F396225

General Info

Members Datasets Scaffolds Average Seq Length
301 213 602 350

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2841911363|2841915462
Length 381
Sequence PALQDEAALPPEPAPPQEAAPVLPQQPLQKEPSFAARLQDEPWRFDFYATLRRIERSFPESARIGDAATRRDEYLALGEPAYMEFPASTIAQADHDAQGRMRLLVKFLGLLGPQGALPLATTEETFHWQLERDDSFPRFLDILNHRFLQLFYRAWADSRPIAQHDRPDLDRFAAYIGSMIGLGSKPYHGLDAVPDPEKLAHAGLIGAQAKSASRLRSFLSGLFEAEVDIEQFIGMRLVFDPADRTRLGQGHCTLGGDALVGASVYSVEDKFRVRIVARDMEQFCRFLPNGDLCEPLADAVFYYLGEQFEWDVELALPVGEVKPVTLGGFGNLGWTSWMAPNWGESEGALRRDARFHPADRMRQKRAAQAAGETTQTSQRRG

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
104 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
105 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
106 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
107 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
185 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
186 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
187 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
192 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
193 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
194 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
195 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
196 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
197 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
201 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
202 2643221734 Bosea sp. Root670 Isolate Unclassified
203 2643221736 Bosea sp. Root483D1 Isolate Unclassified
204 2818991467 Bosea vestrisii 3192 Isolate Unclassified
205 2841760612 Bosea sp. Tri-49 Isolate Nodule
206 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
207 2844104063 Bosea sp. Tri-39 Isolate Nodule
208 2851182111 Bosea sp. Tri-44 Isolate Nodule
209 2851246043 Bosea sp. Tri-54 Isolate Nodule
210 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
211 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
212 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
213 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 0
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.96
Nodule 2.99
Rhizoplane 9.3
Rhizosphere 65.78
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1007504 3300002987 Bacteria 3120
2 Ga0055526_1003047 3300003771 Bacteria 10886
3 Ga0065165_1000072 3300005262 Bacteria 165049
4 Ga0065715_10290305 3300005293 Unclassified 1064
5 Ga0070682_100063163 3300005337 Bacteria 2347
6 Ga0068868_100004817 3300005338 Bacteria 9472
7 Ga0070661_100052498 3300005344 Bacteria 2984
8 Ga0070671_100269187 3300005355 Bacteria 1448
9 Ga0070673_100331113 3300005364 Bacteria 1347
10 Ga0070709_10002870 3300005434 Bacteria 9304
11 Ga0070713_100123710 3300005436 Bacteria 2272
12 Ga0070710_10000961 3300005437 Bacteria 13669
13 Ga0070705_100182632 3300005440 Unclassified 1422
14 Ga0070681_10063411 3300005458 Bacteria 3668
15 Ga0068867_100114381 3300005459 Bacteria 2077
16 Ga0070698_100079412 3300005471 Bacteria 3278
17 Ga0070679_100123285 3300005530 Bacteria 2575
18 Ga0068857_100217539 3300005577 Bacteria 1744
19 Ga0068852_100009568 3300005616 Bacteria 7200
20 Ga0068859_100007356 3300005617 Bacteria 11171
21 Ga0068859_100207577 3300005617 Bacteria 2045
22 Ga0068864_100004017 3300005618 Bacteria 12090
23 Ga0068864_100030311 3300005618 Bacteria 4584
24 Ga0068851_10024223 3300005834 Bacteria 2971
25 Ga0068870_10053209 3300005840 Bacteria 2149
26 Ga0068860_100000071 3300005843 Bacteria 178413
27 Ga0081455_10170987 3300005937 Bacteria 1655
28 Ga0081540_1017936 3300005983 Bacteria 4361
29 Ga0070717_10026489 3300006028 Bacteria 4624
30 Ga0070716_100011380 3300006173 Bacteria 4477
31 Ga0070712_100004429 3300006175 Bacteria 8665
32 Ga0097621_100143565 3300006237 Bacteria 2042
33 Ga0068865_100011482 3300006881 Bacteria 5549
34 Ga0075436_100152231 3300006914 Bacteria 1628
35 Ga0097620_100007356 3300006931 Bacteria 11171
36 Ga0097620_100207569 3300006931 Bacteria 2045
37 Ga0099795_10025789 3300007788 Bacteria 1974
38 Ga0105245_10032748 3300009098 Bacteria 4602
39 Ga0105247_10025175 3300009101 Bacteria 3590
40 Ga0105237_10006130 3300009545 Bacteria 13439
41 Ga0105237_10203818 3300009545 Bacteria 1978
42 Ga0105249_10121252 3300009553 Bacteria 2485
43 Ga0099796_10022733 3300010159 Bacteria 1949
44 Ga0105239_10192172 3300010375 Unclassified 2285
45 Ga0105239_10260675 3300010375 Bacteria 1948
46 Ga0105246_10002862 3300011119 Bacteria 10441
47 Ga0105246_10021742 3300011119 Bacteria 4132
48 Ga0171462_1016 3300013250 Bacteria 164601
49 Ga0157374_10063086 3300013296 Bacteria 3475
50 Ga0157378_10084079 3300013297 Bacteria 2881
51 Ga0157378_10442525 3300013297 Bacteria 1289
52 Ga0163162_10077138 3300013306 Bacteria 3395
53 Ga0157375_10003961 3300013308 Bacteria 12843
54 Ga0163163_10000226 3300014325 Bacteria 58312
55 Ga0163163_10075815 3300014325 Bacteria 3357
56 Ga0157380_10064362 3300014326 Bacteria 2943
57 Ga0157379_10049031 3300014968 Bacteria 3770
58 Ga0157376_10009413 3300014969 Bacteria 7094
59 Ga0163161_10079235 3300017792 Bacteria 2415
60 Ga0213874_10010237 3300021377 Bacteria 2343
61 Ga0209130_1000125 3300025284 Bacteria 124425
62 Ga0209676_1012065 3300025292 Bacteria 3430
63 Ga0209025_1002055 3300025294 Bacteria 22908
64 Ga0209025_1024921 3300025294 Bacteria 3068
65 Ga0209564_1000054 3300025295 Bacteria 350653
66 Ga0209758_1002162 3300025297 Bacteria 20653
67 Ga0209256_1001102 3300025299 Bacteria 30971
68 Ga0207426_1004693 3300025302 Bacteria 6547
69 Ga0207697_10034501 3300025315 Bacteria 2071
70 Ga0207692_10022890 3300025898 Unclassified 2882
71 Ga0207699_10059322 3300025906 Bacteria 2292
72 Ga0207643_10070734 3300025908 Bacteria 2007
73 Ga0207671_10004856 3300025914 Bacteria 12651
74 Ga0207693_10006821 3300025915 Bacteria 9430
75 Ga0207663_10008247 3300025916 Bacteria 5438
76 Ga0207649_10049668 3300025920 Bacteria 2592
77 Ga0207687_10033161 3300025927 Bacteria 3501
78 Ga0207644_10234171 3300025931 Bacteria 1460
79 Ga0207704_10007215 3300025938 Bacteria 5234
80 Ga0207665_10059802 3300025939 Bacteria 2580
81 Ga0207691_10090858 3300025940 Bacteria 2736
82 Ga0207677_10057551 3300026023 Bacteria 2670
83 Ga0207678_10004106 3300026067 Bacteria 13093
84 Ga0207676_10002307 3300026095 Bacteria 13696
85 Ga0207676_10055645 3300026095 Bacteria 3107
86 Ga0207683_10012359 3300026121 Bacteria 7285
87 Ga0207698_10020677 3300026142 Bacteria 4536
88 Ga0209588_1002372 3300027671 Bacteria 5103
89 Ga0207428_10043851 3300027907 Bacteria 3610
90 Ga0268264_10000073 3300028381 Bacteria 260615
91 Ga0265334_10011107 3300028573 Bacteria 3795
92 Ga0265318_10014390 3300028577 Bacteria 3323
93 Ga0265332_10005515 3300031238 Bacteria 5831
94 Ga0265325_10012840 3300031241 Unclassified 4779
95 Ga0265316_10147130 3300031344 Bacteria 1766
96 Ga0307516_10014491 3300031730 Bacteria 8337
97 Ga0307414_10301882 3300032004 Bacteria 1355
98 Ga0307507_10054418 3300033179 Bacteria 3809
99 Ga0373923_0028073 3300035111 Bacteria 2249
100 Ga0373923_0107804 3300035111 Bacteria 1234
101 Ga0373936_0008475 3300035113 Bacteria 3872
102 Ga0373954_0008695 3300035118 Bacteria 4464
103 Ga0373954_0081318 3300035118 Bacteria 1548
104 Ga0373956_0060854 3300035119 Bacteria 1710
105 Ga0373955_0003989 3300035172 Bacteria 6516
106 Ga0373955_0052052 3300035172 Bacteria 2233
107 Ga0373931_0066774 3300035691 Bacteria 1953
108 Ga0373935_0125803 3300035692 Unclassified 1717
109 Ga0373933_0001898 3300035724 Bacteria 12058
110 Ga0373933_0013705 3300035724 Bacteria 4497
111 Ga0373933_0058978 3300035724 Bacteria 2310
112 Ga0373937_0000508 3300036401 Bacteria 35534
113 Ga0373937_0181466 3300036401 Bacteria 1976
114 Ga0373925_0057426 3300037068 Bacteria 2916
115 Ga0373925_0077745 3300037068 Bacteria 2519
116 Ga0436364_0404884 3300037853 Bacteria 2886
117 Ga0436365_1853625 3300039437 Bacteria 2962
118 Ga0436361_0574358 3300039447 Bacteria 2080
119 Ga0436363_1049393 3300039450 Bacteria 5679
120 Ga0439453_0000088 3300041408 Bacteria 7084
121 Ga0439432_025312 3300042006 Unclassified 1948
122 Ga0439452_025337 3300042010 Unclassified 1507
123 Ga0439446_0013155 3300042156 Unclassified 2269
124 Ga0439435_0000250 3300042436 Bacteria 7786
125 Ga0466963_0019092 3300044694 Bacteria 4293
126 Ga0466963_0196670 3300044694 Bacteria 1410
127 Ga0466958_0036588 3300045836 Bacteria 2939
128 Ga0466967_0055406 3300045976 Bacteria 3492
129 Ga0466967_0069980 3300045976 Unclassified 3138
130 Ga0466967_0078104 3300045976 Bacteria 2981
131 Ga0495592_0012531 3300046454 Bacteria 6443
132 Ga0495592_0019396 3300046454 Bacteria 5172
133 Ga0495603_0038326 3300046455 Bacteria 2874
134 Ga0495651_0000357 3300046462 Bacteria 35203
135 Ga0495651_0000463 3300046462 Bacteria 31159
136 Ga0495651_0070499 3300046462 Bacteria 2659
137 Ga0495653_0011748 3300046463 Bacteria 7151
138 Ga0495653_0039116 3300046463 Bacteria 3718
139 Ga0495580_0100744 3300046472 Bacteria 2009
140 Ga0495582_0013881 3300046473 Bacteria 4437
141 Ga0495605_0026513 3300046474 Bacteria 3012
142 Ga0495664_0056454 3300046477 Bacteria 2336
143 Ga0495594_0014871 3300046499 Bacteria 4084
144 Ga0495606_0089828 3300046507 Bacteria 1892
145 Ga0495608_0002896 3300046511 Bacteria 12294
146 Ga0495608_0006426 3300046511 Bacteria 8348
147 Ga0495608_0020607 3300046511 Bacteria 4531
148 Ga0495628_0008820 3300046516 Bacteria 8630
149 Ga0495652_0016430 3300046529 Bacteria 6621
150 Ga0495652_0030336 3300046529 Bacteria 4743
151 Ga0495652_0075029 3300046529 Bacteria 2810
152 Ga0495665_0060788 3300046531 Bacteria 1995
153 Ga0495640_0022009 3300046533 Bacteria 4668
154 Ga0495640_0033592 3300046533 Bacteria 3643
155 Ga0495587_0000726 3300046536 Bacteria 22036
156 Ga0495587_0007987 3300046536 Bacteria 6834
157 Ga0495587_0048928 3300046536 Bacteria 2503
158 Ga0495645_0038379 3300046543 Bacteria 3493
159 Ga0495622_0025502 3300046557 Bacteria 2761
160 Ga0495667_0000275 3300046559 Bacteria 33645
161 Ga0495667_0005670 3300046559 Bacteria 8449
162 Ga0495634_0016421 3300046642 Bacteria 5296
163 Ga0495634_0043433 3300046642 Bacteria 3046
164 Ga0495635_0000874 3300046663 Bacteria 19764
165 Ga0495635_0026999 3300046663 Bacteria 3994
166 Ga0495635_0049636 3300046663 Bacteria 2892
167 Ga0495657_0001958 3300046675 Bacteria 17541
168 Ga0495657_0002115 3300046675 Bacteria 16872
169 Ga0495657_0052559 3300046675 Bacteria 2730
170 Ga0495599_0004803 3300046678 Bacteria 8032
171 Ga0495599_0055929 3300046678 Bacteria 2469
172 Ga0495623_0000225 3300046679 Bacteria 36356
173 Ga0495623_0000713 3300046679 Bacteria 22193
174 Ga0495623_0003894 3300046679 Bacteria 9844
175 Ga0495646_0010562 3300046680 Bacteria 5866
176 Ga0495613_0143444 3300046689 Bacteria 1705
177 Ga0495600_0000244 3300046809 Bacteria 29739
178 Ga0495600_0008939 3300046809 Bacteria 6171
179 Ga0495600_0036235 3300046809 Bacteria 3206
180 Ga0495581_0000845 3300047315 Bacteria 16316
181 Ga0495604_0004285 3300047317 Bacteria 11296
182 Ga0495604_0183233 3300047317 Bacteria 1463
183 Ga0495674_0031749 3300047319 Bacteria 4795
184 Ga0495674_0055536 3300047319 Bacteria 3472
185 Ga0495680_0006834 3300047322 Bacteria 10541
186 Ga0495680_0095544 3300047322 Bacteria 2221
187 Ga0495675_0003764 3300047444 Bacteria 9174
188 Ga0495675_0014314 3300047444 Bacteria 5012
189 Ga0495675_0027928 3300047444 Bacteria 3596
190 Ga0495684_0009384 3300047471 Bacteria 7552
191 Ga0495684_0009457 3300047471 Bacteria 7522
192 Ga0495593_0020642 3300047673 Bacteria 3687
193 Ga0495593_0043973 3300047673 Bacteria 2391
194 Ga0495602_0005049 3300048088 Bacteria 13818
195 Ga0495602_0043849 3300048088 Bacteria 4061
196 Ga0496100_0005265 3300048903 Bacteria 6953
197 Ga0496101_0006955 3300048904 Bacteria 7311
198 Ga0496101_0029796 3300048904 Bacteria 3818
199 Ga0496102_0002038 3300048905 Bacteria 17450
200 Ga0496103_0041177 3300048906 Bacteria 2839
201 Ga0496104_0007760 3300048907 Bacteria 9507
202 Ga0496104_0007936 3300048907 Bacteria 9412
203 Ga0496105_0000053 3300048908 Bacteria 89666
204 Ga0496105_0000280 3300048908 Bacteria 33624
205 Ga0496105_0206195 3300048908 Bacteria 1603
206 Ga0496106_0013536 3300048909 Bacteria 6023
207 Ga0496106_0105912 3300048909 Bacteria 2185
208 Ga0496108_0015878 3300048911 Bacteria 6138
209 Ga0496108_0094704 3300048911 Bacteria 2542
210 Ga0496110_0004017 3300048913 Bacteria 11338
211 Ga0496110_0005882 3300048913 Bacteria 9653
212 Ga0496111_0020197 3300048914 Bacteria 4635
213 Ga0496112_0024254 3300048915 Bacteria 5805
214 Ga0496112_0110382 3300048915 Bacteria 2720
215 Ga0496113_0024030 3300048916 Bacteria 4327
216 Ga0496113_0032246 3300048916 Bacteria 3807
217 Ga0496113_0218520 3300048916 Bacteria 1518
218 Ga0496114_0020510 3300048917 Bacteria 5364
219 Ga0496114_0069670 3300048917 Bacteria 2953
220 Ga0496114_0320848 3300048917 Bacteria 1369
221 Ga0496114_0344138 3300048917 Bacteria 1318
222 Ga0496115_0002180 3300048918 Bacteria 14015
223 Ga0496115_0101730 3300048918 Bacteria 2356
224 Ga0496117_0065365 3300048920 Bacteria 2474
225 Ga0496117_0081358 3300048920 Bacteria 2126
226 Ga0496118_0000368 3300048921 Bacteria 75743
227 Ga0496119_0001323 3300048922 Bacteria 30449
228 Ga0496120_0032963 3300048923 Bacteria 3117
229 Ga0496121_0000144 3300048924 Bacteria 156856
230 Ga0496121_0086356 3300048924 Bacteria 2466
231 Ga0496121_0112683 3300048924 Bacteria 2072
232 Ga0496122_0026087 3300048925 Bacteria 5054
233 Ga0496123_0009062 3300048926 Bacteria 9013
234 Ga0496124_0001636 3300048927 Bacteria 32112
235 Ga0496125_0000060 3300048928 Bacteria 264143
236 Ga0496125_0000583 3300048928 Bacteria 62446
237 Ga0496125_0022863 3300048928 Bacteria 5792
238 Ga0496125_0040092 3300048928 Bacteria 4022
239 Ga0496125_0049675 3300048928 Bacteria 3482
240 Ga0496126_0005244 3300048929 Bacteria 14910
241 Ga0496126_0057499 3300048929 Bacteria 3510
242 Ga0501034_0126725 3300049571 Bacteria 2538
243 Ga0501034_0138331 3300049571 Bacteria 2415
244 Ga0501037_0017490 3300049573 Bacteria 5277
245 Ga0501071_0041570 3300049587 Bacteria 3292
246 Ga0501072_0037741 3300049588 Bacteria 3789
247 Ga0501075_0006109 3300049591 Bacteria 8273
248 Ga0501076_0022014 3300049592 Bacteria 4896
249 Ga0501079_0050776 3300049741 Bacteria 3201
250 nmdc:mga0n895_31166_c1 3300050512 Bacteria 5102
251 nmdc:mga0rr50_128626_c1 3300050513 Bacteria 2025
252 Ga0495601_0069371 3300053077 Bacteria 2249
253 Ga0495612_0044838 3300053078 Bacteria 1809
254 Ga0500635_0010685 3300053080 Bacteria 2587
255 Ga0495595_0015789 3300053084 Bacteria 3224
256 Ga0495595_0062555 3300053084 Bacteria 1745
257 Ga0495619_0004415 3300053085 Bacteria 8975
258 Ga0495619_0071994 3300053085 Bacteria 2314
259 Ga0500647_0004621 3300053091 Bacteria 5577
260 Ga0500647_0027368 3300053091 Bacteria 2695
261 Ga0500566_0000021 3300053094 Bacteria 82710
262 Ga0500566_0000046 3300053094 Bacteria 59187
263 Ga0500640_000416 3300053095 Bacteria 10285
264 Ga0500640_021358 3300053095 Bacteria 2792
265 Ga0500572_000063 3300053111 Bacteria 33008
266 Ga0500572_000089 3300053111 Bacteria 29455
267 Ga0500572_000173 3300053111 Bacteria 22812
268 Ga0500608_003184 3300053122 Bacteria 6102
269 Ga0500608_057839 3300053122 Bacteria 1857
270 Ga0500614_000704 3300053123 Bacteria 8564
271 Ga0500614_001173 3300053123 Bacteria 6434
272 Ga0500559_0001582 3300053136 Bacteria 12714
273 Ga0500559_0014602 3300053136 Bacteria 3319
274 Ga0500590_003105 3300053148 Bacteria 7578
275 Ga0500603_000144 3300053150 Bacteria 17179
276 Ga0500603_000289 3300053150 Bacteria 13311
277 Ga0500630_001818 3300053159 Bacteria 10248
278 Ga0500630_005586 3300053159 Bacteria 6151
279 Ga0500638_023129 3300053162 Bacteria 2951
280 Ga0500639_000004 3300053163 Bacteria 216921
281 Ga0500639_000009 3300053163 Bacteria 139043
282 Ga0500639_035623 3300053163 Bacteria 2626
283 Ga0500636_0025524 3300053177 Bacteria 3493
284 Ga0500596_000290 3300053735 Bacteria 8873
285 Ga0500596_003425 3300053735 Bacteria 3021
286 Ga0501084_0045811 3300054114 Bacteria 3661
287 Ga0501082_0022760 3300060353 Bacteria 5397
288 Ga0530510_0077824 3300061734 Bacteria 2410
289 2841915462 2841911363 Bacteria 6173697
290 2644735381 2643221734 Bacteria 5365412
291 2644747235 2643221736 Bacteria 6608466
292 2819720897 2818991467 Bacteria 5893227
293 2841762026 2841760612 Bacteria 6454112
294 2841920664 2841917233 Bacteria 6173500
295 2844105051 2844104063 Bacteria 6440972
296 2851183464 2851182111 Bacteria 6047226
297 2851248039 2851246043 Bacteria 6439203
298 2904697088 2904690495 Bacteria 9412302
299 2908762643 2908756301 Bacteria 8864324
300 2917699234 2917699015 Bacteria 7043791
301 8057529808 8057529695 Bacteria 6306553
302 JGI25159J45721_1007504
303 Ga0055526_1003047
304 Ga0065165_1000072
305 Ga0065715_10290305
306 Ga0070682_100063163
307 Ga0068868_100004817
308 Ga0070661_100052498
309 Ga0070671_100269187
310 Ga0070673_100331113
311 Ga0070709_10002870
312 Ga0070713_100123710
313 Ga0070710_10000961
314 Ga0070705_100182632
315 Ga0070681_10063411
316 Ga0068867_100114381
317 Ga0070698_100079412
318 Ga0070679_100123285
319 Ga0068857_100217539
320 Ga0068852_100009568
321 Ga0068859_100007356
322 Ga0068859_100207577
323 Ga0068864_100004017
324 Ga0068864_100030311
325 Ga0068851_10024223
326 Ga0068870_10053209
327 Ga0068860_100000071
328 Ga0081455_10170987
329 Ga0081540_1017936
330 Ga0070717_10026489
331 Ga0070716_100011380
332 Ga0070712_100004429
333 Ga0097621_100143565
334 Ga0068865_100011482
335 Ga0075436_100152231
336 Ga0097620_100007356
337 Ga0097620_100207569
338 Ga0099795_10025789
339 Ga0105245_10032748
340 Ga0105247_10025175
341 Ga0105237_10006130
342 Ga0105237_10203818
343 Ga0105249_10121252
344 Ga0099796_10022733
345 Ga0105239_10192172
346 Ga0105239_10260675
347 Ga0105246_10002862
348 Ga0105246_10021742
349 Ga0171462_1016
350 Ga0157374_10063086
351 Ga0157378_10084079
352 Ga0157378_10442525
353 Ga0163162_10077138
354 Ga0157375_10003961
355 Ga0163163_10000226
356 Ga0163163_10075815
357 Ga0157380_10064362
358 Ga0157379_10049031
359 Ga0157376_10009413
360 Ga0163161_10079235
361 Ga0213874_10010237
362 Ga0209130_1000125
363 Ga0209676_1012065
364 Ga0209025_1002055
365 Ga0209025_1024921
366 Ga0209564_1000054
367 Ga0209758_1002162
368 Ga0209256_1001102
369 Ga0207426_1004693
370 Ga0207697_10034501
371 Ga0207692_10022890
372 Ga0207699_10059322
373 Ga0207643_10070734
374 Ga0207671_10004856
375 Ga0207693_10006821
376 Ga0207663_10008247
377 Ga0207649_10049668
378 Ga0207687_10033161
379 Ga0207644_10234171
380 Ga0207704_10007215
381 Ga0207665_10059802
382 Ga0207691_10090858
383 Ga0207677_10057551
384 Ga0207678_10004106
385 Ga0207676_10002307
386 Ga0207676_10055645
387 Ga0207683_10012359
388 Ga0207698_10020677
389 Ga0209588_1002372
390 Ga0207428_10043851
391 Ga0268264_10000073
392 Ga0265334_10011107
393 Ga0265318_10014390
394 Ga0265332_10005515
395 Ga0265325_10012840
396 Ga0265316_10147130
397 Ga0307516_10014491
398 Ga0307414_10301882
399 Ga0307507_10054418
400 Ga0373923_0028073
401 Ga0373923_0107804
402 Ga0373936_0008475
403 Ga0373954_0008695
404 Ga0373954_0081318
405 Ga0373956_0060854
406 Ga0373955_0003989
407 Ga0373955_0052052
408 Ga0373931_0066774
409 Ga0373935_0125803
410 Ga0373933_0001898
411 Ga0373933_0013705
412 Ga0373933_0058978
413 Ga0373937_0000508
414 Ga0373937_0181466
415 Ga0373925_0057426
416 Ga0373925_0077745
417 Ga0436364_0404884
418 Ga0436365_1853625
419 Ga0436361_0574358
420 Ga0436363_1049393
421 Ga0439453_0000088
422 Ga0439432_025312
423 Ga0439452_025337
424 Ga0439446_0013155
425 Ga0439435_0000250
426 Ga0466963_0019092
427 Ga0466963_0196670
428 Ga0466958_0036588
429 Ga0466967_0055406
430 Ga0466967_0069980
431 Ga0466967_0078104
432 Ga0495592_0012531
433 Ga0495592_0019396
434 Ga0495603_0038326
435 Ga0495651_0000357
436 Ga0495651_0000463
437 Ga0495651_0070499
438 Ga0495653_0011748
439 Ga0495653_0039116
440 Ga0495580_0100744
441 Ga0495582_0013881
442 Ga0495605_0026513
443 Ga0495664_0056454
444 Ga0495594_0014871
445 Ga0495606_0089828
446 Ga0495608_0002896
447 Ga0495608_0006426
448 Ga0495608_0020607
449 Ga0495628_0008820
450 Ga0495652_0016430
451 Ga0495652_0030336
452 Ga0495652_0075029
453 Ga0495665_0060788
454 Ga0495640_0022009
455 Ga0495640_0033592
456 Ga0495587_0000726
457 Ga0495587_0007987
458 Ga0495587_0048928
459 Ga0495645_0038379
460 Ga0495622_0025502
461 Ga0495667_0000275
462 Ga0495667_0005670
463 Ga0495634_0016421
464 Ga0495634_0043433
465 Ga0495635_0000874
466 Ga0495635_0026999
467 Ga0495635_0049636
468 Ga0495657_0001958
469 Ga0495657_0002115
470 Ga0495657_0052559
471 Ga0495599_0004803
472 Ga0495599_0055929
473 Ga0495623_0000225
474 Ga0495623_0000713
475 Ga0495623_0003894
476 Ga0495646_0010562
477 Ga0495613_0143444
478 Ga0495600_0000244
479 Ga0495600_0008939
480 Ga0495600_0036235
481 Ga0495581_0000845
482 Ga0495604_0004285
483 Ga0495604_0183233
484 Ga0495674_0031749
485 Ga0495674_0055536
486 Ga0495680_0006834
487 Ga0495680_0095544
488 Ga0495675_0003764
489 Ga0495675_0014314
490 Ga0495675_0027928
491 Ga0495684_0009384
492 Ga0495684_0009457
493 Ga0495593_0020642
494 Ga0495593_0043973
495 Ga0495602_0005049
496 Ga0495602_0043849
497 Ga0496100_0005265
498 Ga0496101_0006955
499 Ga0496101_0029796
500 Ga0496102_0002038
501 Ga0496103_0041177
502 Ga0496104_0007760
503 Ga0496104_0007936
504 Ga0496105_0000053
505 Ga0496105_0000280
506 Ga0496105_0206195
507 Ga0496106_0013536
508 Ga0496106_0105912
509 Ga0496108_0015878
510 Ga0496108_0094704
511 Ga0496110_0004017
512 Ga0496110_0005882
513 Ga0496111_0020197
514 Ga0496112_0024254
515 Ga0496112_0110382
516 Ga0496113_0024030
517 Ga0496113_0032246
518 Ga0496113_0218520
519 Ga0496114_0020510
520 Ga0496114_0069670
521 Ga0496114_0320848
522 Ga0496114_0344138
523 Ga0496115_0002180
524 Ga0496115_0101730
525 Ga0496117_0065365
526 Ga0496117_0081358
527 Ga0496118_0000368
528 Ga0496119_0001323
529 Ga0496120_0032963
530 Ga0496121_0000144
531 Ga0496121_0086356
532 Ga0496121_0112683
533 Ga0496122_0026087
534 Ga0496123_0009062
535 Ga0496124_0001636
536 Ga0496125_0000060
537 Ga0496125_0000583
538 Ga0496125_0022863
539 Ga0496125_0040092
540 Ga0496125_0049675
541 Ga0496126_0005244
542 Ga0496126_0057499
543 Ga0501034_0126725
544 Ga0501034_0138331
545 Ga0501037_0017490
546 Ga0501071_0041570
547 Ga0501072_0037741
548 Ga0501075_0006109
549 Ga0501076_0022014
550 Ga0501079_0050776
551 nmdc:mga0n895_31166_c1
552 nmdc:mga0rr50_128626_c1
553 Ga0495601_0069371
554 Ga0495612_0044838
555 Ga0500635_0010685
556 Ga0495595_0015789
557 Ga0495595_0062555
558 Ga0495619_0004415
559 Ga0495619_0071994
560 Ga0500647_0004621
561 Ga0500647_0027368
562 Ga0500566_0000021
563 Ga0500566_0000046
564 Ga0500640_000416
565 Ga0500640_021358
566 Ga0500572_000063
567 Ga0500572_000089
568 Ga0500572_000173
569 Ga0500608_003184
570 Ga0500608_057839
571 Ga0500614_000704
572 Ga0500614_001173
573 Ga0500559_0001582
574 Ga0500559_0014602
575 Ga0500590_003105
576 Ga0500603_000144
577 Ga0500603_000289
578 Ga0500630_001818
579 Ga0500630_005586
580 Ga0500638_023129
581 Ga0500639_000004
582 Ga0500639_000009
583 Ga0500639_035623
584 Ga0500636_0025524
585 Ga0500596_000290
586 Ga0500596_003425
587 Ga0501084_0045811
588 Ga0501082_0022760
589 Ga0530510_0077824
590 2841915462
591 2644735381
592 2644747235
593 2819720897
594 2841762026
595 2841920664
596 2844105051
597 2851183464
598 2851248039
599 2904697088
600 2908762643
601 2917699234
602 8057529808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06996

T6SS_TssG

Type VI secretion, TssG

41

339

0.98

Map