F396198

General Info

Members Datasets Scaffolds Average Seq Length
301 204 602 401

Family's Representative Sequence

Representative Sequence 3300053077|Ga0495601_0068528|Ga0495601_0068528_22_1218
Length 398
Sequence VSLDRFRIGFVPLVDAALPILAHELGFAEEQGVAVDLVRDVTWAAVRDRLLYGHTDAAHMVAPLAIATALGRDRPAVPMAVPFVLGLNGNAITFSTALGEACGLGEGLGDPIAVGAALREVAARQRLRFGVVHRHSSHNYMLRYWLAGVGIRPDMDVDIVVTSPPFAADALAAGEVDGICVGEPWNSIAVDRGVGRIALATAQIWRRGVEKVLAMRSDQAEERRDAVLRLIRALHAAAAHFIDPETVEQSAEILSRTAYLDAPVGAILRAITDRIRVVPGGEPVHYPDFMFQYREAANFPWRSQAGWLYAQMVRWEGLSFSNADAATAQGVFRPDLYRAALAGSGAPLPGASSKLEGALVEPIGAGSTQGRLVLGSDPFFDGRAFDPDDIPGYLKELP

Samples

Sample ID Description Type Environment
1 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
168 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
177 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
178 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
179 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
180 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
181 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
184 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
185 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
188 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
189 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
190 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
191 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
192 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
193 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
194 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
195 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
196 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
197 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
198 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
199 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
200 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
201 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
202 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
203 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
204 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.35
Metatranscriptomes 0
Isolates 4.65

Biome Distribution

Category Percentage (%)
Aerial Root 1.66
Bulb 0
Endosphere 16.28
Nodule 0
Rhizoplane 4.32
Rhizosphere 68.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495601_0068528 3300053077 Bacteria 2262
2 JGI24741J21665_1000661 3300001915 Bacteria 10421
3 JGI24740J21852_10001652 3300001979 Bacteria 10234
4 JGI24739J22299_10014010 3300001989 Bacteria 2920
5 JGI25153J46596_10000075 3300003215 Bacteria 114168
6 Ga0055525_1000058 3300003759 Bacteria 210367
7 Ga0055542_1000842 3300003762 Bacteria 21677
8 Ga0055529_1000040 3300003763 Bacteria 230562
9 Ga0055530_10000093 3300003791 Bacteria 77624
10 Ga0055530_10000104 3300003791 Bacteria 72163
11 Ga0055531_10000854 3300003794 Bacteria 25073
12 Ga0070658_10000486 3300005327 Bacteria 34470
13 Ga0070658_10004780 3300005327 Bacteria 11020
14 Ga0070676_10041780 3300005328 Bacteria 2660
15 Ga0070666_10070893 3300005335 Bacteria 2371
16 Ga0070666_10100993 3300005335 Bacteria 1988
17 Ga0070660_100023830 3300005339 Bacteria 4537
18 Ga0070661_100010094 3300005344 Bacteria 6558
19 Ga0070668_100006192 3300005347 Bacteria 8860
20 Ga0070668_100007888 3300005347 Bacteria 7903
21 Ga0070669_100000659 3300005353 Bacteria 25480
22 Ga0070669_100001143 3300005353 Bacteria 19370
23 Ga0070675_100199005 3300005354 Bacteria 1738
24 Ga0070671_100000040 3300005355 Bacteria 92357
25 Ga0070671_100001027 3300005355 Bacteria 20510
26 Ga0070671_100007178 3300005355 Bacteria 8906
27 Ga0070674_100005747 3300005356 Bacteria 7197
28 Ga0070674_100009123 3300005356 Bacteria 5933
29 Ga0070667_100001272 3300005367 Bacteria 22834
30 Ga0070667_100011008 3300005367 Bacteria 7480
31 Ga0070663_100088802 3300005455 Bacteria 2286
32 Ga0070663_100186363 3300005455 Bacteria 1613
33 Ga0070678_100042153 3300005456 Bacteria 3242
34 Ga0070662_100051588 3300005457 Bacteria 2971
35 Ga0068853_100109657 3300005539 Bacteria 2450
36 Ga0070665_100000169 3300005548 Bacteria 118043
37 Ga0070665_100263263 3300005548 Bacteria 1725
38 Ga0068855_100005354 3300005563 Bacteria 15653
39 Ga0068855_100097859 3300005563 Bacteria 3380
40 Ga0070664_100003863 3300005564 Bacteria 12097
41 Ga0068854_100000459 3300005578 Bacteria 25127
42 Ga0068854_100001010 3300005578 Bacteria 16921
43 Ga0068854_100033461 3300005578 Bacteria 3584
44 Ga0068854_100096540 3300005578 Bacteria 2208
45 Ga0068854_100209636 3300005578 Bacteria 1536
46 Ga0068856_100011271 3300005614 Bacteria 8677
47 Ga0068852_100000231 3300005616 Bacteria 37728
48 Ga0068859_100030291 3300005617 Bacteria 5430
49 Ga0068859_100077259 3300005617 Bacteria 3371
50 Ga0068859_100088781 3300005617 Bacteria 3141
51 Ga0068851_10017063 3300005834 Bacteria 3483
52 Ga0068863_100000131 3300005841 Bacteria 79059
53 Ga0068863_100121763 3300005841 Bacteria 2488
54 Ga0068858_100035149 3300005842 Bacteria 4648
55 Ga0068858_100340856 3300005842 Bacteria 1435
56 Ga0068860_100002824 3300005843 Bacteria 18062
57 Ga0068860_100053350 3300005843 Bacteria 3844
58 Ga0068860_100156545 3300005843 Bacteria 2196
59 Ga0068860_100176421 3300005843 Bacteria 2065
60 Ga0068862_100004950 3300005844 Bacteria 11216
61 Ga0068862_100016090 3300005844 Bacteria 6220
62 Ga0075363_100002516 3300006048 Bacteria 7517
63 Ga0075364_10001358 3300006051 Bacteria 13201
64 Ga0075364_10054807 3300006051 Bacteria 2608
65 Ga0075362_10000042 3300006177 Bacteria 45768
66 Ga0075367_10088114 3300006178 Bacteria 1886
67 Ga0075366_10011165 3300006195 Bacteria 5064
68 Ga0075370_10000026 3300006353 Bacteria 51806
69 Ga0097620_100030291 3300006931 Bacteria 5430
70 Ga0097620_100077259 3300006931 Bacteria 3371
71 Ga0097620_100088781 3300006931 Bacteria 3141
72 Ga0105251_10013183 3300009011 Bacteria 4634
73 Ga0105240_10013931 3300009093 Bacteria 11008
74 Ga0105240_10317611 3300009093 Bacteria 1776
75 Ga0105247_10011698 3300009101 Bacteria 5281
76 Ga0105241_10000452 3300009174 Bacteria 30921
77 Ga0105242_10249420 3300009176 Bacteria 1599
78 Ga0105248_10009758 3300009177 Bacteria 10578
79 Ga0105248_10124408 3300009177 Bacteria 2909
80 Ga0105237_10228679 3300009545 Bacteria 1861
81 Ga0105237_10304411 3300009545 Bacteria 1597
82 Ga0105249_10157944 3300009553 Bacteria 2189
83 Ga0105239_10146287 3300010375 Bacteria 2636
84 Ga0157371_10000148 3300013102 Bacteria 101711
85 Ga0157370_10252404 3300013104 Bacteria 1631
86 Ga0157370_10284659 3300013104 Bacteria 1527
87 Ga0157369_10054717 3300013105 Bacteria 4309
88 Ga0163162_10198164 3300013306 Bacteria 2137
89 Ga0157376_10075905 3300014969 Bacteria 2870
90 Ga0163161_10002387 3300017792 Bacteria 13456
91 Ga0163161_10109339 3300017792 Bacteria 2065
92 Ga0209674_105442 3300025226 Bacteria 1880
93 Ga0209563_100024 3300025230 Bacteria 601155
94 Ga0209677_101534 3300025253 Bacteria 9867
95 Ga0209148_1000008 3300025254 Bacteria 1504371
96 Ga0209455_1000002 3300025272 Bacteria 1505459
97 Ga0209675_1000188 3300025291 Bacteria 68178
98 Ga0209676_1000070 3300025292 Bacteria 312074
99 Ga0209676_1000593 3300025292 Bacteria 54046
100 Ga0209025_1027965 3300025294 Bacteria 2778
101 Ga0209758_1000007 3300025297 Bacteria 1270410
102 Ga0209050_1000115 3300025298 Bacteria 204622
103 Ga0209257_1000160 3300025304 Bacteria 177175
104 Ga0207656_10022343 3300025321 Bacteria 2537
105 Ga0207713_1001058 3300025735 Bacteria 23840
106 Ga0207647_10005855 3300025904 Bacteria 8959
107 Ga0207647_10016969 3300025904 Bacteria 4957
108 Ga0207705_10000004 3300025909 Bacteria 705756
109 Ga0207705_10000127 3300025909 Bacteria 83788
110 Ga0207695_10023787 3300025913 Bacteria 6914
111 Ga0207695_10224743 3300025913 Bacteria 1784
112 Ga0207695_10224789 3300025913 Bacteria 1784
113 Ga0207671_10008129 3300025914 Bacteria 8952
114 Ga0207657_10035661 3300025919 Bacteria 4459
115 Ga0207649_10001574 3300025920 Bacteria 13298
116 Ga0207681_10000393 3300025923 Bacteria 30649
117 Ga0207681_10001400 3300025923 Bacteria 15582
118 Ga0207681_10094471 3300025923 Bacteria 2143
119 Ga0207694_10006451 3300025924 Bacteria 8938
120 Ga0207659_10156350 3300025926 Bacteria 1786
121 Ga0207644_10000005 3300025931 Bacteria 441948
122 Ga0207644_10000148 3300025931 Bacteria 50390
123 Ga0207644_10001680 3300025931 Bacteria 14272
124 Ga0207690_10000965 3300025932 Bacteria 18393
125 Ga0207690_10068983 3300025932 Bacteria 2431
126 Ga0207709_10000109 3300025935 Bacteria 128086
127 Ga0207669_10000059 3300025937 Bacteria 54857
128 Ga0207669_10000384 3300025937 Bacteria 19532
129 Ga0207711_10005031 3300025941 Bacteria 11212
130 Ga0207711_10356780 3300025941 Bacteria 1354
131 Ga0207679_10022618 3300025945 Bacteria 4283
132 Ga0207667_10000074 3300025949 Bacteria 171635
133 Ga0207667_10005425 3300025949 Bacteria 15550
134 Ga0207667_10372121 3300025949 Bacteria 1456
135 Ga0207712_10030818 3300025961 Bacteria 3608
136 Ga0207668_10003853 3300025972 Bacteria 8839
137 Ga0207668_10003931 3300025972 Bacteria 8761
138 Ga0207668_10083125 3300025972 Bacteria 2329
139 Ga0207640_10000508 3300025981 Bacteria 23527
140 Ga0207640_10000554 3300025981 Bacteria 22430
141 Ga0207640_10005413 3300025981 Bacteria 6961
142 Ga0207658_10000955 3300025986 Bacteria 23859
143 Ga0207658_10093116 3300025986 Bacteria 2342
144 Ga0207703_10069077 3300026035 Bacteria 2912
145 Ga0207703_10107982 3300026035 Bacteria 2370
146 Ga0207702_10004366 3300026078 Bacteria 12605
147 Ga0207641_10000004 3300026088 Bacteria 481088
148 Ga0207641_10005938 3300026088 Bacteria 10349
149 Ga0207648_10053104 3300026089 Bacteria 3543
150 Ga0207674_10227772 3300026116 Bacteria 1812
151 Ga0207683_10002089 3300026121 Bacteria 17609
152 Ga0207698_10000058 3300026142 Bacteria 78048
153 Ga0207698_10001783 3300026142 Bacteria 12574
154 Ga0207698_10094578 3300026142 Bacteria 2457
155 Ga0268266_10000480 3300028379 Bacteria 57568
156 Ga0268265_10046379 3300028380 Bacteria 3248
157 Ga0268264_10002511 3300028381 Bacteria 16129
158 Ga0268264_10007130 3300028381 Bacteria 9367
159 Ga0268264_10021902 3300028381 Bacteria 5216
160 Ga0268264_10285020 3300028381 Bacteria 1549
161 Ga0307517_10037580 3300028786 Bacteria 5401
162 Ga0307408_100107602 3300031548 Bacteria 2135
163 Ga0307408_100130029 3300031548 Bacteria 1963
164 Ga0307405_10000949 3300031731 Bacteria 11579
165 Ga0307405_10004639 3300031731 Bacteria 6524
166 Ga0307405_10081083 3300031731 Bacteria 2120
167 Ga0307413_10015035 3300031824 Bacteria 3954
168 Ga0307413_10165396 3300031824 Bacteria 1559
169 Ga0307410_10201457 3300031852 Bacteria 1520
170 Ga0307406_10001389 3300031901 Bacteria 13476
171 Ga0307412_10010786 3300031911 Bacteria 5273
172 Ga0307412_10015951 3300031911 Bacteria 4463
173 Ga0307412_10029158 3300031911 Bacteria 3461
174 Ga0307412_10037976 3300031911 Bacteria 3097
175 Ga0307409_100110052 3300031995 Bacteria 2308
176 Ga0307409_100451939 3300031995 Bacteria 1240
177 Ga0307416_100138572 3300032002 Bacteria 2206
178 Ga0307414_10001704 3300032004 Bacteria 11449
179 Ga0307414_10003444 3300032004 Bacteria 8446
180 Ga0307414_10034920 3300032004 Bacteria 3339
181 Ga0307414_10165624 3300032004 Bacteria 1761
182 Ga0373962_0022834 3300035242 Bacteria 1662
183 Ga0395899_0019969 3300037312 Bacteria 5083
184 Ga0395901_0297922 3300038443 Bacteria 1672
185 Ga0439462_0001193 3300042015 Bacteria 5682
186 Ga0495650_0000058 3300046471 Bacteria 302308
187 Ga0495584_0004747 3300046491 Bacteria 7275
188 Ga0495584_0067451 3300046491 Bacteria 1798
189 Ga0495585_0012409 3300046492 Bacteria 5020
190 Ga0495596_0040387 3300046500 Bacteria 1842
191 Ga0495583_0000673 3300046506 Bacteria 44600
192 Ga0495583_0003905 3300046506 Bacteria 11037
193 Ga0495583_0032183 3300046506 Bacteria 2533
194 Ga0495583_0036559 3300046506 Bacteria 2334
195 Ga0495606_0001811 3300046507 Bacteria 27176
196 Ga0495610_0001553 3300046512 Bacteria 20242
197 Ga0495620_0010179 3300046515 Bacteria 4967
198 Ga0495631_0015276 3300046518 Bacteria 3682
199 Ga0495632_0123161 3300046519 Bacteria 1210
200 Ga0495637_0013938 3300046520 Bacteria 3804
201 Ga0495643_0000557 3300046522 Bacteria 46202
202 Ga0495643_0004800 3300046522 Bacteria 9321
203 Ga0495643_0005754 3300046522 Bacteria 8294
204 Ga0495643_0023176 3300046522 Bacteria 3531
205 Ga0495648_0000498 3300046524 Bacteria 42255
206 Ga0495663_0000325 3300046525 Bacteria 17863
207 Ga0495609_0028181 3300046538 Bacteria 2564
208 Ga0495597_0008130 3300046542 Bacteria 5277
209 Ga0495622_0004213 3300046557 Bacteria 6706
210 Ga0495633_0001087 3300046558 Bacteria 21944
211 Ga0495668_0000098 3300046616 Bacteria 138553
212 Ga0495668_0018815 3300046616 Bacteria 3991
213 Ga0495625_0005013 3300046660 Bacteria 12283
214 Ga0495625_0008659 3300046660 Bacteria 8651
215 Ga0495625_0033817 3300046660 Bacteria 3776
216 Ga0495669_0000026 3300046684 Bacteria 111814
217 Ga0495670_0002829 3300046691 Bacteria 8587
218 Ga0495649_0015220 3300046694 Bacteria 4379
219 Ga0495649_0057746 3300046694 Bacteria 2092
220 Ga0495600_0000389 3300046809 Bacteria 22709
221 Ga0495660_0016883 3300046810 Bacteria 4206
222 Ga0495683_0004258 3300047323 Bacteria 8166
223 Ga0495683_0058507 3300047323 Bacteria 1914
224 Ga0495687_000123 3300047443 Bacteria 118577
225 Ga0495687_000285 3300047443 Bacteria 66562
226 Ga0495681_0001526 3300047470 Bacteria 17269
227 Ga0495681_0068301 3300047470 Bacteria 1618
228 Ga0496101_0092955 3300048904 Bacteria 2246
229 Ga0496101_0169963 3300048904 Bacteria 1675
230 Ga0496102_0000092 3300048905 Bacteria 125879
231 Ga0496103_0000101 3300048906 Bacteria 93679
232 Ga0496103_0007086 3300048906 Bacteria 6694
233 Ga0496104_0009124 3300048907 Bacteria 8819
234 Ga0496105_0001224 3300048908 Bacteria 17875
235 Ga0496106_0002615 3300048909 Bacteria 13399
236 Ga0496107_0025116 3300048910 Bacteria 4217
237 Ga0496111_0006559 3300048914 Bacteria 7567
238 Ga0496113_0002879 3300048916 Bacteria 10132
239 Ga0496114_0004414 3300048917 Bacteria 10917
240 Ga0496115_0000038 3300048918 Bacteria 125104
241 Ga0496116_0000627 3300048919 Bacteria 46393
242 Ga0496116_0009876 3300048919 Bacteria 8075
243 Ga0496117_0000173 3300048920 Bacteria 133415
244 Ga0496118_0000131 3300048921 Bacteria 133116
245 Ga0496119_0009367 3300048922 Bacteria 8420
246 Ga0496119_0026232 3300048922 Bacteria 4044
247 Ga0496120_0004518 3300048923 Bacteria 11632
248 Ga0496121_0000022 3300048924 Bacteria 472849
249 Ga0496121_0000209 3300048924 Bacteria 129740
250 Ga0496121_0003675 3300048924 Bacteria 21549
251 Ga0496121_0023519 3300048924 Bacteria 5930
252 Ga0496122_0001686 3300048925 Bacteria 34241
253 Ga0496122_0052224 3300048925 Bacteria 3097
254 Ga0496123_0003133 3300048926 Bacteria 18969
255 Ga0496123_0069644 3300048926 Bacteria 2207
256 Ga0496124_0000166 3300048927 Bacteria 133634
257 Ga0496125_0000390 3300048928 Bacteria 81748
258 Ga0496125_0009487 3300048928 Bacteria 9988
259 Ga0496125_0018739 3300048928 Bacteria 6561
260 Ga0496126_0000222 3300048929 Bacteria 123936
261 Ga0496126_0018631 3300048929 Bacteria 6871
262 Ga0501257_000098 3300049686 Bacteria 20774
263 Ga0501280_000355 3300049776 Bacteria 11410
264 Ga0501044_0000121 3300049823 Bacteria 93902
265 nmdc:mga03683_53_c1 3300050489 Bacteria 47904
266 nmdc:mga03n38_2795_c1 3300050490 Bacteria 5482
267 nmdc:mga00v17_5090_c1 3300050491 Bacteria 6906
268 nmdc:mga0k408_499_c1 3300050493 Bacteria 21537
269 nmdc:mga0k408_5_c2 3300050493 Bacteria 142245
270 nmdc:mga07m45_30_c1 3300050496 Bacteria 85279
271 nmdc:mga0sz30_78_c2 3300050516 Bacteria 28116
272 Ga0500610_0000169 3300053079 Bacteria 19508
273 Ga0500643_000139 3300053087 Bacteria 73348
274 Ga0500592_000096 3300053116 Bacteria 19420
275 Ga0500595_000230 3300053119 Bacteria 37914
276 Ga0500608_000224 3300053122 Bacteria 22253
277 Ga0500618_001521 3300053125 Bacteria 10201
278 Ga0500559_0065143 3300053136 Bacteria 1632
279 Ga0500573_0126988 3300053140 Bacteria 1415
280 Ga0500622_0001336 3300053156 Bacteria 19980
281 Ga0500627_0000119 3300053158 Bacteria 24541
282 Ga0500627_0004611 3300053158 Bacteria 4456
283 Ga0500636_0002265 3300053177 Bacteria 10680
284 Ga0500567_000658 3300053723 Bacteria 12534
285 Ga0500625_000037 3300053729 Bacteria 44475
286 Ga0500645_000045 3300053730 Bacteria 108141
287 Ga0500596_002065 3300053735 Bacteria 4000
288 2643951509 2643221588 Bacteria 3692460
289 2739650260 2739367664 Bacteria 4114334
290 2740028733 2739367865 Bacteria 4114482
291 2852682990 2852680915 Bacteria 4100189
292 2919140267 2919138771 Bacteria 5281312
293 2928028757 2928027323 Bacteria 4382488
294 2928104365 2928100450 Bacteria 4837635
295 2928962968 2928959182 Bacteria 4725774
296 2984555415 2984555340 Bacteria 4247089
297 2984566448 2984564862 Bacteria 4339992
298 2990266116 2990265787 Bacteria 3943888
299 2993357486 2993356040 Bacteria 4247105
300 2993696090 2993693658 Bacteria 4040749
301 8057105867 8057101203 Bacteria 5034064
302 Ga0495601_0068528
303 JGI24741J21665_1000661
304 JGI24740J21852_10001652
305 JGI24739J22299_10014010
306 JGI25153J46596_10000075
307 Ga0055525_1000058
308 Ga0055542_1000842
309 Ga0055529_1000040
310 Ga0055530_10000093
311 Ga0055530_10000104
312 Ga0055531_10000854
313 Ga0070658_10000486
314 Ga0070658_10004780
315 Ga0070676_10041780
316 Ga0070666_10070893
317 Ga0070666_10100993
318 Ga0070660_100023830
319 Ga0070661_100010094
320 Ga0070668_100006192
321 Ga0070668_100007888
322 Ga0070669_100000659
323 Ga0070669_100001143
324 Ga0070675_100199005
325 Ga0070671_100000040
326 Ga0070671_100001027
327 Ga0070671_100007178
328 Ga0070674_100005747
329 Ga0070674_100009123
330 Ga0070667_100001272
331 Ga0070667_100011008
332 Ga0070663_100088802
333 Ga0070663_100186363
334 Ga0070678_100042153
335 Ga0070662_100051588
336 Ga0068853_100109657
337 Ga0070665_100000169
338 Ga0070665_100263263
339 Ga0068855_100005354
340 Ga0068855_100097859
341 Ga0070664_100003863
342 Ga0068854_100000459
343 Ga0068854_100001010
344 Ga0068854_100033461
345 Ga0068854_100096540
346 Ga0068854_100209636
347 Ga0068856_100011271
348 Ga0068852_100000231
349 Ga0068859_100030291
350 Ga0068859_100077259
351 Ga0068859_100088781
352 Ga0068851_10017063
353 Ga0068863_100000131
354 Ga0068863_100121763
355 Ga0068858_100035149
356 Ga0068858_100340856
357 Ga0068860_100002824
358 Ga0068860_100053350
359 Ga0068860_100156545
360 Ga0068860_100176421
361 Ga0068862_100004950
362 Ga0068862_100016090
363 Ga0075363_100002516
364 Ga0075364_10001358
365 Ga0075364_10054807
366 Ga0075362_10000042
367 Ga0075367_10088114
368 Ga0075366_10011165
369 Ga0075370_10000026
370 Ga0097620_100030291
371 Ga0097620_100077259
372 Ga0097620_100088781
373 Ga0105251_10013183
374 Ga0105240_10013931
375 Ga0105240_10317611
376 Ga0105247_10011698
377 Ga0105241_10000452
378 Ga0105242_10249420
379 Ga0105248_10009758
380 Ga0105248_10124408
381 Ga0105237_10228679
382 Ga0105237_10304411
383 Ga0105249_10157944
384 Ga0105239_10146287
385 Ga0157371_10000148
386 Ga0157370_10252404
387 Ga0157370_10284659
388 Ga0157369_10054717
389 Ga0163162_10198164
390 Ga0157376_10075905
391 Ga0163161_10002387
392 Ga0163161_10109339
393 Ga0209674_105442
394 Ga0209563_100024
395 Ga0209677_101534
396 Ga0209148_1000008
397 Ga0209455_1000002
398 Ga0209675_1000188
399 Ga0209676_1000070
400 Ga0209676_1000593
401 Ga0209025_1027965
402 Ga0209758_1000007
403 Ga0209050_1000115
404 Ga0209257_1000160
405 Ga0207656_10022343
406 Ga0207713_1001058
407 Ga0207647_10005855
408 Ga0207647_10016969
409 Ga0207705_10000004
410 Ga0207705_10000127
411 Ga0207695_10023787
412 Ga0207695_10224743
413 Ga0207695_10224789
414 Ga0207671_10008129
415 Ga0207657_10035661
416 Ga0207649_10001574
417 Ga0207681_10000393
418 Ga0207681_10001400
419 Ga0207681_10094471
420 Ga0207694_10006451
421 Ga0207659_10156350
422 Ga0207644_10000005
423 Ga0207644_10000148
424 Ga0207644_10001680
425 Ga0207690_10000965
426 Ga0207690_10068983
427 Ga0207709_10000109
428 Ga0207669_10000059
429 Ga0207669_10000384
430 Ga0207711_10005031
431 Ga0207711_10356780
432 Ga0207679_10022618
433 Ga0207667_10000074
434 Ga0207667_10005425
435 Ga0207667_10372121
436 Ga0207712_10030818
437 Ga0207668_10003853
438 Ga0207668_10003931
439 Ga0207668_10083125
440 Ga0207640_10000508
441 Ga0207640_10000554
442 Ga0207640_10005413
443 Ga0207658_10000955
444 Ga0207658_10093116
445 Ga0207703_10069077
446 Ga0207703_10107982
447 Ga0207702_10004366
448 Ga0207641_10000004
449 Ga0207641_10005938
450 Ga0207648_10053104
451 Ga0207674_10227772
452 Ga0207683_10002089
453 Ga0207698_10000058
454 Ga0207698_10001783
455 Ga0207698_10094578
456 Ga0268266_10000480
457 Ga0268265_10046379
458 Ga0268264_10002511
459 Ga0268264_10007130
460 Ga0268264_10021902
461 Ga0268264_10285020
462 Ga0307517_10037580
463 Ga0307408_100107602
464 Ga0307408_100130029
465 Ga0307405_10000949
466 Ga0307405_10004639
467 Ga0307405_10081083
468 Ga0307413_10015035
469 Ga0307413_10165396
470 Ga0307410_10201457
471 Ga0307406_10001389
472 Ga0307412_10010786
473 Ga0307412_10015951
474 Ga0307412_10029158
475 Ga0307412_10037976
476 Ga0307409_100110052
477 Ga0307409_100451939
478 Ga0307416_100138572
479 Ga0307414_10001704
480 Ga0307414_10003444
481 Ga0307414_10034920
482 Ga0307414_10165624
483 Ga0373962_0022834
484 Ga0395899_0019969
485 Ga0395901_0297922
486 Ga0439462_0001193
487 Ga0495650_0000058
488 Ga0495584_0004747
489 Ga0495584_0067451
490 Ga0495585_0012409
491 Ga0495596_0040387
492 Ga0495583_0000673
493 Ga0495583_0003905
494 Ga0495583_0032183
495 Ga0495583_0036559
496 Ga0495606_0001811
497 Ga0495610_0001553
498 Ga0495620_0010179
499 Ga0495631_0015276
500 Ga0495632_0123161
501 Ga0495637_0013938
502 Ga0495643_0000557
503 Ga0495643_0004800
504 Ga0495643_0005754
505 Ga0495643_0023176
506 Ga0495648_0000498
507 Ga0495663_0000325
508 Ga0495609_0028181
509 Ga0495597_0008130
510 Ga0495622_0004213
511 Ga0495633_0001087
512 Ga0495668_0000098
513 Ga0495668_0018815
514 Ga0495625_0005013
515 Ga0495625_0008659
516 Ga0495625_0033817
517 Ga0495669_0000026
518 Ga0495670_0002829
519 Ga0495649_0015220
520 Ga0495649_0057746
521 Ga0495600_0000389
522 Ga0495660_0016883
523 Ga0495683_0004258
524 Ga0495683_0058507
525 Ga0495687_000123
526 Ga0495687_000285
527 Ga0495681_0001526
528 Ga0495681_0068301
529 Ga0496101_0092955
530 Ga0496101_0169963
531 Ga0496102_0000092
532 Ga0496103_0000101
533 Ga0496103_0007086
534 Ga0496104_0009124
535 Ga0496105_0001224
536 Ga0496106_0002615
537 Ga0496107_0025116
538 Ga0496111_0006559
539 Ga0496113_0002879
540 Ga0496114_0004414
541 Ga0496115_0000038
542 Ga0496116_0000627
543 Ga0496116_0009876
544 Ga0496117_0000173
545 Ga0496118_0000131
546 Ga0496119_0009367
547 Ga0496119_0026232
548 Ga0496120_0004518
549 Ga0496121_0000022
550 Ga0496121_0000209
551 Ga0496121_0003675
552 Ga0496121_0023519
553 Ga0496122_0001686
554 Ga0496122_0052224
555 Ga0496123_0003133
556 Ga0496123_0069644
557 Ga0496124_0000166
558 Ga0496125_0000390
559 Ga0496125_0009487
560 Ga0496125_0018739
561 Ga0496126_0000222
562 Ga0496126_0018631
563 Ga0501257_000098
564 Ga0501280_000355
565 Ga0501044_0000121
566 nmdc:mga03683_53_c1
567 nmdc:mga03n38_2795_c1
568 nmdc:mga00v17_5090_c1
569 nmdc:mga0k408_499_c1
570 nmdc:mga0k408_5_c2
571 nmdc:mga07m45_30_c1
572 nmdc:mga0sz30_78_c2
573 Ga0500610_0000169
574 Ga0500643_000139
575 Ga0500592_000096
576 Ga0500595_000230
577 Ga0500608_000224
578 Ga0500618_001521
579 Ga0500559_0065143
580 Ga0500573_0126988
581 Ga0500622_0001336
582 Ga0500627_0000119
583 Ga0500627_0004611
584 Ga0500636_0002265
585 Ga0500567_000658
586 Ga0500625_000037
587 Ga0500645_000045
588 Ga0500596_002065
589 2643951509
590 2739650260
591 2740028733
592 2852682990
593 2919140267
594 2928028757
595 2928104365
596 2928962968
597 2984555415
598 2984566448
599 2990266116
600 2993357486
601 2993696090
602 8057105867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

2

255

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.8911 3 403
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.8778 3 403
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8572 4 345
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.8547 5 403
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8431 4 345
ID Description Score Start End Superfamily
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8881 3 346 3.40.190.10
2g29A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8571 88 208 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8383 88 208 3.40.190.10
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7989 3 346 3.40.190.10
3up9A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7894 3 96 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A430E7E2-F1-model_v4 deleted 0.9851 1 367
AF-A0A430E7E2-F1-model_v4 deleted 0.9824 1 367
AF-A0A327JPI0-F1-model_v4 Nitrate transporter 0.9635 1 220 GO:0005886
GO:0012505
AF-A0A679JJF7-F1-model_v4 Nitrate transport protein NrtA 0.9616 5 348 GO:0005886
GO:0012505
AF-A0A4Q3MZI6-F1-model_v4 deleted 0.9578 4 274

Map