F396303

General Info

Members Datasets Scaffolds Average Seq Length
302 212 604 135

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_101117166|Ga0070670_1011171661
Length 144
Sequence MKEGIEVVGLYVRDQDEALAFYVEKIGFRVHTDVKNGDYRWLTVQHPEQPSFQLGLFRPQAPVVDAGTVRVLEEVVAKGAMPPLVLVVDDCRAAYERMRAAGVEFTQEPVERFGTVDAGFRDPSGNGWKMIGARRGRGGGRTED

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
139 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
140 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
141 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
147 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
206 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
207 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
208 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
209 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
210 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
211 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
212 2929520902 Variovorax beijingensis 502 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.68
Metatranscriptomes 0
Isolates 2.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.6
Nodule 0.33
Rhizoplane 3.64
Rhizosphere 80.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_101117166 3300005331 Bacteria 719
2 JGI25152J39213_1000819 3300002773 Bacteria 15524
3 JGI25151J46595_10000485 3300003187 Bacteria 37594
4 JGI25153J46596_10008333 3300003215 Bacteria 4972
5 rootL2_10019046 3300003322 Bacteria 7070
6 Ga0055526_1015007 3300003771 Bacteria 3139
7 Ga0055540_1000754 3300003792 Bacteria 21953
8 Ga0055540_1011420 3300003792 Bacteria 2866
9 Ga0070658_10123797 3300005327 Bacteria 2150
10 Ga0070658_10347799 3300005327 Bacteria 1269
11 Ga0070683_101400523 3300005329 Bacteria 672
12 Ga0070683_101546169 3300005329 Bacteria 638
13 Ga0070690_100062846 3300005330 Bacteria 2395
14 Ga0070690_100946341 3300005330 Bacteria 676
15 Ga0068869_100899614 3300005334 Bacteria 766
16 Ga0070682_100000886 3300005337 Bacteria 17470
17 Ga0070660_100509267 3300005339 Bacteria 1002
18 Ga0070689_100003647 3300005340 Bacteria 10272
19 Ga0070689_102241074 3300005340 Bacteria 501
20 Ga0070687_100436067 3300005343 Bacteria 868
21 Ga0070675_100846207 3300005354 Bacteria 837
22 Ga0070688_100060159 3300005365 Bacteria 2398
23 Ga0070659_100019984 3300005366 Bacteria 5084
24 Ga0070667_100354427 3300005367 Bacteria 1329
25 Ga0070714_100039767 3300005435 Bacteria 3961
26 Ga0070714_100162456 3300005435 Bacteria 2022
27 Ga0070713_100007084 3300005436 Bacteria 7837
28 Ga0070701_10680737 3300005438 Bacteria 690
29 Ga0070705_100679756 3300005440 Bacteria 806
30 Ga0070700_100149922 3300005441 Bacteria 1594
31 Ga0070694_100275191 3300005444 Bacteria 1282
32 Ga0070662_100320337 3300005457 Bacteria 1264
33 Ga0070685_11504035 3300005466 Bacteria 519
34 Ga0068853_100388749 3300005539 Bacteria 1304
35 Ga0070686_100133539 3300005544 Bacteria 1719
36 Ga0070686_101001761 3300005544 Bacteria 685
37 Ga0070695_100125788 3300005545 Bacteria 1760
38 Ga0070696_100058356 3300005546 Bacteria 2695
39 Ga0070696_100474799 3300005546 Bacteria 991
40 Ga0070665_100063901 3300005548 Bacteria 3691
41 Ga0068855_100232414 3300005563 Bacteria 2064
42 Ga0068855_101108140 3300005563 Bacteria 827
43 Ga0068855_101124157 3300005563 Bacteria 820
44 Ga0068855_101268334 3300005563 Bacteria 764
45 Ga0068856_101034920 3300005614 Bacteria 839
46 Ga0070702_100166832 3300005615 Bacteria 1429
47 Ga0068859_101186329 3300005617 Bacteria 841
48 Ga0068861_100023524 3300005719 Bacteria 4444
49 Ga0068861_100479303 3300005719 Bacteria 1121
50 Ga0068863_100054816 3300005841 Bacteria 3777
51 Ga0068863_100299030 3300005841 Bacteria 1561
52 Ga0068858_100342837 3300005842 Bacteria 1430
53 Ga0068860_100133876 3300005843 Bacteria 2380
54 Ga0068862_100218026 3300005844 Bacteria 1726
55 Ga0081455_10267338 3300005937 Bacteria 1242
56 Ga0081455_10309901 3300005937 Bacteria 1129
57 Ga0070717_10007931 3300006028 Bacteria 7909
58 Ga0075365_10292159 3300006038 Bacteria 1147
59 Ga0075364_10806202 3300006051 Bacteria 640
60 Ga0075362_10002722 3300006177 Bacteria 6022
61 Ga0097621_100149897 3300006237 Bacteria 2000
62 Ga0075370_10053814 3300006353 Bacteria 2284
63 Ga0075430_100556302 3300006846 Bacteria 946
64 Ga0068865_101036164 3300006881 Bacteria 720
65 Ga0097620_101186289 3300006931 Bacteria 841
66 Ga0099826_10043224 3300006948 Bacteria 3105
67 Ga0105251_10006922 3300009011 Bacteria 7103
68 Ga0105243_10832202 3300009148 Bacteria 912
69 Ga0105242_10703974 3300009176 Bacteria 989
70 Ga0105242_10934608 3300009176 Bacteria 870
71 Ga0105248_10655797 3300009177 Bacteria 1184
72 Ga0105248_10834415 3300009177 Bacteria 1040
73 Ga0105238_10438818 3300009551 Bacteria 1302
74 Ga0105238_11249225 3300009551 Bacteria 768
75 Ga0105249_10302220 3300009553 Bacteria 1605
76 Ga0157373_10020811 3300013100 Bacteria 4762
77 Ga0157371_10104335 3300013102 Bacteria 2012
78 Ga0157369_11747142 3300013105 Bacteria 632
79 Ga0157372_10142430 3300013307 Bacteria 2763
80 Ga0157372_12251219 3300013307 Bacteria 626
81 Ga0157380_10094477 3300014326 Bacteria 2475
82 Ga0182008_10185716 3300014497 Bacteria 1053
83 Ga0157379_10991824 3300014968 Bacteria 800
84 Ga0163161_10441467 3300017792 Bacteria 1050
85 Ga0213876_10016190 3300021384 Bacteria 3941
86 Ga0213876_10028818 3300021384 Bacteria 2928
87 Ga0207425_1000336 3300025245 Bacteria 32559
88 Ga0209129_1000148 3300025258 Bacteria 114559
89 Ga0209129_1015983 3300025258 Bacteria 1522
90 Ga0209673_1039493 3300025273 Bacteria 1362
91 Ga0209025_1000029 3300025294 Bacteria 488571
92 Ga0209564_1000251 3300025295 Bacteria 114511
93 Ga0209758_1000387 3300025297 Bacteria 76099
94 Ga0209256_1021541 3300025299 Bacteria 1975
95 Ga0209051_1000128 3300025303 Bacteria 142159
96 Ga0209051_1003383 3300025303 Bacteria 10475
97 Ga0209257_1082096 3300025304 Bacteria 824
98 Ga0207713_1094918 3300025735 Bacteria 1040
99 Ga0207647_10009232 3300025904 Bacteria 7014
100 Ga0207699_11476941 3300025906 Bacteria 503
101 Ga0207705_10289068 3300025909 Bacteria 1256
102 Ga0207684_10640507 3300025910 Bacteria 906
103 Ga0207671_11321506 3300025914 Bacteria 561
104 Ga0207662_10178757 3300025918 Bacteria 1364
105 Ga0207649_10280496 3300025920 Bacteria 1211
106 Ga0207694_11857819 3300025924 Bacteria 506
107 Ga0207700_10021105 3300025928 Bacteria 4439
108 Ga0207664_10077612 3300025929 Bacteria 2691
109 Ga0207664_10116399 3300025929 Bacteria 2230
110 Ga0207690_10010168 3300025932 Bacteria 5589
111 Ga0207706_10301062 3300025933 Bacteria 1397
112 Ga0207686_10471773 3300025934 Bacteria 969
113 Ga0207686_10542446 3300025934 Bacteria 908
114 Ga0207670_10006330 3300025936 Bacteria 6558
115 Ga0207669_10097220 3300025937 Bacteria 1935
116 Ga0207704_10159188 3300025938 Bacteria 1604
117 Ga0207711_10806698 3300025941 Bacteria 874
118 Ga0207689_10188550 3300025942 Bacteria 1701
119 Ga0207689_10457272 3300025942 Bacteria 1067
120 Ga0207679_10812618 3300025945 Bacteria 853
121 Ga0207667_10280094 3300025949 Bacteria 1704
122 Ga0207667_10879850 3300025949 Bacteria 889
123 Ga0207667_11411558 3300025949 Bacteria 669
124 Ga0207667_11418922 3300025949 Bacteria 667
125 Ga0207712_10369609 3300025961 Bacteria 1197
126 Ga0207668_10179660 3300025972 Bacteria 1668
127 Ga0207703_11665418 3300026035 Bacteria 614
128 Ga0207708_10356338 3300026075 Bacteria 1201
129 Ga0207708_10469873 3300026075 Bacteria 1050
130 Ga0207702_10369800 3300026078 Bacteria 1376
131 Ga0207702_10800324 3300026078 Bacteria 932
132 Ga0207641_10041031 3300026088 Bacteria 3878
133 Ga0207648_10206522 3300026089 Bacteria 1743
134 Ga0207674_10280130 3300026116 Bacteria 1615
135 Ga0207675_100012113 3300026118 Bacteria 8057
136 Ga0207675_100019637 3300026118 Bacteria 6308
137 Ga0207698_12188797 3300026142 Bacteria 566
138 Ga0268266_10076273 3300028379 Bacteria 2913
139 Ga0268265_10178571 3300028380 Bacteria 1822
140 Ga0268265_11903264 3300028380 Bacteria 602
141 Ga0268264_10087609 3300028381 Bacteria 2677
142 Ga0268264_10261201 3300028381 Bacteria 1613
143 Ga0268264_12503681 3300028381 Bacteria 521
144 Ga0307515_10265669 3300028794 Bacteria 1445
145 Ga0265324_10047561 3300029957 Bacteria 1475
146 Ga0265320_10066915 3300031240 Bacteria 1702
147 Ga0307513_10646547 3300031456 Bacteria 765
148 Ga0307408_100005843 3300031548 Bacteria 8185
149 Ga0307405_10045084 3300031731 Bacteria 2700
150 Ga0307413_10534350 3300031824 Bacteria 948
151 Ga0307410_10234513 3300031852 Bacteria 1419
152 Ga0307406_10000605 3300031901 Bacteria 20510
153 Ga0307407_10309225 3300031903 Bacteria 1105
154 Ga0307412_10082659 3300031911 Bacteria 2224
155 Ga0307416_100412711 3300032002 Bacteria 1392
156 Ga0307416_100524250 3300032002 Bacteria 1254
157 Ga0307414_10115701 3300032004 Bacteria 2051
158 Ga0307411_10397583 3300032005 Bacteria 1138
159 Ga0307415_100464584 3300032126 Bacteria 1098
160 Ga0307415_101640150 3300032126 Bacteria 619
161 Ga0373960_0335005 3300035121 Bacteria 570
162 Ga0373955_0386628 3300035172 Bacteria 849
163 Ga0373931_0255793 3300035691 Bacteria 1067
164 Ga0373937_0013849 3300036401 Bacteria 7108
165 Ga0395899_0000317 3300037312 Bacteria 61581
166 Ga0395899_0005227 3300037312 Bacteria 10095
167 Ga0395899_0204262 3300037312 Bacteria 1376
168 Ga0395900_0000238 3300037418 Bacteria 86469
169 Ga0395900_0086635 3300037418 Bacteria 3219
170 Ga0395900_0120088 3300037418 Bacteria 2697
171 Ga0395900_0121010 3300037418 Bacteria 2685
172 Ga0395900_0254371 3300037418 Bacteria 1756
173 Ga0395900_0255404 3300037418 Bacteria 1752
174 Ga0395900_0257600 3300037418 Bacteria 1743
175 Ga0395900_0383196 3300037418 Bacteria 1373
176 Ga0395898_0000245 3300037466 Bacteria 136315
177 Ga0395898_0026873 3300037466 Bacteria 5784
178 Ga0395898_0045050 3300037466 Bacteria 4337
179 Ga0395898_0082322 3300037466 Bacteria 3102
180 Ga0395898_0342737 3300037466 Bacteria 1425
181 Ga0395898_1035543 3300037466 Bacteria 756
182 Ga0395905_0000006 3300037471 Bacteria 549428
183 Ga0395905_0013230 3300037471 Bacteria 7918
184 Ga0395905_0027909 3300037471 Bacteria 5321
185 Ga0395905_0036778 3300037471 Bacteria 4599
186 Ga0395905_0051103 3300037471 Bacteria 3871
187 Ga0395905_0061763 3300037471 Bacteria 3505
188 Ga0395905_0074624 3300037471 Bacteria 3179
189 Ga0395905_0150786 3300037471 Bacteria 2187
190 Ga0395905_0160385 3300037471 Bacteria 2114
191 Ga0395905_0288965 3300037471 Bacteria 1526
192 Ga0395905_0357757 3300037471 Bacteria 1352
193 Ga0395905_0536748 3300037471 Bacteria 1070
194 Ga0395905_0622307 3300037471 Bacteria 981
195 Ga0395905_0652021 3300037471 Bacteria 955
196 Ga0395901_0000156 3300038443 Bacteria 88513
197 Ga0395901_0010982 3300038443 Bacteria 9176
198 Ga0395901_0055486 3300038443 Bacteria 4120
199 Ga0395901_0055737 3300038443 Bacteria 4111
200 Ga0395901_0154617 3300038443 Bacteria 2409
201 Ga0395901_0540851 3300038443 Bacteria 1181
202 Ga0395901_0832536 3300038443 Bacteria 909
203 Ga0395901_0860075 3300038443 Bacteria 891
204 Ga0395901_0973206 3300038443 Bacteria 826
205 Ga0237816_00279 3300039145 Bacteria 4342
206 Ga0436365_0516822 3300039437 Bacteria 4525
207 Ga0436365_1463747 3300039437 Bacteria 11274
208 Ga0436363_0341613 3300039450 Bacteria 989
209 Ga0451795_0262953 3300041456 Bacteria 540
210 Ga0451798_1107070 3300041458 Bacteria 857
211 Ga0451800_0649006 3300041459 Bacteria 1946
212 Ga0451802_0371345 3300041460 Bacteria 1208
213 Ga0451807_0301182 3300041486 Bacteria 3230
214 Ga0451807_0925252 3300041486 Bacteria 561
215 Ga0451835_0273820 3300041492 Bacteria 524
216 Ga0451853_3746577 3300041512 Bacteria 1703
217 Ga0439448_0032303 3300042005 Bacteria 1665
218 Ga0439455_0039157 3300042012 Bacteria 1208
219 Ga0450890_016699 3300042127 Bacteria 973
220 Ga0466960_0260095 3300044901 Bacteria 967
221 Ga0495638_0001680 3300046460 Bacteria 19581
222 Ga0495650_0003710 3300046471 Bacteria 10931
223 Ga0495639_0002346 3300046475 Bacteria 8275
224 Ga0495583_0001383 3300046506 Bacteria 24824
225 Ga0495632_0432827 3300046519 Bacteria 572
226 Ga0495643_0001163 3300046522 Bacteria 25714
227 Ga0495643_0204933 3300046522 Bacteria 945
228 Ga0495648_0001296 3300046524 Bacteria 24870
229 Ga0495648_0001297 3300046524 Bacteria 24870
230 Ga0495642_0005963 3300046528 Bacteria 4676
231 Ga0495609_0009842 3300046538 Bacteria 4609
232 Ga0495597_0001115 3300046542 Bacteria 20308
233 Ga0495645_0509782 3300046543 Bacteria 751
234 Ga0495622_0000936 3300046557 Bacteria 15721
235 Ga0495633_0000917 3300046558 Bacteria 24985
236 Ga0495668_0365845 3300046616 Bacteria 792
237 Ga0495625_0001765 3300046660 Bacteria 25007
238 Ga0495625_0013181 3300046660 Bacteria 6658
239 Ga0495649_0352003 3300046694 Bacteria 744
240 Ga0495672_0004889 3300047320 Bacteria 10772
241 Ga0495686_0197424 3300047472 Bacteria 1156
242 Ga0495615_0023188 3300048090 Bacteria 1420
243 Ga0496101_0931247 3300048904 Bacteria 684
244 Ga0496106_1503629 3300048909 Bacteria 518
245 Ga0496109_0430134 3300048912 Bacteria 1247
246 Ga0496112_0004521 3300048915 Bacteria 11813
247 Ga0496113_0021916 3300048916 Bacteria 4512
248 Ga0495678_005600 3300049459 Bacteria 6877
249 Ga0501032_0567951 3300049569 Bacteria 723
250 Ga0501033_0106676 3300049570 Bacteria 2041
251 Ga0501034_0029260 3300049571 Bacteria 5600
252 Ga0501034_0049594 3300049571 Bacteria 4236
253 Ga0501034_0324229 3300049571 Bacteria 1473
254 Ga0501034_0369252 3300049571 Bacteria 1361
255 Ga0501036_0221702 3300049572 Bacteria 1588
256 Ga0501037_0125929 3300049573 Bacteria 1839
257 Ga0501038_0193681 3300049574 Bacteria 1635
258 Ga0501043_0381615 3300049579 Bacteria 1067
259 Ga0501046_0014525 3300049580 Bacteria 6641
260 Ga0501047_0000317 3300049581 Bacteria 55524
261 Ga0501047_0050596 3300049581 Bacteria 4013
262 Ga0501067_0175091 3300049583 Bacteria 1195
263 Ga0501068_0038844 3300049584 Bacteria 2853
264 Ga0501069_0211215 3300049585 Bacteria 1126
265 Ga0501070_0000512 3300049586 Bacteria 35492
266 Ga0501070_0198926 3300049586 Bacteria 1646
267 Ga0501073_0008340 3300049589 Bacteria 7686
268 Ga0501073_0732213 3300049589 Bacteria 682
269 Ga0501074_0191927 3300049590 Bacteria 1456
270 Ga0501080_0114468 3300049742 Bacteria 2500
271 Ga0501081_0095812 3300049743 Bacteria 2093
272 Ga0501083_0001417 3300049744 Bacteria 16340
273 Ga0501083_0001982 3300049744 Bacteria 14079
274 Ga0501083_0806380 3300049744 Bacteria 611
275 Ga0501035_0126088 3300049822 Bacteria 2235
276 Ga0501035_0129049 3300049822 Bacteria 2205
277 Ga0501044_0510547 3300049823 Bacteria 1102
278 Ga0501044_0722079 3300049823 Bacteria 880
279 nmdc:mga03683_2976_c1 3300050489 Bacteria 5361
280 nmdc:mga00v17_199127_c1 3300050491 Bacteria 1294
281 nmdc:mga07m45_838329_c1 3300050496 Bacteria 526
282 nmdc:mga07m45_922_c1 3300050496 Bacteria 12863
283 nmdc:mga0qj67_593517_c1 3300050509 Bacteria 886
284 nmdc:mga0n895_1013982_c1 3300050512 Bacteria 811
285 Ga0500583_0005221 3300053092 Bacteria 4330
286 Ga0500564_282063 3300053138 Bacteria 645
287 Ga0500568_0192970 3300053139 Bacteria 747
288 Ga0500616_0000018 3300053153 Bacteria 610976
289 Ga0501084_0493145 3300054114 Bacteria 1035
290 Ga0501084_0575952 3300054114 Bacteria 951
291 Ga0501082_0000658 3300060353 Bacteria 30491
292 Ga0501082_0003138 3300060353 Bacteria 14420
293 Ga0501082_0394709 3300060353 Bacteria 1207
294 Ga0501082_1175045 3300060353 Bacteria 671
295 Ga0530510_1536110 3300061734 Bacteria 511
296 2538834291 2537561836 Bacteria 3910579
297 2643828657 2643221562 Bacteria 4048635
298 2643896264 2643221577 Bacteria 3710843
299 2644478481 2643221685 Bacteria 3673288
300 2904542801 2904541872 Bacteria 8915136
301 2929168051 2929160207 Bacteria 9075316
302 2929522150 2929520902 Bacteria 6765052
303 Ga0070670_101117166
304 JGI25152J39213_1000819
305 JGI25151J46595_10000485
306 JGI25153J46596_10008333
307 rootL2_10019046
308 Ga0055526_1015007
309 Ga0055540_1000754
310 Ga0055540_1011420
311 Ga0070658_10123797
312 Ga0070658_10347799
313 Ga0070683_101400523
314 Ga0070683_101546169
315 Ga0070690_100062846
316 Ga0070690_100946341
317 Ga0068869_100899614
318 Ga0070682_100000886
319 Ga0070660_100509267
320 Ga0070689_100003647
321 Ga0070689_102241074
322 Ga0070687_100436067
323 Ga0070675_100846207
324 Ga0070688_100060159
325 Ga0070659_100019984
326 Ga0070667_100354427
327 Ga0070714_100039767
328 Ga0070714_100162456
329 Ga0070713_100007084
330 Ga0070701_10680737
331 Ga0070705_100679756
332 Ga0070700_100149922
333 Ga0070694_100275191
334 Ga0070662_100320337
335 Ga0070685_11504035
336 Ga0068853_100388749
337 Ga0070686_100133539
338 Ga0070686_101001761
339 Ga0070695_100125788
340 Ga0070696_100058356
341 Ga0070696_100474799
342 Ga0070665_100063901
343 Ga0068855_100232414
344 Ga0068855_101108140
345 Ga0068855_101124157
346 Ga0068855_101268334
347 Ga0068856_101034920
348 Ga0070702_100166832
349 Ga0068859_101186329
350 Ga0068861_100023524
351 Ga0068861_100479303
352 Ga0068863_100054816
353 Ga0068863_100299030
354 Ga0068858_100342837
355 Ga0068860_100133876
356 Ga0068862_100218026
357 Ga0081455_10267338
358 Ga0081455_10309901
359 Ga0070717_10007931
360 Ga0075365_10292159
361 Ga0075364_10806202
362 Ga0075362_10002722
363 Ga0097621_100149897
364 Ga0075370_10053814
365 Ga0075430_100556302
366 Ga0068865_101036164
367 Ga0097620_101186289
368 Ga0099826_10043224
369 Ga0105251_10006922
370 Ga0105243_10832202
371 Ga0105242_10703974
372 Ga0105242_10934608
373 Ga0105248_10655797
374 Ga0105248_10834415
375 Ga0105238_10438818
376 Ga0105238_11249225
377 Ga0105249_10302220
378 Ga0157373_10020811
379 Ga0157371_10104335
380 Ga0157369_11747142
381 Ga0157372_10142430
382 Ga0157372_12251219
383 Ga0157380_10094477
384 Ga0182008_10185716
385 Ga0157379_10991824
386 Ga0163161_10441467
387 Ga0213876_10016190
388 Ga0213876_10028818
389 Ga0207425_1000336
390 Ga0209129_1000148
391 Ga0209129_1015983
392 Ga0209673_1039493
393 Ga0209025_1000029
394 Ga0209564_1000251
395 Ga0209758_1000387
396 Ga0209256_1021541
397 Ga0209051_1000128
398 Ga0209051_1003383
399 Ga0209257_1082096
400 Ga0207713_1094918
401 Ga0207647_10009232
402 Ga0207699_11476941
403 Ga0207705_10289068
404 Ga0207684_10640507
405 Ga0207671_11321506
406 Ga0207662_10178757
407 Ga0207649_10280496
408 Ga0207694_11857819
409 Ga0207700_10021105
410 Ga0207664_10077612
411 Ga0207664_10116399
412 Ga0207690_10010168
413 Ga0207706_10301062
414 Ga0207686_10471773
415 Ga0207686_10542446
416 Ga0207670_10006330
417 Ga0207669_10097220
418 Ga0207704_10159188
419 Ga0207711_10806698
420 Ga0207689_10188550
421 Ga0207689_10457272
422 Ga0207679_10812618
423 Ga0207667_10280094
424 Ga0207667_10879850
425 Ga0207667_11411558
426 Ga0207667_11418922
427 Ga0207712_10369609
428 Ga0207668_10179660
429 Ga0207703_11665418
430 Ga0207708_10356338
431 Ga0207708_10469873
432 Ga0207702_10369800
433 Ga0207702_10800324
434 Ga0207641_10041031
435 Ga0207648_10206522
436 Ga0207674_10280130
437 Ga0207675_100012113
438 Ga0207675_100019637
439 Ga0207698_12188797
440 Ga0268266_10076273
441 Ga0268265_10178571
442 Ga0268265_11903264
443 Ga0268264_10087609
444 Ga0268264_10261201
445 Ga0268264_12503681
446 Ga0307515_10265669
447 Ga0265324_10047561
448 Ga0265320_10066915
449 Ga0307513_10646547
450 Ga0307408_100005843
451 Ga0307405_10045084
452 Ga0307413_10534350
453 Ga0307410_10234513
454 Ga0307406_10000605
455 Ga0307407_10309225
456 Ga0307412_10082659
457 Ga0307416_100412711
458 Ga0307416_100524250
459 Ga0307414_10115701
460 Ga0307411_10397583
461 Ga0307415_100464584
462 Ga0307415_101640150
463 Ga0373960_0335005
464 Ga0373955_0386628
465 Ga0373931_0255793
466 Ga0373937_0013849
467 Ga0395899_0000317
468 Ga0395899_0005227
469 Ga0395899_0204262
470 Ga0395900_0000238
471 Ga0395900_0086635
472 Ga0395900_0120088
473 Ga0395900_0121010
474 Ga0395900_0254371
475 Ga0395900_0255404
476 Ga0395900_0257600
477 Ga0395900_0383196
478 Ga0395898_0000245
479 Ga0395898_0026873
480 Ga0395898_0045050
481 Ga0395898_0082322
482 Ga0395898_0342737
483 Ga0395898_1035543
484 Ga0395905_0000006
485 Ga0395905_0013230
486 Ga0395905_0027909
487 Ga0395905_0036778
488 Ga0395905_0051103
489 Ga0395905_0061763
490 Ga0395905_0074624
491 Ga0395905_0150786
492 Ga0395905_0160385
493 Ga0395905_0288965
494 Ga0395905_0357757
495 Ga0395905_0536748
496 Ga0395905_0622307
497 Ga0395905_0652021
498 Ga0395901_0000156
499 Ga0395901_0010982
500 Ga0395901_0055486
501 Ga0395901_0055737
502 Ga0395901_0154617
503 Ga0395901_0540851
504 Ga0395901_0832536
505 Ga0395901_0860075
506 Ga0395901_0973206
507 Ga0237816_00279
508 Ga0436365_0516822
509 Ga0436365_1463747
510 Ga0436363_0341613
511 Ga0451795_0262953
512 Ga0451798_1107070
513 Ga0451800_0649006
514 Ga0451802_0371345
515 Ga0451807_0301182
516 Ga0451807_0925252
517 Ga0451835_0273820
518 Ga0451853_3746577
519 Ga0439448_0032303
520 Ga0439455_0039157
521 Ga0450890_016699
522 Ga0466960_0260095
523 Ga0495638_0001680
524 Ga0495650_0003710
525 Ga0495639_0002346
526 Ga0495583_0001383
527 Ga0495632_0432827
528 Ga0495643_0001163
529 Ga0495643_0204933
530 Ga0495648_0001296
531 Ga0495648_0001297
532 Ga0495642_0005963
533 Ga0495609_0009842
534 Ga0495597_0001115
535 Ga0495645_0509782
536 Ga0495622_0000936
537 Ga0495633_0000917
538 Ga0495668_0365845
539 Ga0495625_0001765
540 Ga0495625_0013181
541 Ga0495649_0352003
542 Ga0495672_0004889
543 Ga0495686_0197424
544 Ga0495615_0023188
545 Ga0496101_0931247
546 Ga0496106_1503629
547 Ga0496109_0430134
548 Ga0496112_0004521
549 Ga0496113_0021916
550 Ga0495678_005600
551 Ga0501032_0567951
552 Ga0501033_0106676
553 Ga0501034_0029260
554 Ga0501034_0049594
555 Ga0501034_0324229
556 Ga0501034_0369252
557 Ga0501036_0221702
558 Ga0501037_0125929
559 Ga0501038_0193681
560 Ga0501043_0381615
561 Ga0501046_0014525
562 Ga0501047_0000317
563 Ga0501047_0050596
564 Ga0501067_0175091
565 Ga0501068_0038844
566 Ga0501069_0211215
567 Ga0501070_0000512
568 Ga0501070_0198926
569 Ga0501073_0008340
570 Ga0501073_0732213
571 Ga0501074_0191927
572 Ga0501080_0114468
573 Ga0501081_0095812
574 Ga0501083_0001417
575 Ga0501083_0001982
576 Ga0501083_0806380
577 Ga0501035_0126088
578 Ga0501035_0129049
579 Ga0501044_0510547
580 Ga0501044_0722079
581 nmdc:mga03683_2976_c1
582 nmdc:mga00v17_199127_c1
583 nmdc:mga07m45_838329_c1
584 nmdc:mga07m45_922_c1
585 nmdc:mga0qj67_593517_c1
586 nmdc:mga0n895_1013982_c1
587 Ga0500583_0005221
588 Ga0500564_282063
589 Ga0500568_0192970
590 Ga0500616_0000018
591 Ga0501084_0493145
592 Ga0501084_0575952
593 Ga0501082_0000658
594 Ga0501082_0003138
595 Ga0501082_0394709
596 Ga0501082_1175045
597 Ga0530510_1536110
598 2538834291
599 2643828657
600 2643896264
601 2644478481
602 2904542801
603 2929168051
604 2929522150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

130

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8017 1 134
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.7964 1 134
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.7871 3 136
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.7856 3 132
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.7821 3 136
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8082 2 57 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7616 5 135 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.745 5 58 3.30.720.110
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7398 5 135 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.727 81 133 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2U0Y9V4-F1-model_v4 deleted 0.9552 3 71
AF-A0A5R2N0I3-F1-model_v4 VOC family protein 0.9382 4 58
AF-A0A6G3VRM6-F1-model_v4 deleted 0.9249 3 80
AF-A0A4R4P948-F1-model_v4 VOC domain-containing protein 0.9173 6 61
AF-A0A7W5C8W4-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.8956 3 58 GO:0016829
GO:0051213

Map