F396380

General Info

Members Datasets Scaffolds Average Seq Length
302 212 286 156

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100023335|Ga0070665_1000233352
Length 162
Sequence MSLASVRAFFATHAPDIDVLVTEASSATVQLAAEAHGVKPEQIAKTICLRAGDRAMLIVTCGTARLDNRKFKDRFGGQKPRMLDADEVTRLTSHPVGGVCPFGLPQPMPVYCDVSLKAFDEVVPAAGATHAAVRIAPNRMAVLVDAEWIDVCQPPALAEPSA

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2643221733 Bosea sp. Root381 Isolate Unclassified
4 2643221734 Bosea sp. Root670 Isolate Unclassified
5 2773857925 Microvirga vignae BR3299 Isolate Unclassified
6 2818991467 Bosea vestrisii 3192 Isolate Unclassified
7 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
8 2857558681 Duganella sp. R-74565 Isolate Unclassified
9 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
10 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
11 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
12 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
13 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
14 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
15 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
16 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
146 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
207 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
208 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
209 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
212 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 0.33
Isolates 5.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.91
Nodule 1.32
Rhizoplane 1.32
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 8.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000535 3300002738 Bacteria 18965
2 JGI25150J39212_1004563 3300002774 Bacteria 3060
3 JGI25406J46586_10000268 3300003203 Bacteria 23155
4 Ga0055526_1000019 3300003771 Bacteria 189698
5 Ga0055526_1000148 3300003771 Bacteria 61933
6 Ga0055526_1000528 3300003771 Bacteria 30285
7 Ga0055524_1010161 3300003775 Bacteria 3767
8 Ga0070658_10007364 3300005327 Bacteria 8889
9 Ga0070658_11041510 3300005327 Bacteria 712
10 Ga0070676_10332071 3300005328 Bacteria 1040
11 Ga0070683_100129394 3300005329 Bacteria 2388
12 Ga0070690_100040236 3300005330 Bacteria 2956
13 Ga0070670_100003405 3300005331 Bacteria 13186
14 Ga0070680_100020445 3300005336 Bacteria 5254
15 Ga0070691_10052074 3300005341 Bacteria 1957
16 Ga0070661_100068629 3300005344 Bacteria 2605
17 Ga0070671_100127796 3300005355 Bacteria 2140
18 Ga0070674_100653862 3300005356 Bacteria 894
19 Ga0070659_100067579 3300005366 Bacteria 2834
20 Ga0070713_100062036 3300005436 Bacteria 3130
21 Ga0070710_10331453 3300005437 Bacteria 1002
22 Ga0070711_100645425 3300005439 Bacteria 887
23 Ga0070678_100047959 3300005456 Bacteria 3073
24 Ga0070681_10008181 3300005458 Bacteria 10237
25 Ga0068867_100069268 3300005459 Bacteria 2635
26 Ga0070679_100038200 3300005530 Bacteria 4772
27 Ga0070684_100172547 3300005535 Bacteria 1964
28 Ga0068853_100088386 3300005539 Bacteria 2720
29 Ga0070693_100196323 3300005547 Bacteria 1308
30 Ga0070665_100003905 3300005548 Bacteria 15758
31 Ga0070665_100023335 3300005548 Bacteria 6228
32 Ga0070665_100023966 3300005548 Bacteria 6146
33 Ga0070665_100188933 3300005548 Bacteria 2061
34 Ga0070665_100227225 3300005548 Bacteria 1866
35 Ga0070665_100231292 3300005548 Bacteria 1848
36 Ga0068855_100014728 3300005563 Bacteria 9421
37 Ga0068855_100378990 3300005563 Bacteria 1553
38 Ga0068855_100475701 3300005563 Bacteria 1360
39 Ga0070664_100005729 3300005564 Bacteria 10012
40 Ga0068857_100288127 3300005577 Bacteria 1512
41 Ga0068856_100222240 3300005614 Bacteria 1904
42 Ga0068856_100311249 3300005614 Bacteria 1592
43 Ga0068852_100410630 3300005616 Bacteria 1334
44 Ga0068851_10088070 3300005834 Bacteria 1631
45 Ga0068860_101722350 3300005843 Bacteria 649
46 Ga0081455_10012065 3300005937 Bacteria 8644
47 Ga0081540_1160228 3300005983 Bacteria 874
48 Ga0081539_10001411 3300005985 Bacteria 41377
49 Ga0075365_11018294 3300006038 Bacteria 583
50 Ga0075368_10187156 3300006042 Bacteria 874
51 Ga0075368_10414489 3300006042 Bacteria 593
52 Ga0075363_100241286 3300006048 Bacteria 1039
53 Ga0075364_10086501 3300006051 Bacteria 2077
54 Ga0070715_10071536 3300006163 Bacteria 1551
55 Ga0075362_10050795 3300006177 Bacteria 1855
56 Ga0075362_10116783 3300006177 Bacteria 1260
57 Ga0075367_10042577 3300006178 Bacteria 2657
58 Ga0075366_10047680 3300006195 Bacteria 2540
59 Ga0105244_10018555 3300009036 Bacteria 3899
60 Ga0105240_10031486 3300009093 Bacteria 6880
61 Ga0105240_10245190 3300009093 Bacteria 2075
62 Ga0105247_10244366 3300009101 Bacteria 1224
63 Ga0105241_10380586 3300009174 Bacteria 1233
64 Ga0105237_10000203 3300009545 Bacteria 84732
65 Ga0105239_10042354 3300010375 Bacteria 4990
66 Ga0105239_10044953 3300010375 Bacteria 4840
67 Ga0105239_10687669 3300010375 Bacteria 1169
68 Ga0157371_10045502 3300013102 Bacteria 3123
69 Ga0157370_10918889 3300013104 Bacteria 794
70 Ga0157369_10087860 3300013105 Bacteria 3319
71 Ga0163162_10378103 3300013306 Bacteria 1549
72 Ga0157372_10275222 3300013307 Bacteria 1957
73 Ga0157372_10777062 3300013307 Bacteria 1113
74 Ga0157375_11136298 3300013308 Bacteria 915
75 Ga0163163_12169095 3300014325 Bacteria 615
76 Ga0182008_10092113 3300014497 Bacteria 1495
77 Ga0157377_10344821 3300014745 Bacteria 997
78 Ga0182007_10132329 3300015262 Bacteria 839
79 Ga0182007_10193316 3300015262 Bacteria 708
80 Ga0206356_10292831 3300020070 Bacteria 1481
81 Ga0213872_10000026 3300021361 Bacteria 149852
82 Ga0213876_10484723 3300021384 Bacteria 658
83 Ga0209437_102012 3300025233 Bacteria 4161
84 Ga0207425_1000348 3300025245 Bacteria 32202
85 Ga0209646_1000007 3300025246 Bacteria 670994
86 Ga0209026_1015403 3300025250 Bacteria 1255
87 Ga0209565_1028017 3300025263 Bacteria 1116
88 Ga0209025_1002513 3300025294 Bacteria 19198
89 Ga0209564_1000002 3300025295 Bacteria 1636803
90 Ga0209564_1000007 3300025295 Bacteria 1028582
91 Ga0209564_1000752 3300025295 Bacteria 45914
92 Ga0209256_1000378 3300025299 Bacteria 71376
93 Ga0207426_1036980 3300025302 Bacteria 1548
94 Ga0209051_1062265 3300025303 Bacteria 1168
95 Ga0207656_10139653 3300025321 Bacteria 1141
96 Ga0207655_1027078 3300025728 Bacteria 2739
97 Ga0207688_10011513 3300025901 Bacteria 4814
98 Ga0207647_10080801 3300025904 Bacteria 1949
99 Ga0207685_10126815 3300025905 Bacteria 1128
100 Ga0207645_10058123 3300025907 Bacteria 2469
101 Ga0207645_10424785 3300025907 Bacteria 896
102 Ga0207705_10092721 3300025909 Bacteria 2213
103 Ga0207707_10007348 3300025912 Bacteria 9596
104 Ga0207695_10075514 3300025913 Bacteria 3429
105 Ga0207671_10000177 3300025914 Bacteria 97072
106 Ga0207660_10008039 3300025917 Bacteria 6821
107 Ga0207657_10137810 3300025919 Bacteria 1995
108 Ga0207652_10079248 3300025921 Bacteria 2869
109 Ga0207652_10578921 3300025921 Bacteria 1008
110 Ga0207694_10027772 3300025924 Bacteria 4311
111 Ga0207650_10056269 3300025925 Bacteria 2922
112 Ga0207659_10143948 3300025926 Bacteria 1854
113 Ga0207690_10271177 3300025932 Bacteria 1318
114 Ga0207669_10095608 3300025937 Bacteria 1948
115 Ga0207661_10232946 3300025944 Bacteria 1631
116 Ga0207679_10162396 3300025945 Bacteria 1830
117 Ga0207667_10104209 3300025949 Bacteria 2926
118 Ga0207667_10132476 3300025949 Bacteria 2568
119 Ga0207667_10158188 3300025949 Bacteria 2331
120 Ga0207640_10675220 3300025981 Bacteria 883
121 Ga0207640_11566608 3300025981 Bacteria 593
122 Ga0207658_10887368 3300025986 Bacteria 812
123 Ga0207678_11409424 3300026067 Bacteria 616
124 Ga0207702_10033995 3300026078 Bacteria 4261
125 Ga0207702_10201280 3300026078 Bacteria 1846
126 Ga0207648_10603576 3300026089 Bacteria 1012
127 Ga0207674_10206372 3300026116 Bacteria 1914
128 Ga0207674_10604676 3300026116 Bacteria 1059
129 Ga0207675_100118676 3300026118 Bacteria 2502
130 Ga0207683_10068662 3300026121 Bacteria 3129
131 Ga0207683_10438965 3300026121 Bacteria 1203
132 Ga0207698_10042262 3300026142 Bacteria 3403
133 Ga0268266_10003595 3300028379 Bacteria 15341
134 Ga0268266_10139292 3300028379 Bacteria 2176
135 Ga0268266_10481150 3300028379 Bacteria 1183
136 Ga0268266_11098808 3300028379 Bacteria 769
137 Ga0268265_10227422 3300028380 Bacteria 1637
138 Ga0307408_100119940 3300031548 Bacteria 2036
139 Ga0307408_100193880 3300031548 Bacteria 1639
140 Ga0307408_100396181 3300031548 Bacteria 1184
141 Ga0307405_10302295 3300031731 Bacteria 1214
142 Ga0307410_10070158 3300031852 Bacteria 2426
143 Ga0307410_10352359 3300031852 Bacteria 1177
144 Ga0307407_10014299 3300031903 Bacteria 3882
145 Ga0307412_10096255 3300031911 Bacteria 2083
146 Ga0307412_10987660 3300031911 Bacteria 743
147 Ga0307416_100074420 3300032002 Bacteria 2837
148 Ga0307416_100431582 3300032002 Bacteria 1365
149 Ga0307414_10295974 3300032004 Bacteria 1367
150 Ga0307415_100625707 3300032126 Bacteria 961
151 Ga0373961_0091194 3300035241 Bacteria 974
152 Ga0373924_0039259 3300035410 Bacteria 1934
153 Ga0373931_0314531 3300035691 Bacteria 971
154 Ga0373931_0318727 3300035691 Bacteria 965
155 Ga0373927_0120699 3300035695 Bacteria 1711
156 Ga0373937_0255856 3300036401 Bacteria 1651
157 Ga0373937_0448692 3300036401 Bacteria 1225
158 Ga0373925_0361531 3300037068 Bacteria 1180
159 Ga0373925_0535288 3300037068 Bacteria 963
160 Ga0395899_0002769 3300037312 Bacteria 14150
161 Ga0395899_0015673 3300037312 Bacteria 5780
162 Ga0395900_0004636 3300037418 Bacteria 14500
163 Ga0395900_0005759 3300037418 Bacteria 12949
164 Ga0395898_0047948 3300037466 Bacteria 4190
165 Ga0395905_0477138 3300037471 Unclassified 1146
166 Ga0395901_0004425 3300038443 Bacteria 14169
167 Ga0395901_0005311 3300038443 Bacteria 13017
168 Ga0436361_0287447 3300039447 Bacteria 113524
169 Ga0451797_0031610 3300041453 Bacteria 592
170 Ga0451807_2245727 3300041486 Bacteria 628
171 Ga0451845_0997305 3300041501 Bacteria 667
172 Ga0439431_0088384 3300041997 Bacteria 842
173 Ga0439445_0041455 3300042004 Bacteria 1224
174 Ga0466965_0219698 3300044683 Bacteria 1012
175 Ga0466963_0166329 3300044694 Bacteria 1536
176 Ga0466957_0007211 3300044842 Bacteria 6284
177 Ga0466967_0199490 3300045976 Bacteria 1894
178 Ga0495627_079421 3300046453 Bacteria 952
179 Ga0495590_0000005 3300046457 Bacteria 384276
180 Ga0495638_0000436 3300046460 Bacteria 50390
181 Ga0495638_0225103 3300046460 Bacteria 1046
182 Ga0495650_0000648 3300046471 Bacteria 45807
183 Ga0495650_0001609 3300046471 Bacteria 21115
184 Ga0495650_0003360 3300046471 Bacteria 11741
185 Ga0495605_0000038 3300046474 Bacteria 197063
186 Ga0495607_0032592 3300046501 Bacteria 3179
187 Ga0495583_0000709 3300046506 Bacteria 42771
188 Ga0495606_0000053 3300046507 Bacteria 200818
189 Ga0495606_0001197 3300046507 Bacteria 36483
190 Ga0495606_0010494 3300046507 Bacteria 7677
191 Ga0495610_0000181 3300046512 Bacteria 70215
192 Ga0495610_0017276 3300046512 Bacteria 4117
193 Ga0495610_0077999 3300046512 Bacteria 1528
194 Ga0495610_0131025 3300046512 Bacteria 1089
195 Ga0495610_0288596 3300046512 Bacteria 636
196 Ga0495610_0311795 3300046512 Bacteria 603
197 Ga0495643_0000195 3300046522 Bacteria 96110
198 Ga0495643_0000516 3300046522 Bacteria 48137
199 Ga0495643_0103381 3300046522 Bacteria 1457
200 Ga0495648_0000002 3300046524 Bacteria 593972
201 Ga0495648_0060615 3300046524 Bacteria 2250
202 Ga0495648_0316912 3300046524 Bacteria 724
203 Ga0495642_0004406 3300046528 Bacteria 5467
204 Ga0495609_0017476 3300046538 Bacteria 3331
205 Ga0495609_0048806 3300046538 Bacteria 1890
206 Ga0495609_0148075 3300046538 Bacteria 999
207 Ga0495597_0000322 3300046542 Bacteria 43315
208 Ga0495597_0000530 3300046542 Bacteria 31626
209 Ga0495622_0000471 3300046557 Bacteria 25560
210 Ga0495633_0000567 3300046558 Bacteria 36076
211 Ga0495633_0005198 3300046558 Bacteria 8038
212 Ga0495633_0006408 3300046558 Bacteria 6981
213 Ga0495633_0034889 3300046558 Bacteria 2418
214 Ga0495668_0000968 3300046616 Bacteria 31788
215 Ga0495668_0005696 3300046616 Bacteria 8339
216 Ga0495625_0000124 3300046660 Bacteria 120849
217 Ga0495625_0000468 3300046660 Bacteria 60719
218 Ga0495625_0008806 3300046660 Bacteria 8543
219 Ga0495625_0013263 3300046660 Bacteria 6631
220 Ga0495625_0258735 3300046660 Bacteria 1127
221 Ga0495658_0448620 3300046683 Bacteria 824
222 Ga0495671_0005616 3300046692 Bacteria 7316
223 Ga0495671_0058590 3300046692 Bacteria 1905
224 Ga0495649_0004375 3300046694 Bacteria 9243
225 Ga0495649_0026971 3300046694 Bacteria 3190
226 Ga0495649_0103299 3300046694 Bacteria 1513
227 Ga0495660_0009394 3300046810 Bacteria 5704
228 Ga0495672_0000398 3300047320 Bacteria 52924
229 Ga0495687_000768 3300047443 Bacteria 34771
230 Ga0495687_001376 3300047443 Bacteria 22480
231 Ga0495677_0092091 3300047445 Bacteria 1143
232 Ga0495677_0106204 3300047445 Bacteria 1065
233 Ga0495673_0000005 3300047469 Bacteria 943364
234 Ga0495673_0000199 3300047469 Bacteria 93637
235 Ga0495673_0211048 3300047469 Bacteria 722
236 Ga0495686_0007750 3300047472 Bacteria 7999
237 Ga0495615_0002001 3300048090 Bacteria 3168
238 Ga0496112_1170420 3300048915 Bacteria 686
239 Ga0496114_0460487 3300048917 Bacteria 1126
240 Ga0496119_0126999 3300048922 Bacteria 1394
241 Ga0496122_0191405 3300048925 Bacteria 1207
242 Ga0496123_0172112 3300048926 Bacteria 1141
243 Ga0496123_0173739 3300048926 Bacteria 1133
244 Ga0496124_0071115 3300048927 Bacteria 2885
245 Ga0496124_0691225 3300048927 Bacteria 648
246 Ga0496125_0000099 3300048928 Bacteria 203333
247 Ga0496125_0004213 3300048928 Bacteria 16756
248 Ga0496126_0092475 3300048929 Bacteria 2657
249 Ga0496126_0126416 3300048929 Bacteria 2212
250 Ga0496126_0754189 3300048929 Bacteria 751
251 Ga0496126_0937380 3300048929 Bacteria 654
252 Ga0495678_000291 3300049459 Bacteria 55271
253 Ga0495678_001981 3300049459 Bacteria 14750
254 Ga0495678_003460 3300049459 Bacteria 9782
255 Ga0501033_0563573 3300049570 Bacteria 784
256 Ga0501034_0000708 3300049571 Bacteria 50605
257 Ga0501034_0003790 3300049571 Bacteria 17063
258 Ga0501034_0981775 3300049571 Bacteria 729
259 Ga0501036_0738754 3300049572 Bacteria 812
260 Ga0501037_0355403 3300049573 Bacteria 1010
261 Ga0501046_0403286 3300049580 Bacteria 987
262 Ga0501047_0297302 3300049581 Bacteria 1457
263 Ga0501068_0010955 3300049584 Bacteria 5104
264 Ga0501070_0070467 3300049586 Bacteria 2895
265 Ga0501035_1144547 3300049822 Bacteria 606
266 Ga0501035_1225827 3300049822 Bacteria 581
267 Ga0501044_0093314 3300049823 Bacteria 3035
268 Ga0501044_0396504 3300049823 Bacteria 1293
269 nmdc:mga03683_73522_c1 3300050489 Bacteria 1465
270 nmdc:mga03683_77772_c1 3300050489 Bacteria 1428
271 nmdc:mga03683_89333_c1 3300050489 Bacteria 1341
272 nmdc:mga03n38_180839_c1 3300050490 Bacteria 1080
273 nmdc:mga03n38_454645_c1 3300050490 Bacteria 713
274 nmdc:mga0yw44_280627_c1 3300050492 Bacteria 1113
275 nmdc:mga0yw44_44198_c1 3300050492 Bacteria 2664
276 nmdc:mga0k408_43779_c1 3300050493 Bacteria 2581
277 nmdc:mga06z11_864677_c1 3300050494 Bacteria 551
278 nmdc:mga04h51_152815_c1 3300050495 Bacteria 883
279 nmdc:mga0sz30_212355_c1 3300050516 Bacteria 860
280 Ga0500610_0280549 3300053079 Bacteria 748
281 Ga0500647_0027056 3300053091 Bacteria 2709
282 Ga0500618_000332 3300053125 Bacteria 34213
283 Ga0500586_001122 3300053145 Bacteria 5534
284 Ga0500616_0002469 3300053153 Bacteria 15343
285 Ga0500634_0212239 3300053161 Bacteria 839
286 Ga0500609_019142 3300053731 Bacteria 933

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015262 Ga0182007_10132329 Ga0182007_101323292 131
2 3300053079 Ga0500610_0280549 Ga0500610_0280549_12_461 147
3 iso_pu_bacteria 2508501050 2508735091 147
4 iso_pu_bacteria 2508501114 2509078720 147
5 iso_pu_bacteria 2835312727 2835319296 147
6 iso_pu_bacteria 2857558681 2857560100 147
7 iso_pu_bacteria 2891373044 2891374844 147
8 iso_pu_bacteria 2894232714 2894236315 147
9 iso_pu_bacteria 2924762789 2924763472 147
10 iso_pu_bacteria 2987666974 2987667701 147
11 iso_pu_bacteria 2818991467 2819721168 148
12 iso_pu_bacteria 2643221733 2644729041 149
13 iso_pu_bacteria 2643221734 2644734078 149
14 iso_pu_bacteria 2773857925 2774872490 149
15 iso_pu_bacteria 2882456835 2882460013 149
16 iso_pu_bacteria 2884298095 2884300327 149
17 iso_pu_bacteria 2917699015 2917703164 149
18 iso_pu_bacteria 3003665799 3003666960 149
19 3300006042 Ga0075368_10414489 Ga0075368_104144891 150
20 3300006195 Ga0075366_10047680 Ga0075366_100476805 150
21 3300036401 Ga0373937_0448692 Ga0373937_0448692_491_946 150
22 3300050493 nmdc:mga0k408_43779_c1 nmdc:mga0k408_43779_c1_1694_2149 150
23 3300050494 nmdc:mga06z11_864677_c1 nmdc:mga06z11_864677_c1_37_492 150
24 3300002774 JGI25150J39212_1004563 JGI25150J39212_10045632 151
25 3300003771 Ga0055526_1000019 Ga0055526_1000019132 151
26 3300003771 Ga0055526_1000148 Ga0055526_100014840 151
27 3300005327 Ga0070658_10007364 Ga0070658_100073647 151
28 3300005331 Ga0070670_100003405 Ga0070670_10000340516 151
29 3300005336 Ga0070680_100020445 Ga0070680_1000204453 151
30 3300005341 Ga0070691_10052074 Ga0070691_100520742 151
31 3300005458 Ga0070681_10008181 Ga0070681_1000818110 151
32 3300005530 Ga0070679_100038200 Ga0070679_1000382002 151
33 3300005563 Ga0068855_100014728 Ga0068855_1000147283 151
34 3300005614 Ga0068856_100222240 Ga0068856_1002222403 151
35 3300006038 Ga0075365_11018294 Ga0075365_110182941 151
36 3300006042 Ga0075368_10187156 Ga0075368_101871562 151
37 3300006051 Ga0075364_10086501 Ga0075364_100865012 151
38 3300006177 Ga0075362_10050795 Ga0075362_100507952 151
39 3300009036 Ga0105244_10018555 Ga0105244_100185554 151
40 3300009093 Ga0105240_10031486 Ga0105240_100314866 151
41 3300015262 Ga0182007_10193316 Ga0182007_101933161 151
42 3300021361 Ga0213872_10000026 Ga0213872_1000002613 151
43 3300025233 Ga0209437_102012 Ga0209437_1020121 151
44 3300025245 Ga0207425_1000348 Ga0207425_100034825 151
45 3300025263 Ga0209565_1028017 Ga0209565_10280172 151
46 3300025294 Ga0209025_1002513 Ga0209025_100251316 151
47 3300025295 Ga0209564_1000002 Ga0209564_1000002753 151
48 3300025295 Ga0209564_1000007 Ga0209564_100000795 151
49 3300025728 Ga0207655_1027078 Ga0207655_10270783 151
50 3300025909 Ga0207705_10092721 Ga0207705_100927213 151
51 3300025912 Ga0207707_10007348 Ga0207707_100073483 151
52 3300025913 Ga0207695_10075514 Ga0207695_100755143 151
53 3300025917 Ga0207660_10008039 Ga0207660_100080397 151
54 3300025921 Ga0207652_10079248 Ga0207652_100792483 151
55 3300025925 Ga0207650_10056269 Ga0207650_100562692 151
56 3300025949 Ga0207667_10104209 Ga0207667_101042092 151
57 3300025981 Ga0207640_10675220 Ga0207640_106752201 151
58 3300026067 Ga0207678_11409424 Ga0207678_114094241 151
59 3300026078 Ga0207702_10201280 Ga0207702_102012803 151
60 3300026118 Ga0207675_100118676 Ga0207675_1001186762 151
61 3300031548 Ga0307408_100119940 Ga0307408_1001199402 151
62 3300031548 Ga0307408_100193880 Ga0307408_1001938802 151
63 3300031548 Ga0307408_100396181 Ga0307408_1003961811 151
64 3300031731 Ga0307405_10302295 Ga0307405_103022952 151
65 3300031852 Ga0307410_10070158 Ga0307410_100701582 151
66 3300031903 Ga0307407_10014299 Ga0307407_100142992 151
67 3300031911 Ga0307412_10096255 Ga0307412_100962553 151
68 3300032002 Ga0307416_100074420 Ga0307416_1000744203 151
69 3300032002 Ga0307416_100431582 Ga0307416_1004315821 151
70 3300032004 Ga0307414_10295974 Ga0307414_102959742 151
71 3300032126 Ga0307415_100625707 Ga0307415_1006257072 151
72 3300035241 Ga0373961_0091194 Ga0373961_0091194_182_640 151
73 3300039447 Ga0436361_0287447 Ga0436361_0287447_102507_102962 151
74 3300041486 Ga0451807_2245727 Ga0451807_2245727_114_572 151
75 3300046453 Ga0495627_079421 Ga0495627_079421_448_903 151
76 3300046457 Ga0495590_0000005 Ga0495590_0000005_46898_47353 151
77 3300046460 Ga0495638_0000436 Ga0495638_0000436_36640_37095 151
78 3300046460 Ga0495638_0225103 Ga0495638_0225103_52_507 151
79 3300046471 Ga0495650_0000648 Ga0495650_0000648_14327_14782 151
80 3300046471 Ga0495650_0001609 Ga0495650_0001609_17935_18390 151
81 3300046471 Ga0495650_0003360 Ga0495650_0003360_3512_3967 151
82 3300046474 Ga0495605_0000038 Ga0495605_0000038_35814_36269 151
83 3300046501 Ga0495607_0032592 Ga0495607_0032592_1675_2130 151
84 3300046506 Ga0495583_0000709 Ga0495583_0000709_36494_36949 151
85 3300046507 Ga0495606_0000053 Ga0495606_0000053_33084_33539 151
86 3300046507 Ga0495606_0010494 Ga0495606_0010494_4198_4653 151
87 3300046512 Ga0495610_0000181 Ga0495610_0000181_48505_48960 151
88 3300046512 Ga0495610_0017276 Ga0495610_0017276_675_1130 151
89 3300046512 Ga0495610_0077999 Ga0495610_0077999_135_590 151
90 3300046512 Ga0495610_0131025 Ga0495610_0131025_411_866 151
91 3300046512 Ga0495610_0288596 Ga0495610_0288596_142_597 151
92 3300046522 Ga0495643_0000195 Ga0495643_0000195_41923_42378 151
93 3300046522 Ga0495643_0000516 Ga0495643_0000516_5668_6123 151
94 3300046522 Ga0495643_0103381 Ga0495643_0103381_614_1072 151
95 3300046524 Ga0495648_0000002 Ga0495648_0000002_359511_359966 151
96 3300046524 Ga0495648_0060615 Ga0495648_0060615_1604_2059 151
97 3300046524 Ga0495648_0316912 Ga0495648_0316912_192_647 151
98 3300046528 Ga0495642_0004406 Ga0495642_0004406_467_922 151
99 3300046538 Ga0495609_0017476 Ga0495609_0017476_1121_1576 151
100 3300046538 Ga0495609_0048806 Ga0495609_0048806_915_1370 151
101 3300046538 Ga0495609_0148075 Ga0495609_0148075_147_602 151
102 3300046542 Ga0495597_0000322 Ga0495597_0000322_2955_3410 151
103 3300046542 Ga0495597_0000530 Ga0495597_0000530_11816_12271 151
104 3300046557 Ga0495622_0000471 Ga0495622_0000471_5808_6263 151
105 3300046558 Ga0495633_0000567 Ga0495633_0000567_29862_30317 151
106 3300046558 Ga0495633_0005198 Ga0495633_0005198_2599_3054 151
107 3300046558 Ga0495633_0006408 Ga0495633_0006408_1940_2395 151
108 3300046558 Ga0495633_0034889 Ga0495633_0034889_1402_1857 151
109 3300046616 Ga0495668_0000968 Ga0495668_0000968_17470_17925 151
110 3300046616 Ga0495668_0005696 Ga0495668_0005696_7866_8321 151
111 3300046660 Ga0495625_0000124 Ga0495625_0000124_83894_84349 151
112 3300046660 Ga0495625_0000468 Ga0495625_0000468_46875_47330 151
113 3300046660 Ga0495625_0008806 Ga0495625_0008806_3099_3554 151
114 3300046660 Ga0495625_0013263 Ga0495625_0013263_5951_6406 151
115 3300046660 Ga0495625_0258735 Ga0495625_0258735_592_1047 151
116 3300046692 Ga0495671_0058590 Ga0495671_0058590_216_671 151
117 3300046694 Ga0495649_0004375 Ga0495649_0004375_6949_7404 151
118 3300046694 Ga0495649_0026971 Ga0495649_0026971_837_1292 151
119 3300046694 Ga0495649_0103299 Ga0495649_0103299_777_1232 151
120 3300046810 Ga0495660_0009394 Ga0495660_0009394_2302_2757 151
121 3300047320 Ga0495672_0000398 Ga0495672_0000398_11187_11642 151
122 3300047443 Ga0495687_000768 Ga0495687_000768_12798_13253 151
123 3300047443 Ga0495687_001376 Ga0495687_001376_12804_13259 151
124 3300047445 Ga0495677_0092091 Ga0495677_0092091_128_583 151
125 3300047445 Ga0495677_0106204 Ga0495677_0106204_41_496 151
126 3300047469 Ga0495673_0000199 Ga0495673_0000199_65129_65584 151
127 3300047469 Ga0495673_0211048 Ga0495673_0211048_163_618 151
128 3300047472 Ga0495686_0007750 Ga0495686_0007750_5644_6099 151
129 3300048090 Ga0495615_0002001 Ga0495615_0002001_2700_3155 151
130 3300048922 Ga0496119_0126999 Ga0496119_0126999_772_1230 151
131 3300048927 Ga0496124_0071115 Ga0496124_0071115_1323_1778 151
132 3300048927 Ga0496124_0691225 Ga0496124_0691225_120_575 151
133 3300048929 Ga0496126_0937380 Ga0496126_0937380_120_575 151
134 3300049459 Ga0495678_000291 Ga0495678_000291_41247_41702 151
135 3300049459 Ga0495678_001981 Ga0495678_001981_11001_11456 151
136 3300049459 Ga0495678_003460 Ga0495678_003460_5727_6182 151
137 3300049571 Ga0501034_0003790 Ga0501034_0003790_8901_9359 151
138 3300050489 nmdc:mga03683_77772_c1 nmdc:mga03683_77772_c1_578_1036 151
139 3300050489 nmdc:mga03683_89333_c1 nmdc:mga03683_89333_c1_789_1247 151
140 3300050490 nmdc:mga03n38_454645_c1 nmdc:mga03n38_454645_c1_237_695 151
141 3300050492 nmdc:mga0yw44_44198_c1 nmdc:mga0yw44_44198_c1_121_579 151
142 3300050516 nmdc:mga0sz30_212355_c1 nmdc:mga0sz30_212355_c1_288_746 151
143 3300053091 Ga0500647_0027056 Ga0500647_0027056_1888_2346 151
144 3300053145 Ga0500586_001122 Ga0500586_001122_1360_1815 151
145 3300003771 Ga0055526_1000528 Ga0055526_10005287 152
146 3300005344 Ga0070661_100068629 Ga0070661_1000686294 152
147 3300005436 Ga0070713_100062036 Ga0070713_1000620366 152
148 3300005437 Ga0070710_10331453 Ga0070710_103314532 152
149 3300005439 Ga0070711_100645425 Ga0070711_1006454251 152
150 3300005548 Ga0070665_100003905 Ga0070665_10000390511 152
151 3300005548 Ga0070665_100023966 Ga0070665_1000239662 152
152 3300005563 Ga0068855_100378990 Ga0068855_1003789903 152
153 3300005843 Ga0068860_101722350 Ga0068860_1017223502 152
154 3300005937 Ga0081455_10012065 Ga0081455_100120653 152
155 3300005983 Ga0081540_1160228 Ga0081540_11602281 152
156 3300006177 Ga0075362_10116783 Ga0075362_101167832 152
157 3300006178 Ga0075367_10042577 Ga0075367_100425772 152
158 3300009093 Ga0105240_10245190 Ga0105240_102451904 152
159 3300009101 Ga0105247_10244366 Ga0105247_102443663 152
160 3300010375 Ga0105239_10687669 Ga0105239_106876692 152
161 3300013307 Ga0157372_10777062 Ga0157372_107770621 152
162 3300013308 Ga0157375_11136298 Ga0157375_111362982 152
163 3300014325 Ga0163163_12169095 Ga0163163_121690951 152
164 3300021384 Ga0213876_10484723 Ga0213876_104847231 152
165 3300025295 Ga0209564_1000752 Ga0209564_100075226 152
166 3300025302 Ga0207426_1036980 Ga0207426_10369802 152
167 3300025907 Ga0207645_10424785 Ga0207645_104247852 152
168 3300025949 Ga0207667_10158188 Ga0207667_101581884 152
169 3300025986 Ga0207658_10887368 Ga0207658_108873682 152
170 3300026116 Ga0207674_10206372 Ga0207674_102063722 152
171 3300026121 Ga0207683_10438965 Ga0207683_104389653 152
172 3300028379 Ga0268266_10139292 Ga0268266_101392922 152
173 3300036401 Ga0373937_0255856 Ga0373937_0255856_121_621 152
174 3300037068 Ga0373925_0361531 Ga0373925_0361531_306_773 152
175 3300037068 Ga0373925_0535288 Ga0373925_0535288_283_747 152
176 3300041501 Ga0451845_0997305 Ga0451845_0997305_65_535 152
177 3300048915 Ga0496112_1170420 Ga0496112_1170420_110_574 152
178 3300049570 Ga0501033_0563573 Ga0501033_0563573_288_752 152
179 3300049571 Ga0501034_0000708 Ga0501034_0000708_32806_33270 152
180 3300049571 Ga0501034_0981775 Ga0501034_0981775_110_574 152
181 3300049572 Ga0501036_0738754 Ga0501036_0738754_317_781 152
182 3300049573 Ga0501037_0355403 Ga0501037_0355403_531_995 152
183 3300049580 Ga0501046_0403286 Ga0501046_0403286_378_842 152
184 3300049581 Ga0501047_0297302 Ga0501047_0297302_616_1080 152
185 3300049584 Ga0501068_0010955 Ga0501068_0010955_362_826 152
186 3300049586 Ga0501070_0070467 Ga0501070_0070467_663_1127 152
187 3300049822 Ga0501035_1225827 Ga0501035_1225827_47_511 152
188 3300049823 Ga0501044_0093314 Ga0501044_0093314_1984_2448 152
189 3300049823 Ga0501044_0396504 Ga0501044_0396504_539_1003 152
190 3300050489 nmdc:mga03683_73522_c1 nmdc:mga03683_73522_c1_289_753 152
191 3300050492 nmdc:mga0yw44_280627_c1 nmdc:mga0yw44_280627_c1_231_695 152
192 3300053153 Ga0500616_0002469 Ga0500616_0002469_14774_15238 152
193 3300053161 Ga0500634_0212239 Ga0500634_0212239_119_580 152
194 3300053731 Ga0500609_019142 Ga0500609_019142_217_681 152
195 3300003203 JGI25406J46586_10000268 JGI25406J46586_1000026813 153
196 3300003775 Ga0055524_1010161 Ga0055524_10101613 153
197 3300005327 Ga0070658_11041510 Ga0070658_110415101 153
198 3300005328 Ga0070676_10332071 Ga0070676_103320711 153
199 3300005329 Ga0070683_100129394 Ga0070683_1001293943 153
200 3300005330 Ga0070690_100040236 Ga0070690_1000402364 153
201 3300005355 Ga0070671_100127796 Ga0070671_1001277962 153
202 3300005356 Ga0070674_100653862 Ga0070674_1006538621 153
203 3300005366 Ga0070659_100067579 Ga0070659_1000675793 153
204 3300005456 Ga0070678_100047959 Ga0070678_1000479594 153
205 3300005459 Ga0068867_100069268 Ga0068867_1000692682 153
206 3300005535 Ga0070684_100172547 Ga0070684_1001725473 153
207 3300005539 Ga0068853_100088386 Ga0068853_1000883863 153
208 3300005547 Ga0070693_100196323 Ga0070693_1001963232 153
209 3300005548 Ga0070665_100023335 Ga0070665_1000233352 153
210 3300005548 Ga0070665_100188933 Ga0070665_1001889331 153
211 3300005548 Ga0070665_100227225 Ga0070665_1002272252 153
212 3300005548 Ga0070665_100231292 Ga0070665_1002312923 153
213 3300005563 Ga0068855_100475701 Ga0068855_1004757012 153
214 3300005564 Ga0070664_100005729 Ga0070664_1000057298 153
215 3300005577 Ga0068857_100288127 Ga0068857_1002881272 153
216 3300005614 Ga0068856_100311249 Ga0068856_1003112492 153
217 3300005616 Ga0068852_100410630 Ga0068852_1004106303 153
218 3300005834 Ga0068851_10088070 Ga0068851_100880703 153
219 3300005985 Ga0081539_10001411 Ga0081539_1000141124 153
220 3300006048 Ga0075363_100241286 Ga0075363_1002412861 153
221 3300006163 Ga0070715_10071536 Ga0070715_100715363 153
222 3300009174 Ga0105241_10380586 Ga0105241_103805863 153
223 3300009545 Ga0105237_10000203 Ga0105237_1000020335 153
224 3300010375 Ga0105239_10042354 Ga0105239_100423542 153
225 3300010375 Ga0105239_10044953 Ga0105239_100449535 153
226 3300013102 Ga0157371_10045502 Ga0157371_100455025 153
227 3300013104 Ga0157370_10918889 Ga0157370_109188892 153
228 3300013105 Ga0157369_10087860 Ga0157369_100878605 153
229 3300013306 Ga0163162_10378103 Ga0163162_103781032 153
230 3300013307 Ga0157372_10275222 Ga0157372_102752223 153
231 3300014497 Ga0182008_10092113 Ga0182008_100921132 153
232 3300014745 Ga0157377_10344821 Ga0157377_103448212 153
233 3300020070 Ga0206356_10292831 Ga0206356_102928312 153
234 3300025299 Ga0209256_1000378 Ga0209256_100037828 153
235 3300025303 Ga0209051_1062265 Ga0209051_10622652 153
236 3300025321 Ga0207656_10139653 Ga0207656_101396532 153
237 3300025901 Ga0207688_10011513 Ga0207688_100115135 153
238 3300025904 Ga0207647_10080801 Ga0207647_100808012 153
239 3300025905 Ga0207685_10126815 Ga0207685_101268151 153
240 3300025907 Ga0207645_10058123 Ga0207645_100581234 153
241 3300025914 Ga0207671_10000177 Ga0207671_1000017735 153
242 3300025919 Ga0207657_10137810 Ga0207657_101378102 153
243 3300025921 Ga0207652_10578921 Ga0207652_105789212 153
244 3300025924 Ga0207694_10027772 Ga0207694_100277723 153
245 3300025926 Ga0207659_10143948 Ga0207659_101439482 153
246 3300025932 Ga0207690_10271177 Ga0207690_102711773 153
247 3300025937 Ga0207669_10095608 Ga0207669_100956082 153
248 3300025944 Ga0207661_10232946 Ga0207661_102329462 153
249 3300025945 Ga0207679_10162396 Ga0207679_101623962 153
250 3300025949 Ga0207667_10132476 Ga0207667_101324763 153
251 3300025981 Ga0207640_11566608 Ga0207640_115666081 153
252 3300026078 Ga0207702_10033995 Ga0207702_100339953 153
253 3300026089 Ga0207648_10603576 Ga0207648_106035761 153
254 3300026116 Ga0207674_10604676 Ga0207674_106046762 153
255 3300026121 Ga0207683_10068662 Ga0207683_100686624 153
256 3300026142 Ga0207698_10042262 Ga0207698_100422623 153
257 3300028379 Ga0268266_10003595 Ga0268266_1000359513 153
258 3300028379 Ga0268266_10481150 Ga0268266_104811502 153
259 3300028379 Ga0268266_11098808 Ga0268266_110988082 153
260 3300028380 Ga0268265_10227422 Ga0268265_102274223 153
261 3300031852 Ga0307410_10352359 Ga0307410_103523592 153
262 3300031911 Ga0307412_10987660 Ga0307412_109876601 153
263 3300035410 Ga0373924_0039259 Ga0373924_0039259_627_1094 153
264 3300035691 Ga0373931_0314531 Ga0373931_0314531_404_910 153
265 3300035691 Ga0373931_0318727 Ga0373931_0318727_331_798 153
266 3300035695 Ga0373927_0120699 Ga0373927_0120699_95_562 153
267 3300037312 Ga0395899_0002769 Ga0395899_0002769_13008_13511 153
268 3300037312 Ga0395899_0015673 Ga0395899_0015673_2483_2989 153
269 3300037418 Ga0395900_0004636 Ga0395900_0004636_2948_3451 153
270 3300037418 Ga0395900_0005759 Ga0395900_0005759_2451_2957 153
271 3300037466 Ga0395898_0047948 Ga0395898_0047948_2103_2606 153
272 3300037471 Ga0395905_0477138 Ga0395905_0477138_616_1095 153
273 3300038443 Ga0395901_0004425 Ga0395901_0004425_11401_11904 153
274 3300038443 Ga0395901_0005311 Ga0395901_0005311_8253_8759 153
275 3300041453 Ga0451797_0031610 Ga0451797_0031610_58_525 153
276 3300041997 Ga0439431_0088384 Ga0439431_0088384_288_764 153
277 3300042004 Ga0439445_0041455 Ga0439445_0041455_382_858 153
278 3300044694 Ga0466963_0166329 Ga0466963_0166329_609_1112 153
279 3300044842 Ga0466957_0007211 Ga0466957_0007211_1084_1587 153
280 3300045976 Ga0466967_0199490 Ga0466967_0199490_679_1182 153
281 3300046512 Ga0495610_0311795 Ga0495610_0311795_76_558 153
282 3300046683 Ga0495658_0448620 Ga0495658_0448620_169_636 153
283 3300046692 Ga0495671_0005616 Ga0495671_0005616_621_1112 153
284 3300048917 Ga0496114_0460487 Ga0496114_0460487_300_767 153
285 3300048925 Ga0496122_0191405 Ga0496122_0191405_106_603 153
286 3300048926 Ga0496123_0172112 Ga0496123_0172112_586_1083 153
287 3300048926 Ga0496123_0173739 Ga0496123_0173739_266_766 153
288 3300048928 Ga0496125_0000099 Ga0496125_0000099_20453_20950 153
289 3300048928 Ga0496125_0004213 Ga0496125_0004213_8420_8917 153
290 3300048929 Ga0496126_0126416 Ga0496126_0126416_413_910 153
291 3300048929 Ga0496126_0754189 Ga0496126_0754189_132_620 153
292 3300049822 Ga0501035_1144547 Ga0501035_1144547_72_563 153
293 3300050490 nmdc:mga03n38_180839_c1 nmdc:mga03n38_180839_c1_378_890 153
294 3300050495 nmdc:mga04h51_152815_c1 nmdc:mga04h51_152815_c1_59_535 153
295 3300002738 JGI25154J39366_1000535 JGI25154J39366_10005356 154
296 3300025246 Ga0209646_1000007 Ga0209646_100000747 154
297 3300025250 Ga0209026_1015403 Ga0209026_10154032 154
298 3300044683 Ga0466965_0219698 Ga0466965_0219698_475_954 154
299 3300046507 Ga0495606_0001197 Ga0495606_0001197_3098_3562 154
300 3300047469 Ga0495673_0000005 Ga0495673_0000005_832975_833442 154
301 3300048929 Ga0496126_0092475 Ga0496126_0092475_1734_2228 154
302 3300053125 Ga0500618_000332 Ga0500618_000332_20357_20824 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

23

143

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.9349 5 152
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.9173 5 152
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9165 3 153
2cx5-assembly3.cif.gz_C crystal structure of a putative trans-editing enzyme for prolyl trna synthetase 0.9082 3 153
3ri0-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9011 3 153
ID Description Score Start End Superfamily
af_Q4D973_68_232_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9377 2 153 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9276 5 152 3.90.960.10
af_Q4D973_68_232_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9202 2 153 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9158 5 152 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9025 5 150 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A7C6PW45-F1-model_v4 YbaK/EbsC family protein 0.9805 1 152 GO:0002161
AF-A0A2X5NU96-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase ybaK 0.9773 32 152 GO:0002161
AF-A0A379UZN2-F1-model_v4 tRNA proofreading protein 0.9749 4 152 GO:0002161
GO:0016020
AF-A0A1G5YIC9-F1-model_v4 deleted 0.9724 1 154
AF-A0A2S5K9E9-F1-model_v4 Cys-tRNA(Pro)/cys-tRNA(Cys) deacylase 0.9721 1 154 GO:0002161

Feature Viewer

pLDDT pTM Quality
91.92 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map