F396068

General Info

Members Datasets Scaffolds Average Seq Length
301 198 602 194

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0147334|Ga0466967_0147334_630_1157
Length 175
Sequence MSTRKLIVSEFLTLDGVMQAPGGEDEDRDNGFAHGGWTRPFWHDDIGKSFGALMQDTDAFLLGRRTYVIHAQAFEPLPPGDPFGDILNAPKKYVVSVRALKAQPGRNILADGSSQLVHTLLQHELVDELHLLVYPIILGSGKRLFPDGERAQFVLRSATPYPTGVVGLHYTRSSS

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
194 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.65
Nodule 0
Rhizoplane 1
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0147334 3300045976 Bacteria 2197
2 rootH2_10169442 3300003320 Bacteria 3689
3 rootH1_10083331 3300003323 Bacteria 11141
4 Ga0070676_10015736 3300005328 Bacteria 4173
5 Ga0070676_10574216 3300005328 Bacteria 810
6 Ga0070683_100048653 3300005329 Bacteria 3920
7 Ga0070683_100130845 3300005329 Bacteria 2375
8 Ga0070683_100583302 3300005329 Bacteria 1069
9 Ga0070670_100118369 3300005331 Bacteria 2284
10 Ga0070677_10330187 3300005333 Bacteria 784
11 Ga0068869_100070835 3300005334 Bacteria 2580
12 Ga0070680_100042876 3300005336 Bacteria 3673
13 Ga0070680_100070326 3300005336 Bacteria 2874
14 Ga0070680_100131880 3300005336 Bacteria 2091
15 Ga0070682_100012679 3300005337 Bacteria 4838
16 Ga0070682_100060622 3300005337 Bacteria 2393
17 Ga0070682_100328681 3300005337 Bacteria 1132
18 Ga0068868_100036226 3300005338 Bacteria 3817
19 Ga0068868_100362917 3300005338 Bacteria 1243
20 Ga0070660_100027070 3300005339 Bacteria 4277
21 Ga0070689_100404479 3300005340 Bacteria 1154
22 Ga0070661_100002039 3300005344 Bacteria 13947
23 Ga0070661_100059163 3300005344 Bacteria 2809
24 Ga0070692_10166052 3300005345 Bacteria 1269
25 Ga0070669_100608055 3300005353 Bacteria 916
26 Ga0070675_100039535 3300005354 Bacteria 3850
27 Ga0070675_100086405 3300005354 Unclassified 2621
28 Ga0070671_100117248 3300005355 Bacteria 2238
29 Ga0070671_100831333 3300005355 Bacteria 805
30 Ga0070674_100068576 3300005356 Bacteria 2499
31 Ga0070688_100031086 3300005365 Bacteria 3209
32 Ga0070688_100168236 3300005365 Bacteria 1511
33 Ga0070688_100448398 3300005365 Bacteria 964
34 Ga0070659_100010052 3300005366 Bacteria 6966
35 Ga0070659_100024946 3300005366 Bacteria 4588
36 Ga0070667_100069997 3300005367 Bacteria 2986
37 Ga0070713_100158582 3300005436 Bacteria 2018
38 Ga0070711_100124612 3300005439 Bacteria 1911
39 Ga0070700_100049132 3300005441 Bacteria 2617
40 Ga0070694_100054319 3300005444 Bacteria 2713
41 Ga0070694_100269407 3300005444 Bacteria 1294
42 Ga0070663_100057265 3300005455 Bacteria 2795
43 Ga0070662_100002176 3300005457 Bacteria 12017
44 Ga0070681_10015253 3300005458 Bacteria 7644
45 Ga0070681_10028768 3300005458 Bacteria 5586
46 Ga0070681_10035345 3300005458 Bacteria 5020
47 Ga0070681_10174017 3300005458 Bacteria 2074
48 Ga0070681_10217697 3300005458 Bacteria 1825
49 Ga0068867_100016500 3300005459 Bacteria 5243
50 Ga0068867_100135422 3300005459 Bacteria 1919
51 Ga0068867_100191172 3300005459 Bacteria 1633
52 Ga0070685_10040067 3300005466 Bacteria 2665
53 Ga0070707_100404151 3300005468 Bacteria 1326
54 Ga0070698_100263205 3300005471 Bacteria 1657
55 Ga0070679_100009280 3300005530 Bacteria 9299
56 Ga0070679_100023561 3300005530 Bacteria 6027
57 Ga0070679_100072929 3300005530 Bacteria 3425
58 Ga0070679_100201676 3300005530 Bacteria 1955
59 Ga0070684_100028802 3300005535 Bacteria 4700
60 Ga0070684_100042244 3300005535 Bacteria 3935
61 Ga0070684_100588507 3300005535 Bacteria 1034
62 Ga0070684_100779906 3300005535 Bacteria 893
63 Ga0068853_100046502 3300005539 Bacteria 3721
64 Ga0070672_100170909 3300005543 Bacteria 1808
65 Ga0070672_100247646 3300005543 Bacteria 1500
66 Ga0070686_100480445 3300005544 Bacteria 961
67 Ga0070704_100004355 3300005549 Bacteria 8176
68 Ga0068855_100082720 3300005563 Bacteria 3720
69 Ga0068855_100204527 3300005563 Bacteria 2222
70 Ga0070664_100027411 3300005564 Bacteria 4734
71 Ga0070664_100134224 3300005564 Bacteria 2175
72 Ga0070664_100155289 3300005564 Bacteria 2022
73 Ga0070664_100472181 3300005564 Bacteria 1153
74 Ga0070664_100729530 3300005564 Bacteria 924
75 Ga0068857_100007782 3300005577 Bacteria 9234
76 Ga0068854_100127205 3300005578 Bacteria 1942
77 Ga0068852_100123996 3300005616 Bacteria 2369
78 Ga0068864_100159979 3300005618 Bacteria 2046
79 Ga0068866_10135301 3300005718 Bacteria 1407
80 Ga0068861_100005128 3300005719 Bacteria 8833
81 Ga0068851_10050805 3300005834 Unclassified 2106
82 Ga0068870_10141024 3300005840 Bacteria 1410
83 Ga0068863_100463298 3300005841 Bacteria 1245
84 Ga0068863_100831942 3300005841 Bacteria 921
85 Ga0068858_100140090 3300005842 Bacteria 2270
86 Ga0068858_100283475 3300005842 Bacteria 1578
87 Ga0068858_100358911 3300005842 Bacteria 1397
88 Ga0068860_100102487 3300005843 Bacteria 2731
89 Ga0075368_10030568 3300006042 Bacteria 2086
90 Ga0075364_10257160 3300006051 Bacteria 1187
91 Ga0070716_100729907 3300006173 Unclassified 760
92 Ga0070712_100022200 3300006175 Bacteria 4177
93 Ga0075367_10015557 3300006178 Bacteria 4140
94 Ga0075428_100123048 3300006844 Bacteria 2824
95 Ga0075428_100691248 3300006844 Bacteria 1087
96 Ga0075430_100007235 3300006846 Bacteria 9372
97 Ga0075430_100013303 3300006846 Bacteria 7015
98 Ga0075430_100605811 3300006846 Bacteria 904
99 Ga0075430_100736213 3300006846 Bacteria 813
100 Ga0075431_100057448 3300006847 Unclassified 4013
101 Ga0075431_100117182 3300006847 Bacteria 2748
102 Ga0075431_100788688 3300006847 Bacteria 924
103 Ga0075433_10008362 3300006852 Bacteria 8253
104 Ga0075433_10014645 3300006852 Bacteria 6414
105 Ga0075434_100001624 3300006871 Bacteria 19118
106 Ga0075429_100017795 3300006880 Bacteria 6147
107 Ga0075429_100075183 3300006880 Unclassified 2942
108 Ga0075429_100558855 3300006880 Bacteria 1003
109 Ga0105240_10075194 3300009093 Bacteria 4167
110 Ga0105240_10457842 3300009093 Bacteria 1426
111 Ga0105240_10610040 3300009093 Bacteria 1200
112 Ga0111539_11815432 3300009094 Bacteria 707
113 Ga0105245_10286698 3300009098 Bacteria 1611
114 Ga0114129_10014461 3300009147 Bacteria 11246
115 Ga0114129_10035155 3300009147 Bacteria 7080
116 Ga0114129_10065836 3300009147 Bacteria 5056
117 Ga0114129_10204067 3300009147 Bacteria 2676
118 Ga0114129_10353236 3300009147 Bacteria 1947
119 Ga0105241_10642470 3300009174 Bacteria 963
120 Ga0105248_10377975 3300009177 Bacteria 1595
121 Ga0105248_10788056 3300009177 Bacteria 1073
122 Ga0105237_10490731 3300009545 Bacteria 1235
123 Ga0105249_10050305 3300009553 Bacteria 3800
124 Ga0105239_10161754 3300010375 Bacteria 2501
125 Ga0157373_10460748 3300013100 Bacteria 916
126 Ga0157371_10050195 3300013102 Bacteria 2964
127 Ga0157369_10077024 3300013105 Bacteria 3574
128 Ga0157374_10309283 3300013296 Bacteria 1564
129 Ga0157378_10542818 3300013297 Bacteria 1167
130 Ga0157378_11136584 3300013297 Bacteria 819
131 Ga0163162_10072535 3300013306 Bacteria 3498
132 Ga0157372_10024632 3300013307 Bacteria 6540
133 Ga0157372_10505524 3300013307 Bacteria 1409
134 Ga0157375_10802386 3300013308 Bacteria 1090
135 Ga0163163_10102017 3300014325 Bacteria 2892
136 Ga0157380_10089706 3300014326 Bacteria 2534
137 Ga0182008_10008999 3300014497 Bacteria 5410
138 Ga0157377_10061741 3300014745 Bacteria 2142
139 Ga0157379_10063478 3300014968 Bacteria 3302
140 Ga0157376_10517720 3300014969 Bacteria 1175
141 Ga0157376_10674875 3300014969 Bacteria 1036
142 Ga0163161_10114838 3300017792 Bacteria 2017
143 Ga0213876_10001957 3300021384 Bacteria 12340
144 Ga0207697_10007946 3300025315 Bacteria 4689
145 Ga0207656_10038681 3300025321 Unclassified 2014
146 Ga0207653_10070524 3300025885 Bacteria 1194
147 Ga0207682_10058686 3300025893 Bacteria 1606
148 Ga0207682_10307977 3300025893 Bacteria 743
149 Ga0207692_10348160 3300025898 Bacteria 913
150 Ga0207642_10076457 3300025899 Bacteria 1611
151 Ga0207647_10115612 3300025904 Bacteria 1584
152 Ga0207645_10018126 3300025907 Bacteria 4640
153 Ga0207684_10642111 3300025910 Bacteria 905
154 Ga0207707_10021917 3300025912 Bacteria 5584
155 Ga0207707_10027037 3300025912 Bacteria 5015
156 Ga0207707_10048091 3300025912 Bacteria 3715
157 Ga0207707_10119452 3300025912 Bacteria 2304
158 Ga0207707_10229783 3300025912 Bacteria 1614
159 Ga0207707_10655500 3300025912 Bacteria 884
160 Ga0207693_10141985 3300025915 Bacteria 1888
161 Ga0207660_10036674 3300025917 Unclassified 3410
162 Ga0207660_10196923 3300025917 Bacteria 1572
163 Ga0207660_10333273 3300025917 Bacteria 1213
164 Ga0207662_10006613 3300025918 Bacteria 6260
165 Ga0207657_10031603 3300025919 Bacteria 4793
166 Ga0207657_10070151 3300025919 Bacteria 2971
167 Ga0207649_10004920 3300025920 Bacteria 7223
168 Ga0207649_10111496 3300025920 Bacteria 1828
169 Ga0207649_10359697 3300025920 Bacteria 1080
170 Ga0207652_10021041 3300025921 Bacteria 5380
171 Ga0207652_10163320 3300025921 Bacteria 1997
172 Ga0207652_10188274 3300025921 Bacteria 1856
173 Ga0207652_10280942 3300025921 Bacteria 1502
174 Ga0207646_10206200 3300025922 Bacteria 1776
175 Ga0207681_10047972 3300025923 Bacteria 2880
176 Ga0207650_10029211 3300025925 Bacteria 3961
177 Ga0207659_10030737 3300025926 Bacteria 3672
178 Ga0207700_10158882 3300025928 Bacteria 1875
179 Ga0207644_10197289 3300025931 Bacteria 1586
180 Ga0207690_10020881 3300025932 Bacteria 4053
181 Ga0207690_10039056 3300025932 Unclassified 3095
182 Ga0207706_10001979 3300025933 Bacteria 20087
183 Ga0207670_10001814 3300025936 Bacteria 11144
184 Ga0207670_10124281 3300025936 Bacteria 1880
185 Ga0207704_10920218 3300025938 Bacteria 736
186 Ga0207691_10005862 3300025940 Bacteria 11877
187 Ga0207691_10034622 3300025940 Bacteria 4695
188 Ga0207691_10101849 3300025940 Bacteria 2562
189 Ga0207691_10110480 3300025940 Bacteria 2445
190 Ga0207689_10023999 3300025942 Bacteria 5115
191 Ga0207661_10021874 3300025944 Bacteria 4801
192 Ga0207661_10057949 3300025944 Bacteria 3116
193 Ga0207661_10106373 3300025944 Bacteria 2365
194 Ga0207661_10410954 3300025944 Bacteria 1228
195 Ga0207661_11181867 3300025944 Bacteria 704
196 Ga0207679_10018500 3300025945 Bacteria 4668
197 Ga0207679_10059988 3300025945 Bacteria 2824
198 Ga0207679_10338543 3300025945 Bacteria 1308
199 Ga0207651_10258240 3300025960 Bacteria 1429
200 Ga0207651_10587399 3300025960 Bacteria 972
201 Ga0207712_10029112 3300025961 Bacteria 3702
202 Ga0207668_10023563 3300025972 Bacteria 3959
203 Ga0207640_10164050 3300025981 Bacteria 1648
204 Ga0207640_10164742 3300025981 Bacteria 1645
205 Ga0207658_10405779 3300025986 Bacteria 1199
206 Ga0207677_10063689 3300026023 Bacteria 2564
207 Ga0207677_10493928 3300026023 Bacteria 1057
208 Ga0207677_10967521 3300026023 Unclassified 770
209 Ga0207703_10089762 3300026035 Bacteria 2581
210 Ga0207703_10445592 3300026035 Bacteria 1209
211 Ga0207639_10331566 3300026041 Bacteria 1354
212 Ga0207678_10021250 3300026067 Bacteria 5690
213 Ga0207678_10568565 3300026067 Bacteria 992
214 Ga0207708_10304924 3300026075 Bacteria 1296
215 Ga0207648_10005555 3300026089 Bacteria 12692
216 Ga0207648_10046217 3300026089 Bacteria 3817
217 Ga0207676_10095716 3300026095 Bacteria 2449
218 Ga0207674_10000394 3300026116 Bacteria 56421
219 Ga0207674_10090236 3300026116 Bacteria 3056
220 Ga0207675_100030078 3300026118 Bacteria 5057
221 Ga0207698_10129256 3300026142 Bacteria 2155
222 Ga0207698_10902620 3300026142 Unclassified 891
223 Ga0209813_10020442 3300027866 Bacteria 1852
224 Ga0268266_10880339 3300028379 Bacteria 866
225 Ga0268265_10094451 3300028380 Bacteria 2398
226 Ga0268264_10136266 3300028381 Bacteria 2183
227 Ga0307408_100006220 3300031548 Bacteria 7929
228 Ga0307413_10272211 3300031824 Bacteria 1268
229 Ga0307410_10428153 3300031852 Bacteria 1075
230 Ga0307406_10032204 3300031901 Bacteria 3199
231 Ga0307412_10609096 3300031911 Bacteria 926
232 Ga0307412_10642916 3300031911 Unclassified 904
233 Ga0307409_100438203 3300031995 Bacteria 1258
234 Ga0307416_101256759 3300032002 Bacteria 846
235 Ga0307414_10141165 3300032004 Unclassified 1886
236 Ga0307415_100591108 3300032126 Bacteria 986
237 Ga0373934_0011116 3300035086 Bacteria 3388
238 Ga0373923_0356983 3300035111 Bacteria 699
239 Ga0373956_0019828 3300035119 Bacteria 2855
240 Ga0373943_0095526 3300035170 Bacteria 1546
241 Ga0373946_0147959 3300035171 Bacteria 1094
242 Ga0373955_0054862 3300035172 Bacteria 2181
243 Ga0373933_0008199 3300035724 Bacteria 5703
244 Ga0373937_0020940 3300036401 Bacteria 5865
245 Ga0395905_0547633 3300037471 Bacteria 1058
246 Ga0395901_1082725 3300038443 Bacteria 773
247 Ga0436365_0864611 3300039437 Bacteria 25080
248 Ga0439433_0083968 3300041999 Bacteria 777
249 Ga0439445_0040108 3300042004 Bacteria 1242
250 Ga0439440_0234328 3300042993 Bacteria 554
251 Ga0451576_0020908 3300045051 Bacteria 7123
252 Ga0495582_0216612 3300046473 Bacteria 1095
253 Ga0495594_0386980 3300046499 Bacteria 796
254 Ga0495628_0071251 3300046516 Bacteria 2710
255 Ga0495630_0533675 3300046517 Bacteria 900
256 Ga0495652_0121584 3300046529 Bacteria 2081
257 Ga0495587_0003496 3300046536 Bacteria 10459
258 Ga0495645_0001285 3300046543 Bacteria 17109
259 Ga0495667_0079118 3300046559 Bacteria 2137
260 Ga0495588_0300713 3300046674 Unclassified 845
261 Ga0495599_0076399 3300046678 Bacteria 2091
262 Ga0495623_0008029 3300046679 Bacteria 6860
263 Ga0495600_0003383 3300046809 Bacteria 9386
264 Ga0495604_0188012 3300047317 Bacteria 1441
265 Ga0495672_0003539 3300047320 Bacteria 13300
266 Ga0495675_0017058 3300047444 Bacteria 4597
267 Ga0495684_0023028 3300047471 Bacteria 4790
268 Ga0496113_1094279 3300048916 Bacteria 625
269 Ga0496114_0003602 3300048917 Bacteria 11902
270 Ga0496114_0419771 3300048917 Bacteria 1185
271 Ga0501073_0579991 3300049589 Bacteria 775
272 Ga0501234_038331 3300049707 Bacteria 782
273 nmdc:mga00v17_225650_c1 3300050491 Bacteria 1213
274 nmdc:mga0k408_662646_c1 3300050493 Bacteria 613
275 nmdc:mga04h51_17051_c1 3300050495 Unclassified 2117
276 nmdc:mga05p37_110531_c1 3300050507 Bacteria 3381
277 nmdc:mga05p37_186615_c1 3300050507 Bacteria 2520
278 nmdc:mga05p37_230991_c1 3300050507 Bacteria 2229
279 nmdc:mga05p37_7304_c1 3300050507 Bacteria 13033
280 nmdc:mga09592_18805_c1 3300050508 Bacteria 5668
281 nmdc:mga0qj67_1504_c1 3300050509 Bacteria 16351
282 nmdc:mga0qj67_578455_c1 3300050509 Bacteria 899
283 nmdc:mga0qj67_84024_c1 3300050509 Unclassified 2552
284 nmdc:mga06r32_119762_c1 3300050510 Bacteria 2595
285 nmdc:mga06r32_16900_c1 3300050510 Bacteria 6655
286 nmdc:mga06r32_179911_c1 3300050510 Unclassified 2100
287 nmdc:mga06r32_63278_c1 3300050510 Bacteria 3565
288 nmdc:mga0n895_131878_c1 3300050512 Bacteria 2524
289 nmdc:mga0n895_19020_c1 3300050512 Bacteria 6373
290 nmdc:mga0rr50_382579_c1 3300050513 Bacteria 1187
291 nmdc:mga0rr50_741498_c1 3300050513 Bacteria 838
292 nmdc:mga0a205_14232_c1 3300050515 Bacteria 7419
293 nmdc:mga0a205_4533_c1 3300050515 Bacteria 12468
294 Ga0500641_0053087 3300053096 Bacteria 1672
295 Ga0500555_000269 3300053103 Bacteria 22364
296 Ga0500589_092599 3300053147 Unclassified 1328
297 Ga0500645_000076 3300053730 Bacteria 78006
298 Ga0590071_011175 3300059421 Bacteria 2101
299 Ga0590074_001985 3300059423 Bacteria 3345
300 Ga0590075_011587 3300059424 Bacteria 2133
301 Ga0590075_032897 3300059424 Bacteria 1316
302 Ga0466967_0147334
303 rootH2_10169442
304 rootH1_10083331
305 Ga0070676_10015736
306 Ga0070676_10574216
307 Ga0070683_100048653
308 Ga0070683_100130845
309 Ga0070683_100583302
310 Ga0070670_100118369
311 Ga0070677_10330187
312 Ga0068869_100070835
313 Ga0070680_100042876
314 Ga0070680_100070326
315 Ga0070680_100131880
316 Ga0070682_100012679
317 Ga0070682_100060622
318 Ga0070682_100328681
319 Ga0068868_100036226
320 Ga0068868_100362917
321 Ga0070660_100027070
322 Ga0070689_100404479
323 Ga0070661_100002039
324 Ga0070661_100059163
325 Ga0070692_10166052
326 Ga0070669_100608055
327 Ga0070675_100039535
328 Ga0070675_100086405
329 Ga0070671_100117248
330 Ga0070671_100831333
331 Ga0070674_100068576
332 Ga0070688_100031086
333 Ga0070688_100168236
334 Ga0070688_100448398
335 Ga0070659_100010052
336 Ga0070659_100024946
337 Ga0070667_100069997
338 Ga0070713_100158582
339 Ga0070711_100124612
340 Ga0070700_100049132
341 Ga0070694_100054319
342 Ga0070694_100269407
343 Ga0070663_100057265
344 Ga0070662_100002176
345 Ga0070681_10015253
346 Ga0070681_10028768
347 Ga0070681_10035345
348 Ga0070681_10174017
349 Ga0070681_10217697
350 Ga0068867_100016500
351 Ga0068867_100135422
352 Ga0068867_100191172
353 Ga0070685_10040067
354 Ga0070707_100404151
355 Ga0070698_100263205
356 Ga0070679_100009280
357 Ga0070679_100023561
358 Ga0070679_100072929
359 Ga0070679_100201676
360 Ga0070684_100028802
361 Ga0070684_100042244
362 Ga0070684_100588507
363 Ga0070684_100779906
364 Ga0068853_100046502
365 Ga0070672_100170909
366 Ga0070672_100247646
367 Ga0070686_100480445
368 Ga0070704_100004355
369 Ga0068855_100082720
370 Ga0068855_100204527
371 Ga0070664_100027411
372 Ga0070664_100134224
373 Ga0070664_100155289
374 Ga0070664_100472181
375 Ga0070664_100729530
376 Ga0068857_100007782
377 Ga0068854_100127205
378 Ga0068852_100123996
379 Ga0068864_100159979
380 Ga0068866_10135301
381 Ga0068861_100005128
382 Ga0068851_10050805
383 Ga0068870_10141024
384 Ga0068863_100463298
385 Ga0068863_100831942
386 Ga0068858_100140090
387 Ga0068858_100283475
388 Ga0068858_100358911
389 Ga0068860_100102487
390 Ga0075368_10030568
391 Ga0075364_10257160
392 Ga0070716_100729907
393 Ga0070712_100022200
394 Ga0075367_10015557
395 Ga0075428_100123048
396 Ga0075428_100691248
397 Ga0075430_100007235
398 Ga0075430_100013303
399 Ga0075430_100605811
400 Ga0075430_100736213
401 Ga0075431_100057448
402 Ga0075431_100117182
403 Ga0075431_100788688
404 Ga0075433_10008362
405 Ga0075433_10014645
406 Ga0075434_100001624
407 Ga0075429_100017795
408 Ga0075429_100075183
409 Ga0075429_100558855
410 Ga0105240_10075194
411 Ga0105240_10457842
412 Ga0105240_10610040
413 Ga0111539_11815432
414 Ga0105245_10286698
415 Ga0114129_10014461
416 Ga0114129_10035155
417 Ga0114129_10065836
418 Ga0114129_10204067
419 Ga0114129_10353236
420 Ga0105241_10642470
421 Ga0105248_10377975
422 Ga0105248_10788056
423 Ga0105237_10490731
424 Ga0105249_10050305
425 Ga0105239_10161754
426 Ga0157373_10460748
427 Ga0157371_10050195
428 Ga0157369_10077024
429 Ga0157374_10309283
430 Ga0157378_10542818
431 Ga0157378_11136584
432 Ga0163162_10072535
433 Ga0157372_10024632
434 Ga0157372_10505524
435 Ga0157375_10802386
436 Ga0163163_10102017
437 Ga0157380_10089706
438 Ga0182008_10008999
439 Ga0157377_10061741
440 Ga0157379_10063478
441 Ga0157376_10517720
442 Ga0157376_10674875
443 Ga0163161_10114838
444 Ga0213876_10001957
445 Ga0207697_10007946
446 Ga0207656_10038681
447 Ga0207653_10070524
448 Ga0207682_10058686
449 Ga0207682_10307977
450 Ga0207692_10348160
451 Ga0207642_10076457
452 Ga0207647_10115612
453 Ga0207645_10018126
454 Ga0207684_10642111
455 Ga0207707_10021917
456 Ga0207707_10027037
457 Ga0207707_10048091
458 Ga0207707_10119452
459 Ga0207707_10229783
460 Ga0207707_10655500
461 Ga0207693_10141985
462 Ga0207660_10036674
463 Ga0207660_10196923
464 Ga0207660_10333273
465 Ga0207662_10006613
466 Ga0207657_10031603
467 Ga0207657_10070151
468 Ga0207649_10004920
469 Ga0207649_10111496
470 Ga0207649_10359697
471 Ga0207652_10021041
472 Ga0207652_10163320
473 Ga0207652_10188274
474 Ga0207652_10280942
475 Ga0207646_10206200
476 Ga0207681_10047972
477 Ga0207650_10029211
478 Ga0207659_10030737
479 Ga0207700_10158882
480 Ga0207644_10197289
481 Ga0207690_10020881
482 Ga0207690_10039056
483 Ga0207706_10001979
484 Ga0207670_10001814
485 Ga0207670_10124281
486 Ga0207704_10920218
487 Ga0207691_10005862
488 Ga0207691_10034622
489 Ga0207691_10101849
490 Ga0207691_10110480
491 Ga0207689_10023999
492 Ga0207661_10021874
493 Ga0207661_10057949
494 Ga0207661_10106373
495 Ga0207661_10410954
496 Ga0207661_11181867
497 Ga0207679_10018500
498 Ga0207679_10059988
499 Ga0207679_10338543
500 Ga0207651_10258240
501 Ga0207651_10587399
502 Ga0207712_10029112
503 Ga0207668_10023563
504 Ga0207640_10164050
505 Ga0207640_10164742
506 Ga0207658_10405779
507 Ga0207677_10063689
508 Ga0207677_10493928
509 Ga0207677_10967521
510 Ga0207703_10089762
511 Ga0207703_10445592
512 Ga0207639_10331566
513 Ga0207678_10021250
514 Ga0207678_10568565
515 Ga0207708_10304924
516 Ga0207648_10005555
517 Ga0207648_10046217
518 Ga0207676_10095716
519 Ga0207674_10000394
520 Ga0207674_10090236
521 Ga0207675_100030078
522 Ga0207698_10129256
523 Ga0207698_10902620
524 Ga0209813_10020442
525 Ga0268266_10880339
526 Ga0268265_10094451
527 Ga0268264_10136266
528 Ga0307408_100006220
529 Ga0307413_10272211
530 Ga0307410_10428153
531 Ga0307406_10032204
532 Ga0307412_10609096
533 Ga0307412_10642916
534 Ga0307409_100438203
535 Ga0307416_101256759
536 Ga0307414_10141165
537 Ga0307415_100591108
538 Ga0373934_0011116
539 Ga0373923_0356983
540 Ga0373956_0019828
541 Ga0373943_0095526
542 Ga0373946_0147959
543 Ga0373955_0054862
544 Ga0373933_0008199
545 Ga0373937_0020940
546 Ga0395905_0547633
547 Ga0395901_1082725
548 Ga0436365_0864611
549 Ga0439433_0083968
550 Ga0439445_0040108
551 Ga0439440_0234328
552 Ga0451576_0020908
553 Ga0495582_0216612
554 Ga0495594_0386980
555 Ga0495628_0071251
556 Ga0495630_0533675
557 Ga0495652_0121584
558 Ga0495587_0003496
559 Ga0495645_0001285
560 Ga0495667_0079118
561 Ga0495588_0300713
562 Ga0495599_0076399
563 Ga0495623_0008029
564 Ga0495600_0003383
565 Ga0495604_0188012
566 Ga0495672_0003539
567 Ga0495675_0017058
568 Ga0495684_0023028
569 Ga0496113_1094279
570 Ga0496114_0003602
571 Ga0496114_0419771
572 Ga0501073_0579991
573 Ga0501234_038331
574 nmdc:mga00v17_225650_c1
575 nmdc:mga0k408_662646_c1
576 nmdc:mga04h51_17051_c1
577 nmdc:mga05p37_110531_c1
578 nmdc:mga05p37_186615_c1
579 nmdc:mga05p37_230991_c1
580 nmdc:mga05p37_7304_c1
581 nmdc:mga09592_18805_c1
582 nmdc:mga0qj67_1504_c1
583 nmdc:mga0qj67_578455_c1
584 nmdc:mga0qj67_84024_c1
585 nmdc:mga06r32_119762_c1
586 nmdc:mga06r32_16900_c1
587 nmdc:mga06r32_179911_c1
588 nmdc:mga06r32_63278_c1
589 nmdc:mga0n895_131878_c1
590 nmdc:mga0n895_19020_c1
591 nmdc:mga0rr50_382579_c1
592 nmdc:mga0rr50_741498_c1
593 nmdc:mga0a205_14232_c1
594 nmdc:mga0a205_4533_c1
595 Ga0500641_0053087
596 Ga0500555_000269
597 Ga0500589_092599
598 Ga0500645_000076
599 Ga0590071_011175
600 Ga0590074_001985
601 Ga0590075_011587
602 Ga0590075_032897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

92

166

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8215 2 191
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8189 1 190
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8105 1 190
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7996 1 192
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7982 1 193
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8213 2 189 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8165 2 189 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7982 1 193 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7898 1 193 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7873 1 192 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A7V9JGY0-F1-model_v4 Dihydrofolate reductase family protein 0.9732 55 193 GO:0008703
GO:0009231
AF-K9RR86-F1-model_v4 Dihydrofolate reductase 0.9482 1 191 GO:0008703
GO:0009231
AF-A0A841BZP7-F1-model_v4 Dihydrofolate reductase 0.947 1 192 GO:0008703
GO:0009231
AF-A0A6A7LAV2-F1-model_v4 Dihydrofolate reductase 0.9469 1 193 GO:0008703
GO:0009231
AF-A0A7V9JGY0-F1-model_v4 Dihydrofolate reductase family protein 0.9464 55 193 GO:0008703
GO:0009231

Map