F396033

General Info

Members Datasets Scaffolds Average Seq Length
301 141 602 148

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0225902|Ga0395905_0225902_779_1273
Length 164
Sequence MKTAIAIATGALVMTSPAEAAPARPAVEHFGRPTLNGQPLPFSDAVRAGDTLYLSGQLGIVDGKLPDGIEAQTKAALDNIGSILKRAGLGYGDVFHCTAMLSDMKLWPDFNKVYVTYFPEGRRPARSAFGASGLALGALIELECQAYAGEKLNVPTRREDTSSL

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
111 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.99
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0225902 3300037471 Bacteria 1751
2 JGI24735J21928_10037000 3300002067 Bacteria 1431
3 JGI24735J21928_10112202 3300002067 Bacteria 784
4 JGI24735J21928_10153171 3300002067 Unclassified 666
5 Ga0070658_10037906 3300005327 Bacteria 3887
6 Ga0070658_10722614 3300005327 Bacteria 865
7 Ga0070658_10761628 3300005327 Unclassified 841
8 Ga0070683_100272211 3300005329 Bacteria 1611
9 Ga0070683_100536869 3300005329 Bacteria 1118
10 Ga0070683_100782758 3300005329 Bacteria 914
11 Ga0070677_10052039 3300005333 Bacteria 1660
12 Ga0070680_100338686 3300005336 Bacteria 1278
13 Ga0070682_100163247 3300005337 Bacteria 1541
14 Ga0068868_100380132 3300005338 Unclassified 1215
15 Ga0070660_100001318 3300005339 Bacteria 16898
16 Ga0070660_100201145 3300005339 Bacteria 1616
17 Ga0070660_100508200 3300005339 Bacteria 1003
18 Ga0070660_100777035 3300005339 Bacteria 805
19 Ga0070661_100032786 3300005344 Bacteria 3761
20 Ga0070661_100181697 3300005344 Bacteria 1600
21 Ga0070692_10029252 3300005345 Bacteria 2744
22 Ga0070692_10141974 3300005345 Bacteria 1360
23 Ga0070692_10313682 3300005345 Bacteria 962
24 Ga0070671_100004794 3300005355 Bacteria 10753
25 Ga0070671_100518265 3300005355 Bacteria 1026
26 Ga0070673_100118592 3300005364 Bacteria 2204
27 Ga0070659_100020150 3300005366 Bacteria 5064
28 Ga0070659_100040635 3300005366 Bacteria 3635
29 Ga0070659_100126702 3300005366 Bacteria 2072
30 Ga0070659_100604609 3300005366 Bacteria 943
31 Ga0070659_100785192 3300005366 Bacteria 827
32 Ga0070667_100241762 3300005367 Unclassified 1612
33 Ga0070667_100360540 3300005367 Bacteria 1317
34 Ga0070667_100416022 3300005367 Bacteria 1225
35 Ga0070714_100006451 3300005435 Bacteria 9061
36 Ga0070714_100147891 3300005435 Bacteria 2114
37 Ga0070714_100498048 3300005435 Bacteria 1162
38 Ga0070714_101053400 3300005435 Unclassified 792
39 Ga0070713_101027188 3300005436 Bacteria 796
40 Ga0070663_100003354 3300005455 Bacteria 9242
41 Ga0070663_100350192 3300005455 Bacteria 1196
42 Ga0070662_100018692 3300005457 Bacteria 4692
43 Ga0070662_100143502 3300005457 Bacteria 1853
44 Ga0070662_100625038 3300005457 Bacteria 907
45 Ga0070681_10481454 3300005458 Bacteria 1154
46 Ga0070681_10552394 3300005458 Bacteria 1065
47 Ga0068867_100753608 3300005459 Bacteria 864
48 Ga0070679_100132108 3300005530 Bacteria 2477
49 Ga0070679_100286926 3300005530 Bacteria 1598
50 Ga0070684_101230898 3300005535 Bacteria 704
51 Ga0068853_100472379 3300005539 Bacteria 1181
52 Ga0070672_100142706 3300005543 Bacteria 1977
53 Ga0070672_100237972 3300005543 Bacteria 1531
54 Ga0070665_100507749 3300005548 Bacteria 1217
55 Ga0070665_100534374 3300005548 Bacteria 1184
56 Ga0068855_100345919 3300005563 Bacteria 1639
57 Ga0068855_100656947 3300005563 Bacteria 1125
58 Ga0068855_100779456 3300005563 Unclassified 1017
59 Ga0068857_100194526 3300005577 Bacteria 1848
60 Ga0068854_100032456 3300005578 Bacteria 3634
61 Ga0068856_100021369 3300005614 Bacteria 6291
62 Ga0068856_100122424 3300005614 Bacteria 2603
63 Ga0068856_100150203 3300005614 Bacteria 2338
64 Ga0068856_100254575 3300005614 Bacteria 1771
65 Ga0068856_100430342 3300005614 Bacteria 1340
66 Ga0068856_100642608 3300005614 Unclassified 1082
67 Ga0068856_101266915 3300005614 Unclassified 753
68 Ga0068852_100310959 3300005616 Bacteria 1528
69 Ga0068852_100340024 3300005616 Bacteria 1462
70 Ga0068852_100653117 3300005616 Bacteria 1059
71 Ga0068859_100658914 3300005617 Bacteria 1139
72 Ga0068864_100023734 3300005618 Bacteria 5153
73 Ga0068861_100779086 3300005719 Bacteria 896
74 Ga0068851_10002561 3300005834 Bacteria 7996
75 Ga0068860_100005315 3300005843 Bacteria 13069
76 Ga0068862_100539529 3300005844 Unclassified 1112
77 Ga0070717_11211126 3300006028 Bacteria 687
78 Ga0097621_100325843 3300006237 Bacteria 1361
79 Ga0097621_100365005 3300006237 Unclassified 1287
80 Ga0068871_100133651 3300006358 Bacteria 2105
81 Ga0097620_100658872 3300006931 Bacteria 1139
82 Ga0105240_10192398 3300009093 Bacteria 2398
83 Ga0105248_10039964 3300009177 Bacteria 5258
84 Ga0105248_10118442 3300009177 Bacteria 2987
85 Ga0105237_10343255 3300009545 Bacteria 1497
86 Ga0105238_10086205 3300009551 Bacteria 3128
87 Ga0105238_10198520 3300009551 Bacteria 1981
88 Ga0157373_10009802 3300013100 Bacteria 7063
89 Ga0157373_10437150 3300013100 Unclassified 940
90 Ga0157371_10054801 3300013102 Bacteria 2831
91 Ga0157371_10112938 3300013102 Bacteria 1929
92 Ga0157371_10114216 3300013102 Bacteria 1918
93 Ga0157371_10147955 3300013102 Bacteria 1674
94 Ga0157370_10276652 3300013104 Bacteria 1551
95 Ga0157370_10312620 3300013104 Bacteria 1449
96 Ga0157370_10560720 3300013104 Bacteria 1047
97 Ga0157370_11270973 3300013104 Bacteria 663
98 Ga0157369_10082554 3300013105 Bacteria 3438
99 Ga0157369_10136163 3300013105 Bacteria 2600
100 Ga0157369_10567837 3300013105 Unclassified 1172
101 Ga0157378_10366328 3300013297 Bacteria 1412
102 Ga0157372_10161152 3300013307 Bacteria 2593
103 Ga0157372_10272553 3300013307 Bacteria 1967
104 Ga0157372_10719107 3300013307 Bacteria 1162
105 Ga0157372_10917919 3300013307 Bacteria 1015
106 Ga0157375_10055788 3300013308 Bacteria 3897
107 Ga0206353_10214899 3300020082 Bacteria 1593
108 Ga0213876_10015311 3300021384 Bacteria 4060
109 Ga0207697_10060338 3300025315 Bacteria 1577
110 Ga0207656_10179217 3300025321 Bacteria 1016
111 Ga0207688_10158343 3300025901 Bacteria 1341
112 Ga0207647_10064670 3300025904 Bacteria 2222
113 Ga0207647_10233521 3300025904 Unclassified 1058
114 Ga0207647_10322397 3300025904 Bacteria 877
115 Ga0207705_10026766 3300025909 Bacteria 4110
116 Ga0207705_10030784 3300025909 Bacteria 3830
117 Ga0207705_10047579 3300025909 Bacteria 3084
118 Ga0207705_10166573 3300025909 Bacteria 1657
119 Ga0207705_11162011 3300025909 Bacteria 593
120 Ga0207707_10276304 3300025912 Bacteria 1455
121 Ga0207707_10845389 3300025912 Bacteria 760
122 Ga0207671_10148990 3300025914 Bacteria 1807
123 Ga0207660_10094101 3300025917 Bacteria 2227
124 Ga0207657_10001743 3300025919 Bacteria 23446
125 Ga0207657_10160099 3300025919 Bacteria 1829
126 Ga0207657_10169755 3300025919 Bacteria 1768
127 Ga0207657_10183818 3300025919 Bacteria 1689
128 Ga0207657_10336296 3300025919 Bacteria 1192
129 Ga0207649_10137064 3300025920 Bacteria 1670
130 Ga0207652_10087243 3300025921 Bacteria 2736
131 Ga0207652_10556661 3300025921 Bacteria 1030
132 Ga0207694_10617469 3300025924 Bacteria 912
133 Ga0207700_10686910 3300025928 Bacteria 913
134 Ga0207664_10031244 3300025929 Bacteria 4073
135 Ga0207664_10368125 3300025929 Unclassified 1274
136 Ga0207664_11000350 3300025929 Unclassified 749
137 Ga0207664_11146344 3300025929 Bacteria 694
138 Ga0207644_10472997 3300025931 Bacteria 1031
139 Ga0207690_10015267 3300025932 Bacteria 4650
140 Ga0207690_10059752 3300025932 Bacteria 2584
141 Ga0207690_10083694 3300025932 Bacteria 2234
142 Ga0207690_10150405 3300025932 Bacteria 1725
143 Ga0207690_10625038 3300025932 Bacteria 881
144 Ga0207690_11049553 3300025932 Bacteria 679
145 Ga0207706_10009047 3300025933 Bacteria 9163
146 Ga0207706_10103270 3300025933 Bacteria 2507
147 Ga0207706_10844868 3300025933 Unclassified 776
148 Ga0207704_10090916 3300025938 Bacteria 2005
149 Ga0207691_10124474 3300025940 Bacteria 2282
150 Ga0207711_10011122 3300025941 Bacteria 7481
151 Ga0207711_10299851 3300025941 Unclassified 1482
152 Ga0207689_11739170 3300025942 Bacteria 516
153 Ga0207661_10236016 3300025944 Bacteria 1621
154 Ga0207661_10289124 3300025944 Bacteria 1467
155 Ga0207661_10545312 3300025944 Bacteria 1062
156 Ga0207640_10035119 3300025981 Bacteria 3135
157 Ga0207640_10344066 3300025981 Bacteria 1196
158 Ga0207640_11604659 3300025981 Unclassified 586
159 Ga0207658_10053825 3300025986 Bacteria 2975
160 Ga0207658_10115458 3300025986 Bacteria 2131
161 Ga0207658_10149872 3300025986 Bacteria 1899
162 Ga0207677_10332957 3300026023 Bacteria 1266
163 Ga0207639_10000669 3300026041 Bacteria 23668
164 Ga0207639_10011819 3300026041 Bacteria 6070
165 Ga0207639_10991637 3300026041 Bacteria 787
166 Ga0207678_10004124 3300026067 Bacteria 13057
167 Ga0207678_10047363 3300026067 Bacteria 3718
168 Ga0207678_10089765 3300026067 Bacteria 2627
169 Ga0207678_10230280 3300026067 Bacteria 1587
170 Ga0207702_10191232 3300026078 Bacteria 1891
171 Ga0207702_10196754 3300026078 Bacteria 1866
172 Ga0207702_10334452 3300026078 Bacteria 1445
173 Ga0207702_10630598 3300026078 Bacteria 1053
174 Ga0207702_11473201 3300026078 Unclassified 674
175 Ga0207648_10355273 3300026089 Bacteria 1321
176 Ga0207648_11604966 3300026089 Bacteria 611
177 Ga0207676_10044980 3300026095 Bacteria 3408
178 Ga0207674_10011069 3300026116 Bacteria 10143
179 Ga0207674_11649942 3300026116 Bacteria 609
180 Ga0207698_10025634 3300026142 Bacteria 4157
181 Ga0207698_10088912 3300026142 Bacteria 2521
182 Ga0207698_10853805 3300026142 Bacteria 915
183 Ga0268266_10014081 3300028379 Bacteria 6885
184 Ga0268265_10003714 3300028380 Bacteria 10858
185 Ga0268264_10002703 3300028381 Bacteria 15474
186 Ga0316179_1046263 3300030734 Bacteria 807
187 Ga0307408_100026465 3300031548 Bacteria 3985
188 Ga0307405_10002491 3300031731 Bacteria 8137
189 Ga0307405_10310837 3300031731 Bacteria 1200
190 Ga0307413_10034430 3300031824 Bacteria 2895
191 Ga0307410_10043602 3300031852 Bacteria 2974
192 Ga0307410_10083836 3300031852 Bacteria 2245
193 Ga0307406_10019035 3300031901 Bacteria 4024
194 Ga0307407_10035028 3300031903 Bacteria 2754
195 Ga0307407_10169301 3300031903 Bacteria 1437
196 Ga0307412_10444169 3300031911 Bacteria 1067
197 Ga0307409_100019174 3300031995 Bacteria 4623
198 Ga0307409_100150441 3300031995 Bacteria 2020
199 Ga0307416_100010948 3300032002 Bacteria 6019
200 Ga0307414_10008712 3300032004 Bacteria 5779
201 Ga0307411_10013517 3300032005 Bacteria 4506
202 Ga0307411_10109931 3300032005 Bacteria 1970
203 Ga0307415_100008827 3300032126 Bacteria 5611
204 Ga0307415_101130833 3300032126 Bacteria 735
205 Ga0373933_0060594 3300035724 Bacteria 2282
206 Ga0373937_0014586 3300036401 Bacteria 6941
207 Ga0395899_0001383 3300037312 Bacteria 20823
208 Ga0395899_0001992 3300037312 Bacteria 16809
209 Ga0395899_0017914 3300037312 Bacteria 5390
210 Ga0395899_0329920 3300037312 Bacteria 1025
211 Ga0395900_0000240 3300037418 Bacteria 86222
212 Ga0395900_0002824 3300037418 Bacteria 18957
213 Ga0395900_0007734 3300037418 Bacteria 11085
214 Ga0395900_0016099 3300037418 Bacteria 7619
215 Ga0395900_0268353 3300037418 Bacteria 1702
216 Ga0395900_0431785 3300037418 Bacteria 1276
217 Ga0395900_0750508 3300037418 Unclassified 906
218 Ga0395900_1129137 3300037418 Unclassified 700
219 Ga0395900_1547858 3300037418 Bacteria 575
220 Ga0395900_1742206 3300037418 Bacteria 534
221 Ga0395898_0000619 3300037466 Bacteria 65174
222 Ga0395898_0003454 3300037466 Bacteria 17662
223 Ga0395898_0023947 3300037466 Bacteria 6162
224 Ga0395898_0031958 3300037466 Bacteria 5255
225 Ga0395898_0086529 3300037466 Bacteria 3020
226 Ga0395898_0226541 3300037466 Bacteria 1783
227 Ga0395898_0894468 3300037466 Bacteria 826
228 Ga0395898_1157225 3300037466 Bacteria 706
229 Ga0395905_0000219 3300037471 Bacteria 87705
230 Ga0395905_0002462 3300037471 Bacteria 20510
231 Ga0395905_0003068 3300037471 Bacteria 18077
232 Ga0395905_0004594 3300037471 Bacteria 14284
233 Ga0395905_0049244 3300037471 Bacteria 3948
234 Ga0395905_0065274 3300037471 Bacteria 3408
235 Ga0395905_0070685 3300037471 Bacteria 3271
236 Ga0395905_0101854 3300037471 Bacteria 2696
237 Ga0395905_0283340 3300037471 Bacteria 1543
238 Ga0395905_0337926 3300037471 Bacteria 1397
239 Ga0395901_0000471 3300038443 Bacteria 46714
240 Ga0395901_0001287 3300038443 Bacteria 26539
241 Ga0395901_0005137 3300038443 Bacteria 13217
242 Ga0395901_0008791 3300038443 Bacteria 10218
243 Ga0395901_0023263 3300038443 Bacteria 6351
244 Ga0395901_0061165 3300038443 Bacteria 3918
245 Ga0395901_0269418 3300038443 Bacteria 1771
246 Ga0395901_0373515 3300038443 Bacteria 1468
247 Ga0395901_0412971 3300038443 Bacteria 1385
248 Ga0395901_0711076 3300038443 Bacteria 1001
249 Ga0395901_1827121 3300038443 Unclassified 556
250 Ga0436365_0146387 3300039437 Bacteria 4144
251 Ga0436365_1539500 3300039437 Bacteria 2537
252 Ga0439445_0203327 3300042004 Bacteria 585
253 Ga0439458_0124888 3300042157 Bacteria 679
254 Ga0466969_0082441 3300044656 Bacteria 1533
255 Ga0466969_0186193 3300044656 Bacteria 949
256 Ga0466969_0531730 3300044656 Unclassified 537
257 Ga0466966_0007008 3300044684 Bacteria 7463
258 Ga0466966_0052655 3300044684 Bacteria 2585
259 Ga0466961_0016043 3300044693 Bacteria 4809
260 Ga0466961_0153792 3300044693 Bacteria 1435
261 Ga0466961_0284724 3300044693 Bacteria 1011
262 Ga0466963_0272053 3300044694 Bacteria 1190
263 Ga0466963_0861470 3300044694 Bacteria 639
264 Ga0466964_0109377 3300044706 Bacteria 1230
265 Ga0466964_0449588 3300044706 Unclassified 683
266 Ga0466971_0166887 3300044719 Bacteria 1032
267 Ga0466970_0018647 3300044765 Bacteria 3595
268 Ga0466957_0110697 3300044842 Bacteria 1741
269 Ga0466957_0116315 3300044842 Bacteria 1701
270 Ga0466957_0188346 3300044842 Bacteria 1351
271 Ga0466957_0647368 3300044842 Bacteria 743
272 Ga0466960_0444760 3300044901 Bacteria 753
273 Ga0466960_0582467 3300044901 Bacteria 663
274 Ga0466959_0264929 3300045049 Bacteria 1182
275 Ga0466959_0499341 3300045049 Bacteria 822
276 Ga0466959_0560188 3300045049 Bacteria 770
277 Ga0466959_0847717 3300045049 Bacteria 610
278 Ga0466958_0145142 3300045836 Bacteria 1495
279 Ga0466967_0067849 3300045976 Bacteria 3182
280 Ga0466967_0231753 3300045976 Bacteria 1758
281 Ga0466967_0407971 3300045976 Bacteria 1323
282 Ga0466967_0416118 3300045976 Bacteria 1309
283 Ga0466967_0486420 3300045976 Bacteria 1210
284 Ga0495663_0040602 3300046525 Bacteria 1413
285 Ga0495623_0479776 3300046679 Unclassified 659
286 Ga0495669_0092085 3300046684 Bacteria 1400
287 Ga0496101_0051459 3300048904 Bacteria 2968
288 Ga0496102_0396248 3300048905 Bacteria 1298
289 Ga0496106_0026222 3300048909 Bacteria 4337
290 Ga0496109_0202962 3300048912 Bacteria 1864
291 Ga0496110_0692691 3300048913 Bacteria 920
292 Ga0496111_0690224 3300048914 Bacteria 743
293 Ga0496112_0013628 3300048915 Bacteria 7512
294 Ga0496113_0162725 3300048916 Bacteria 1765
295 Ga0496115_1387128 3300048918 Unclassified 519
296 Ga0501067_0070802 3300049583 Bacteria 1931
297 Ga0501069_0452305 3300049585 Unclassified 763
298 Ga0501070_0646887 3300049586 Bacteria 840
299 nmdc:mga0n895_649385_c1 3300050512 Bacteria 1054
300 Ga0495612_0096319 3300053078 Bacteria 1257
301 Ga0466962_0196723 3300061719 Bacteria 984
302 Ga0395905_0225902
303 JGI24735J21928_10037000
304 JGI24735J21928_10112202
305 JGI24735J21928_10153171
306 Ga0070658_10037906
307 Ga0070658_10722614
308 Ga0070658_10761628
309 Ga0070683_100272211
310 Ga0070683_100536869
311 Ga0070683_100782758
312 Ga0070677_10052039
313 Ga0070680_100338686
314 Ga0070682_100163247
315 Ga0068868_100380132
316 Ga0070660_100001318
317 Ga0070660_100201145
318 Ga0070660_100508200
319 Ga0070660_100777035
320 Ga0070661_100032786
321 Ga0070661_100181697
322 Ga0070692_10029252
323 Ga0070692_10141974
324 Ga0070692_10313682
325 Ga0070671_100004794
326 Ga0070671_100518265
327 Ga0070673_100118592
328 Ga0070659_100020150
329 Ga0070659_100040635
330 Ga0070659_100126702
331 Ga0070659_100604609
332 Ga0070659_100785192
333 Ga0070667_100241762
334 Ga0070667_100360540
335 Ga0070667_100416022
336 Ga0070714_100006451
337 Ga0070714_100147891
338 Ga0070714_100498048
339 Ga0070714_101053400
340 Ga0070713_101027188
341 Ga0070663_100003354
342 Ga0070663_100350192
343 Ga0070662_100018692
344 Ga0070662_100143502
345 Ga0070662_100625038
346 Ga0070681_10481454
347 Ga0070681_10552394
348 Ga0068867_100753608
349 Ga0070679_100132108
350 Ga0070679_100286926
351 Ga0070684_101230898
352 Ga0068853_100472379
353 Ga0070672_100142706
354 Ga0070672_100237972
355 Ga0070665_100507749
356 Ga0070665_100534374
357 Ga0068855_100345919
358 Ga0068855_100656947
359 Ga0068855_100779456
360 Ga0068857_100194526
361 Ga0068854_100032456
362 Ga0068856_100021369
363 Ga0068856_100122424
364 Ga0068856_100150203
365 Ga0068856_100254575
366 Ga0068856_100430342
367 Ga0068856_100642608
368 Ga0068856_101266915
369 Ga0068852_100310959
370 Ga0068852_100340024
371 Ga0068852_100653117
372 Ga0068859_100658914
373 Ga0068864_100023734
374 Ga0068861_100779086
375 Ga0068851_10002561
376 Ga0068860_100005315
377 Ga0068862_100539529
378 Ga0070717_11211126
379 Ga0097621_100325843
380 Ga0097621_100365005
381 Ga0068871_100133651
382 Ga0097620_100658872
383 Ga0105240_10192398
384 Ga0105248_10039964
385 Ga0105248_10118442
386 Ga0105237_10343255
387 Ga0105238_10086205
388 Ga0105238_10198520
389 Ga0157373_10009802
390 Ga0157373_10437150
391 Ga0157371_10054801
392 Ga0157371_10112938
393 Ga0157371_10114216
394 Ga0157371_10147955
395 Ga0157370_10276652
396 Ga0157370_10312620
397 Ga0157370_10560720
398 Ga0157370_11270973
399 Ga0157369_10082554
400 Ga0157369_10136163
401 Ga0157369_10567837
402 Ga0157378_10366328
403 Ga0157372_10161152
404 Ga0157372_10272553
405 Ga0157372_10719107
406 Ga0157372_10917919
407 Ga0157375_10055788
408 Ga0206353_10214899
409 Ga0213876_10015311
410 Ga0207697_10060338
411 Ga0207656_10179217
412 Ga0207688_10158343
413 Ga0207647_10064670
414 Ga0207647_10233521
415 Ga0207647_10322397
416 Ga0207705_10026766
417 Ga0207705_10030784
418 Ga0207705_10047579
419 Ga0207705_10166573
420 Ga0207705_11162011
421 Ga0207707_10276304
422 Ga0207707_10845389
423 Ga0207671_10148990
424 Ga0207660_10094101
425 Ga0207657_10001743
426 Ga0207657_10160099
427 Ga0207657_10169755
428 Ga0207657_10183818
429 Ga0207657_10336296
430 Ga0207649_10137064
431 Ga0207652_10087243
432 Ga0207652_10556661
433 Ga0207694_10617469
434 Ga0207700_10686910
435 Ga0207664_10031244
436 Ga0207664_10368125
437 Ga0207664_11000350
438 Ga0207664_11146344
439 Ga0207644_10472997
440 Ga0207690_10015267
441 Ga0207690_10059752
442 Ga0207690_10083694
443 Ga0207690_10150405
444 Ga0207690_10625038
445 Ga0207690_11049553
446 Ga0207706_10009047
447 Ga0207706_10103270
448 Ga0207706_10844868
449 Ga0207704_10090916
450 Ga0207691_10124474
451 Ga0207711_10011122
452 Ga0207711_10299851
453 Ga0207689_11739170
454 Ga0207661_10236016
455 Ga0207661_10289124
456 Ga0207661_10545312
457 Ga0207640_10035119
458 Ga0207640_10344066
459 Ga0207640_11604659
460 Ga0207658_10053825
461 Ga0207658_10115458
462 Ga0207658_10149872
463 Ga0207677_10332957
464 Ga0207639_10000669
465 Ga0207639_10011819
466 Ga0207639_10991637
467 Ga0207678_10004124
468 Ga0207678_10047363
469 Ga0207678_10089765
470 Ga0207678_10230280
471 Ga0207702_10191232
472 Ga0207702_10196754
473 Ga0207702_10334452
474 Ga0207702_10630598
475 Ga0207702_11473201
476 Ga0207648_10355273
477 Ga0207648_11604966
478 Ga0207676_10044980
479 Ga0207674_10011069
480 Ga0207674_11649942
481 Ga0207698_10025634
482 Ga0207698_10088912
483 Ga0207698_10853805
484 Ga0268266_10014081
485 Ga0268265_10003714
486 Ga0268264_10002703
487 Ga0316179_1046263
488 Ga0307408_100026465
489 Ga0307405_10002491
490 Ga0307405_10310837
491 Ga0307413_10034430
492 Ga0307410_10043602
493 Ga0307410_10083836
494 Ga0307406_10019035
495 Ga0307407_10035028
496 Ga0307407_10169301
497 Ga0307412_10444169
498 Ga0307409_100019174
499 Ga0307409_100150441
500 Ga0307416_100010948
501 Ga0307414_10008712
502 Ga0307411_10013517
503 Ga0307411_10109931
504 Ga0307415_100008827
505 Ga0307415_101130833
506 Ga0373933_0060594
507 Ga0373937_0014586
508 Ga0395899_0001383
509 Ga0395899_0001992
510 Ga0395899_0017914
511 Ga0395899_0329920
512 Ga0395900_0000240
513 Ga0395900_0002824
514 Ga0395900_0007734
515 Ga0395900_0016099
516 Ga0395900_0268353
517 Ga0395900_0431785
518 Ga0395900_0750508
519 Ga0395900_1129137
520 Ga0395900_1547858
521 Ga0395900_1742206
522 Ga0395898_0000619
523 Ga0395898_0003454
524 Ga0395898_0023947
525 Ga0395898_0031958
526 Ga0395898_0086529
527 Ga0395898_0226541
528 Ga0395898_0894468
529 Ga0395898_1157225
530 Ga0395905_0000219
531 Ga0395905_0002462
532 Ga0395905_0003068
533 Ga0395905_0004594
534 Ga0395905_0049244
535 Ga0395905_0065274
536 Ga0395905_0070685
537 Ga0395905_0101854
538 Ga0395905_0283340
539 Ga0395905_0337926
540 Ga0395901_0000471
541 Ga0395901_0001287
542 Ga0395901_0005137
543 Ga0395901_0008791
544 Ga0395901_0023263
545 Ga0395901_0061165
546 Ga0395901_0269418
547 Ga0395901_0373515
548 Ga0395901_0412971
549 Ga0395901_0711076
550 Ga0395901_1827121
551 Ga0436365_0146387
552 Ga0436365_1539500
553 Ga0439445_0203327
554 Ga0439458_0124888
555 Ga0466969_0082441
556 Ga0466969_0186193
557 Ga0466969_0531730
558 Ga0466966_0007008
559 Ga0466966_0052655
560 Ga0466961_0016043
561 Ga0466961_0153792
562 Ga0466961_0284724
563 Ga0466963_0272053
564 Ga0466963_0861470
565 Ga0466964_0109377
566 Ga0466964_0449588
567 Ga0466971_0166887
568 Ga0466970_0018647
569 Ga0466957_0110697
570 Ga0466957_0116315
571 Ga0466957_0188346
572 Ga0466957_0647368
573 Ga0466960_0444760
574 Ga0466960_0582467
575 Ga0466959_0264929
576 Ga0466959_0499341
577 Ga0466959_0560188
578 Ga0466959_0847717
579 Ga0466958_0145142
580 Ga0466967_0067849
581 Ga0466967_0231753
582 Ga0466967_0407971
583 Ga0466967_0416118
584 Ga0466967_0486420
585 Ga0495663_0040602
586 Ga0495623_0479776
587 Ga0495669_0092085
588 Ga0496101_0051459
589 Ga0496102_0396248
590 Ga0496106_0026222
591 Ga0496109_0202962
592 Ga0496110_0692691
593 Ga0496111_0690224
594 Ga0496112_0013628
595 Ga0496113_0162725
596 Ga0496115_1387128
597 Ga0501067_0070802
598 Ga0501069_0452305
599 Ga0501070_0646887
600 nmdc:mga0n895_649385_c1
601 Ga0495612_0096319
602 Ga0466962_0196723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

37

148

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v4d-assembly1.cif.gz_A crystal structure of rutc protein a member of the yjgf family from e.coli 0.9041 41 150
2b33-assembly1.cif.gz_A crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution 0.9001 41 148
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.8978 43 148
3lyb-assembly1.cif.gz_B structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae 0.8915 42 150
3kjj-assembly1.cif.gz_B crystal structure of nmb1025, a member of yjgf protein family, from neisseria meningitidis (hexagonal crystal form) 0.89 23 152
ID Description Score Start End Superfamily
af_Q9USQ7_300_402_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9048 45 148 3.30.1330.40
af_A0A1D6HNY1_318_426_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8963 70 145 3.30.1330.40
af_A0A1D8PGY1_281_387_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8954 41 148 3.30.1330.40
af_Q9USQ7_300_402_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.872 45 148 3.30.1330.40
3lybC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8718 45 150 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A7J4TXT4-F1-model_v4 RidA family protein 0.9569 67 150 GO:0005829
GO:0019239
AF-A0A2V0QY85-F1-model_v4 deleted 0.9515 67 148
AF-A0A5N6XDW3-F1-model_v4 Endoribonuclease L-PSP/chorismate mutase-like protein 0.9379 78 152 GO:0005739
GO:0005829
GO:0019239
AF-A0A160VDH7-F1-model_v4 Endoribonuclease L-PSP 0.933 65 147 GO:0005739
GO:0005829
GO:0019239
AF-A0A318GL16-F1-model_v4 deleted 0.9248 42 148

Map