0207669_100956082 | 153 |
| 248 | 3300025944 | Ga0207661_10232946 | Ga0207661_102329462 | 153 |
| 249 | 3300025945 | Ga0207679_10162396 | Ga0207679_101623962 | 153 |
| 250 | 3300025949 | Ga0207667_10132476 | Ga0207667_101324763 | 153 |
| 251 | 3300025981 | Ga0207640_11566608 | Ga0207640_115666081 | 153 |
| 252 | 3300026078 | Ga0207702_10033995 | Ga0207702_100339953 | 153 |
| 253 | 3300026089 | Ga0207648_10603576 | Ga0207648_106035761 | 153 |
| 254 | 3300026116 | Ga0207674_10604676 | Ga0207674_106046762 | 153 |
| 255 | 3300026121 | Ga0207683_10068662 | Ga0207683_100686624 | 153 |
| 256 | 3300026142 | Ga0207698_10042262 | Ga0207698_100422623 | 153 |
| 257 | 3300028379 | Ga0268266_10003595 | Ga0268266_1000359513 | 153 |
| 258 | 3300028379 | Ga0268266_10481150 | Ga0268266_104811502 | 153 |
| 259 | 3300028379 | Ga0268266_11098808 | Ga0268266_110988082 | 153 |
| 260 | 3300028380 | Ga0268265_10227422 | Ga0268265_102274223 | 153 |
| 261 | 3300031852 | Ga0307410_10352359 | Ga0307410_103523592 | 153 |
| 262 | 3300031911 | Ga0307412_10987660 | Ga0307412_109876601 | 153 |
| 263 | 3300035410 | Ga0373924_0039259 | Ga0373924_0039259_627_1094 | 153 |
| 264 | 3300035691 | Ga0373931_0314531 | Ga0373931_0314531_404_910 | 153 |
| 265 | 3300035691 | Ga0373931_0318727 | Ga0373931_0318727_331_798 | 153 |
| 266 | 3300035695 | Ga0373927_0120699 | Ga0373927_0120699_95_562 | 153 |
| 267 | 3300037312 | Ga0395899_0002769 | Ga0395899_0002769_13008_13511 | 153 |
| 268 | 3300037312 | Ga0395899_0015673 | Ga0395899_0015673_2483_2989 | 153 |
| 269 | 3300037418 | Ga0395900_0004636 | Ga0395900_0004636_2948_3451 | 153 |
| 270 | 3300037418 | Ga0395900_0005759 | Ga0395900_0005759_2451_2957 | 153 |
| 271 | 3300037466 | Ga0395898_0047948 | Ga0395898_0047948_2103_2606 | 153 |
| 272 | 3300037471 | Ga0395905_0477138 | Ga0395905_0477138_616_1095 | 153 |
| 273 | 3300038443 | Ga0395901_0004425 | Ga0395901_0004425_11401_11904 | 153 |
| 274 | 3300038443 | Ga0395901_0005311 | Ga0395901_0005311_8253_8759 | 153 |
| 275 | 3300041453 | Ga0451797_0031610 | Ga0451797_0031610_58_525 | 153 |
| 276 | 3300041997 | Ga0439431_0088384 | Ga0439431_0088384_288_764 | 153 |
| 277 | 3300042004 | Ga0439445_0041455 | Ga0439445_0041455_382_858 | 153 |
| 278 | 3300044694 | Ga0466963_0166329 | Ga0466963_0166329_609_1112 | 153 |
| 279 | 3300044842 | Ga0466957_0007211 | Ga0466957_0007211_1084_1587 | 153 |
| 280 | 3300045976 | Ga0466967_0199490 | Ga0466967_0199490_679_1182 | 153 |
| 281 | 3300046512 | Ga0495610_0311795 | Ga0495610_0311795_76_558 | 153 |
| 282 | 3300046683 | Ga0495658_0448620 | Ga0495658_0448620_169_636 | 153 |
| 283 | 3300046692 | Ga0495671_0005616 | Ga0495671_0005616_621_1112 | 153 |
| 284 | 3300048917 | Ga0496114_0460487 | Ga0496114_0460487_300_767 | 153 |
| 285 | 3300048925 | Ga0496122_0191405 | Ga0496122_0191405_106_603 | 153 |
| 286 | 3300048926 | Ga0496123_0172112 | Ga0496123_0172112_586_1083 | 153 |
| 287 | 3300048926 | Ga0496123_0173739 | Ga0496123_0173739_266_766 | 153 |
| 288 | 3300048928 | Ga0496125_0000099 | Ga0496125_0000099_20453_20950 | 153 |
| 289 | 3300048928 | Ga0496125_0004213 | Ga0496125_0004213_8420_8917 | 153 |
| 290 | 3300048929 | Ga0496126_0126416 | Ga0496126_0126416_413_910 | 153 |
| 291 | 3300048929 | Ga0496126_0754189 | Ga0496126_0754189_132_620 | 153 |
| 292 | 3300049822 | Ga0501035_1144547 | Ga0501035_1144547_72_563 | 153 |
| 293 | 3300050490 | nmdc:mga03n38_180839_c1 | nmdc:mga03n38_180839_c1_378_890 | 153 |
| 294 | 3300050495 | nmdc:mga04h51_152815_c1 | nmdc:mga04h51_152815_c1_59_535 | 153 |
| 295 | 3300002738 | JGI25154J39366_1000535 | JGI25154J39366_10005356 | 154 |
| 296 | 3300025246 | Ga0209646_1000007 | Ga0209646_100000747 | 154 |
| 297 | 3300025250 | Ga0209026_1015403 | Ga0209026_10154032 | 154 |
| 298 | 3300044683 | Ga0466965_0219698 | Ga0466965_0219698_475_954 | 154 |
| 299 | 3300046507 | Ga0495606_0001197 | Ga0495606_0001197_3098_3562 | 154 |
| 300 | 3300047469 | Ga0495673_0000005 | Ga0495673_0000005_832975_833442 | 154 |
| 301 | 3300048929 | Ga0496126_0092475 | Ga0496126_0092475_1734_2228 | 154 |
| 302 | 3300053125 | Ga0500618_000332 | Ga0500618_000332_20357_20824 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wdv-assembly2.cif.gz_B | crystal structure of hypothetical protein ape2540 | 0.9349 | 5 | 152 |
| 1wdv-assembly2.cif.gz_B | crystal structure of hypothetical protein ape2540 | 0.9173 | 5 | 152 |
| 3rij-assembly2.cif.gz_B | epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins | 0.9165 | 3 | 153 |
| 2cx5-assembly3.cif.gz_C | crystal structure of a putative trans-editing enzyme for prolyl trna synthetase | 0.9082 | 3 | 153 |
| 3ri0-assembly1.cif.gz_A | epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins | 0.9011 | 3 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D973_68_232_3.90.960.10 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.9377 | 2 | 153 | 3.90.960.10 |
| 1wdvB00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.9276 | 5 | 152 | 3.90.960.10 |
| af_Q4D973_68_232_3.90.960.10 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.9202 | 2 | 153 | 3.90.960.10 |
| 1wdvB00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.9158 | 5 | 152 | 3.90.960.10 |
| af_Q2G0A0_1_158_3.90.960.10 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.9025 | 5 | 150 | 3.90.960.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C6PW45-F1-model_v4 | YbaK/EbsC family protein | 0.9805 | 1 | 152 |
GO:0002161
|
| AF-A0A2X5NU96-F1-model_v4 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase ybaK | 0.9773 | 32 | 152 |
GO:0002161
|
| AF-A0A379UZN2-F1-model_v4 | tRNA proofreading protein | 0.9749 | 4 | 152 |
GO:0002161
GO:0016020 |
| AF-A0A1G5YIC9-F1-model_v4 | deleted | 0.9724 | 1 | 154 |
|
| AF-A0A2S5K9E9-F1-model_v4 | Cys-tRNA(Pro)/cys-tRNA(Cys) deacylase | 0.9721 | 1 | 154 |
GO:0002161
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar