F396016

General Info

Members Datasets Scaffolds Average Seq Length
301 179 602 317

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100167734|Ga0307415_1001677342
Length 363
Sequence VKGRRQKAEGKRQKWRVSPRGDFFSIFAPGLLPFAFRVSGMPSQSALHPAGPQAERIIGLWWLMFWVTGAVFLVVMGFLAAALVRKRRPQGGGEGDAPPVVPEPAGERRMSHVVLVGVALTVFILFVFLIHSFLTGRALDSVSAQEHLTVKVIGHQWWWEVQYENTTASYVLTTANEIHLPVGRPVLFKLTSTDVIHSFWVPNLHGKTDLVPGHENVTWLRADREGTFRGQCAEFCGHQHAHMAFTVVVEPYEKFKAWYDAQLAPAPEPTTGEQARGRLLFLSTPCVMCHTVRGTDAGSRVGPDLTHVASRGTIAAGTLENTRAHLADWVADSQRVKPGNRMPPNPFEPADLEALLDYLQSLK

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
126 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
127 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
128 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
129 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
130 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
145 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
157 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
158 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
159 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
160 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
161 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
164 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 2.99
Rhizosphere 95.68
Stem 0
Stem Tuber 0
Unclassified 3.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100167734 3300032126 Bacteria 1709
2 MBSR1b_contig_10798678 2162886012 Bacteria 2276
3 JGI25406J46586_10000566 3300003203 Bacteria 17440
4 JGI25406J46586_10000579 3300003203 Bacteria 17283
5 Ga0065712_10192307 3300005290 Bacteria 1143
6 Ga0065715_10003118 3300005293 Bacteria 5759
7 Ga0070676_10003976 3300005328 Bacteria 7754
8 Ga0070676_10008454 3300005328 Bacteria 5550
9 Ga0070690_100000537 3300005330 Bacteria 18990
10 Ga0070690_100000789 3300005330 Bacteria 16066
11 Ga0070690_100064022 3300005330 Bacteria 2374
12 Ga0070670_100001737 3300005331 Bacteria 17738
13 Ga0070666_10000335 3300005335 Bacteria 29629
14 Ga0070666_10001791 3300005335 Bacteria 13087
15 Ga0070682_100000145 3300005337 Bacteria 56593
16 Ga0068868_100060576 3300005338 Bacteria 2998
17 Ga0070689_100011597 3300005340 Bacteria 6318
18 Ga0070689_100089463 3300005340 Bacteria 2425
19 Ga0070687_100008021 3300005343 Bacteria 4446
20 Ga0070669_100000761 3300005353 Bacteria 23446
21 Ga0070675_100004404 3300005354 Bacteria 10741
22 Ga0070675_100279326 3300005354 Bacteria 1467
23 Ga0070671_100008611 3300005355 Bacteria 8179
24 Ga0070674_100088222 3300005356 Bacteria 2232
25 Ga0070673_100019823 3300005364 Bacteria 4837
26 Ga0070673_100082353 3300005364 Bacteria 2612
27 Ga0070688_100001296 3300005365 Bacteria 12456
28 Ga0070667_100001371 3300005367 Bacteria 21827
29 Ga0070667_100038955 3300005367 Bacteria 3985
30 Ga0070701_10025338 3300005438 Bacteria 2879
31 Ga0070662_100002977 3300005457 Bacteria 10529
32 Ga0070706_100071640 3300005467 Bacteria 3206
33 Ga0068853_100237434 3300005539 Bacteria 1669
34 Ga0070672_100002026 3300005543 Bacteria 12736
35 Ga0070672_100015829 3300005543 Bacteria 5384
36 Ga0070672_100093711 3300005543 Bacteria 2427
37 Ga0070686_100004462 3300005544 Bacteria 7719
38 Ga0070686_100017011 3300005544 Bacteria 4241
39 Ga0070686_100093964 3300005544 Bacteria 2012
40 Ga0070686_100172616 3300005544 Bacteria 1530
41 Ga0070693_100049336 3300005547 Bacteria 2401
42 Ga0070665_100069865 3300005548 Bacteria 3520
43 Ga0070704_100025495 3300005549 Bacteria 3894
44 Ga0070704_100127019 3300005549 Bacteria 1969
45 Ga0068855_100008093 3300005563 Bacteria 12703
46 Ga0068855_100038366 3300005563 Bacteria 5692
47 Ga0070664_100001727 3300005564 Bacteria 17490
48 Ga0070664_100069867 3300005564 Bacteria 3006
49 Ga0070664_100201276 3300005564 Unclassified 1777
50 Ga0068857_100205151 3300005577 Unclassified 1798
51 Ga0068854_100201664 3300005578 Bacteria 1564
52 Ga0068856_100009201 3300005614 Bacteria 9606
53 Ga0068859_100002647 3300005617 Bacteria 18214
54 Ga0068859_100012645 3300005617 Bacteria 8484
55 Ga0068859_100045527 3300005617 Bacteria 4408
56 Ga0068859_100154124 3300005617 Bacteria 2374
57 Ga0068864_100026915 3300005618 Bacteria 4851
58 Ga0068861_100225007 3300005719 Bacteria 1588
59 Ga0068863_100003179 3300005841 Bacteria 16242
60 Ga0068863_100157869 3300005841 Bacteria 2172
61 Ga0068863_100225656 3300005841 Bacteria 1806
62 Ga0068858_100001543 3300005842 Bacteria 23652
63 Ga0081539_10000084 3300005985 Bacteria 218801
64 Ga0081539_10000795 3300005985 Bacteria 61261
65 Ga0081539_10005185 3300005985 Bacteria 13539
66 Ga0081539_10014470 3300005985 Bacteria 5832
67 Ga0081539_10058269 3300005985 Bacteria 2132
68 Ga0081539_10071123 3300005985 Bacteria 1865
69 Ga0081539_10132631 3300005985 Unclassified 1221
70 Ga0075367_10148204 3300006178 Unclassified 1455
71 Ga0097621_100343940 3300006237 Bacteria 1325
72 Ga0075430_100026812 3300006846 Bacteria 4901
73 Ga0075430_100162633 3300006846 Bacteria 1858
74 Ga0075431_100007846 3300006847 Bacteria 10638
75 Ga0075431_100012017 3300006847 Bacteria 8737
76 Ga0075431_100039197 3300006847 Bacteria 4881
77 Ga0075429_100024870 3300006880 Bacteria 5197
78 Ga0097620_100002647 3300006931 Bacteria 18214
79 Ga0097620_100012645 3300006931 Bacteria 8484
80 Ga0097620_100045528 3300006931 Bacteria 4408
81 Ga0097620_100154124 3300006931 Bacteria 2374
82 Ga0105240_10044712 3300009093 Bacteria 5624
83 Ga0105240_10170342 3300009093 Bacteria 2580
84 Ga0105240_10242891 3300009093 Unclassified 2087
85 Ga0111539_10000155 3300009094 Bacteria 78151
86 Ga0105245_10147702 3300009098 Bacteria 2219
87 Ga0105245_10442475 3300009098 Bacteria 1307
88 Ga0114129_10148967 3300009147 Bacteria 3203
89 Ga0105243_10040519 3300009148 Bacteria 3638
90 Ga0105243_10087759 3300009148 Bacteria 2554
91 Ga0105241_10333855 3300009174 Bacteria 1311
92 Ga0105248_10002228 3300009177 Bacteria 21426
93 Ga0105248_10198839 3300009177 Bacteria 2258
94 Ga0105238_10044951 3300009551 Bacteria 4463
95 Ga0105238_10156420 3300009551 Bacteria 2255
96 Ga0105249_10617739 3300009553 Bacteria 1139
97 Ga0105239_10062393 3300010375 Unclassified 4091
98 Ga0157369_10072950 3300013105 Bacteria 3683
99 Ga0157369_10151466 3300013105 Bacteria 2451
100 Ga0157369_10171076 3300013105 Bacteria 2289
101 Ga0157374_10069862 3300013296 Bacteria 3308
102 Ga0157374_10243011 3300013296 Bacteria 1771
103 Ga0157378_10030733 3300013297 Bacteria 4743
104 Ga0163162_10230707 3300013306 Unclassified 1982
105 Ga0157375_10019834 3300013308 Bacteria 6128
106 Ga0157375_10065532 3300013308 Bacteria 3621
107 Ga0163163_10265907 3300014325 Bacteria 1766
108 Ga0157377_10045940 3300014745 Bacteria 2441
109 Ga0157379_10005010 3300014968 Bacteria 11365
110 Ga0157376_10344284 3300014969 Bacteria 1424
111 Ga0163161_10050818 3300017792 Bacteria 3001
112 Ga0206351_10564620 3300020077 Bacteria 4373
113 Ga0206350_10981650 3300020080 Bacteria 5041
114 Ga0213876_10000006 3300021384 Bacteria 700803
115 Ga0224712_10032055 3300022467 Bacteria 1912
116 Ga0207680_10000770 3300025903 Bacteria 15128
117 Ga0207645_10018683 3300025907 Bacteria 4553
118 Ga0207645_10092356 3300025907 Bacteria 1947
119 Ga0207684_10342357 3300025910 Bacteria 1288
120 Ga0207654_10055876 3300025911 Bacteria 2288
121 Ga0207695_10025462 3300025913 Bacteria 6622
122 Ga0207695_10040958 3300025913 Bacteria 4961
123 Ga0207662_10012232 3300025918 Bacteria 4777
124 Ga0207662_10017546 3300025918 Bacteria 4051
125 Ga0207681_10026849 3300025923 Bacteria 3717
126 Ga0207650_10012351 3300025925 Bacteria 5897
127 Ga0207650_10158028 3300025925 Bacteria 1794
128 Ga0207650_10237298 3300025925 Bacteria 1473
129 Ga0207659_10002676 3300025926 Bacteria 10616
130 Ga0207659_10054839 3300025926 Bacteria 2848
131 Ga0207706_10001729 3300025933 Bacteria 21511
132 Ga0207670_10001567 3300025936 Bacteria 11996
133 Ga0207669_10040041 3300025937 Bacteria 2715
134 Ga0207691_10012203 3300025940 Bacteria 8235
135 Ga0207691_10024163 3300025940 Bacteria 5715
136 Ga0207691_10039377 3300025940 Bacteria 4373
137 Ga0207691_10072874 3300025940 Bacteria 3098
138 Ga0207711_10001140 3300025941 Bacteria 25341
139 Ga0207711_10189651 3300025941 Bacteria 1873
140 Ga0207661_10020472 3300025944 Bacteria 4945
141 Ga0207679_10009399 3300025945 Bacteria 6263
142 Ga0207667_10012514 3300025949 Bacteria 9766
143 Ga0207651_10000945 3300025960 Bacteria 12799
144 Ga0207651_10232248 3300025960 Bacteria 1498
145 Ga0207658_10000994 3300025986 Bacteria 23252
146 Ga0207677_10181493 3300026023 Unclassified 1656
147 Ga0207677_10235869 3300026023 Unclassified 1477
148 Ga0207639_10009212 3300026041 Bacteria 6806
149 Ga0207639_10178192 3300026041 Bacteria 1806
150 Ga0207678_10006145 3300026067 Bacteria 10683
151 Ga0207708_10004778 3300026075 Bacteria 9973
152 Ga0207702_10005921 3300026078 Bacteria 10620
153 Ga0207702_10365941 3300026078 Bacteria 1383
154 Ga0207641_10005334 3300026088 Bacteria 10981
155 Ga0207641_10036635 3300026088 Bacteria 4095
156 Ga0207641_10425649 3300026088 Bacteria 1279
157 Ga0207648_10207451 3300026089 Bacteria 1739
158 Ga0207674_10174106 3300026116 Bacteria 2105
159 Ga0207698_10241797 3300026142 Bacteria 1646
160 Ga0209969_1005224 3300027360 Bacteria 1817
161 Ga0209996_1004908 3300027395 Bacteria 1707
162 Ga0209968_1003068 3300027526 Unclassified 2505
163 Ga0209999_1015496 3300027543 Bacteria 1387
164 Ga0209966_1001649 3300027695 Bacteria 3806
165 Ga0209998_10002632 3300027717 Bacteria 4061
166 Ga0207428_10002409 3300027907 Bacteria 18665
167 Ga0268266_10048547 3300028379 Bacteria 3639
168 Ga0268264_10001464 3300028381 Bacteria 22055
169 Ga0307408_100006204 3300031548 Bacteria 7939
170 Ga0307408_100028131 3300031548 Bacteria 3882
171 Ga0307408_100061901 3300031548 Bacteria 2733
172 Ga0307408_100161182 3300031548 Bacteria 1782
173 Ga0307405_10003427 3300031731 Bacteria 7281
174 Ga0307405_10006715 3300031731 Bacteria 5686
175 Ga0307405_10140371 3300031731 Bacteria 1683
176 Ga0307413_10001333 3300031824 Bacteria 9220
177 Ga0307413_10003372 3300031824 Bacteria 6715
178 Ga0307413_10006494 3300031824 Bacteria 5349
179 Ga0307413_10198209 3300031824 Unclassified 1448
180 Ga0307410_10001978 3300031852 Bacteria 9634
181 Ga0307410_10002587 3300031852 Bacteria 8783
182 Ga0307410_10039621 3300031852 Bacteria 3094
183 Ga0307410_10046679 3300031852 Bacteria 2891
184 Ga0307410_10062225 3300031852 Bacteria 2556
185 Ga0307410_10158136 3300031852 Unclassified 1695
186 Ga0307410_10160743 3300031852 Bacteria 1683
187 Ga0307406_10003696 3300031901 Bacteria 8332
188 Ga0307406_10009108 3300031901 Bacteria 5556
189 Ga0307406_10082173 3300031901 Bacteria 2145
190 Ga0307406_10180161 3300031901 Bacteria 1538
191 Ga0307407_10005092 3300031903 Bacteria 5664
192 Ga0307407_10030388 3300031903 Bacteria 2914
193 Ga0307407_10036683 3300031903 Bacteria 2703
194 Ga0307407_10041096 3300031903 Bacteria 2583
195 Ga0307407_10340146 3300031903 Bacteria 1059
196 Ga0307412_10063059 3300031911 Bacteria 2499
197 Ga0307412_10077273 3300031911 Bacteria 2289
198 Ga0307412_10096162 3300031911 Bacteria 2084
199 Ga0307412_10108575 3300031911 Bacteria 1977
200 Ga0307409_100002206 3300031995 Bacteria 10063
201 Ga0307409_100010442 3300031995 Bacteria 5777
202 Ga0307409_100015104 3300031995 Bacteria 5051
203 Ga0307409_100023840 3300031995 Bacteria 4251
204 Ga0307409_100066608 3300031995 Bacteria 2841
205 Ga0307409_100263070 3300031995 Bacteria 1584
206 Ga0307416_100003186 3300032002 Bacteria 9609
207 Ga0307416_100008411 3300032002 Bacteria 6656
208 Ga0307416_100008895 3300032002 Bacteria 6523
209 Ga0307416_100013707 3300032002 Bacteria 5520
210 Ga0307416_100039409 3300032002 Bacteria 3658
211 Ga0307416_100117533 3300032002 Bacteria 2361
212 Ga0307416_100185345 3300032002 Bacteria 1955
213 Ga0307416_100399151 3300032002 Bacteria 1412
214 Ga0307414_10019005 3300032004 Bacteria 4248
215 Ga0307414_10022399 3300032004 Bacteria 3983
216 Ga0307414_10026395 3300032004 Bacteria 3738
217 Ga0307414_10033790 3300032004 Bacteria 3384
218 Ga0307414_10204277 3300032004 Bacteria 1610
219 Ga0307411_10001984 3300032005 Bacteria 8781
220 Ga0307411_10002406 3300032005 Bacteria 8254
221 Ga0307411_10008093 3300032005 Bacteria 5419
222 Ga0307411_10039102 3300032005 Bacteria 2998
223 Ga0307411_10063900 3300032005 Bacteria 2462
224 Ga0307411_10195114 3300032005 Bacteria 1550
225 Ga0307415_100003415 3300032126 Bacteria 8078
226 Ga0307415_100010769 3300032126 Bacteria 5194
227 Ga0307415_100055521 3300032126 Bacteria 2711
228 Ga0307415_100121506 3300032126 Bacteria 1959
229 Ga0373932_0100201 3300035112 Bacteria 941
230 Ga0373925_0004548 3300037068 Bacteria 10476
231 Ga0395900_0078388 3300037418 Bacteria 3395
232 Ga0395905_0011104 3300037471 Bacteria 8712
233 Ga0395905_0026456 3300037471 Bacteria 5469
234 Ga0395901_0621380 3300038443 Bacteria 1087
235 Ga0436365_0695157 3300039437 Bacteria 511493
236 Ga0439433_0022541 3300041999 Bacteria 1414
237 Ga0450920_024602 3300042122 Bacteria 1170
238 Ga0450923_018247 3300042125 Bacteria 1340
239 Ga0450894_002708 3300042131 Bacteria 2351
240 Ga0450896_002572 3300042133 Bacteria 2354
241 Ga0450906_014425 3300042145 Bacteria 1446
242 Ga0466963_0001208 3300044694 Bacteria 13597
243 Ga0466963_0266394 3300044694 Bacteria 1203
244 Ga0466957_0000487 3300044842 Bacteria 19773
245 Ga0466957_0198578 3300044842 Bacteria 1317
246 Ga0451576_0025638 3300045051 Bacteria 6352
247 Ga0466967_0000869 3300045976 Bacteria 16105
248 Ga0495621_0002666 3300046539 Bacteria 4828
249 Ga0495659_0006428 3300046664 Bacteria 3709
250 Ga0496101_0116516 3300048904 Bacteria 2016
251 Ga0496102_0001480 3300048905 Bacteria 20735
252 Ga0496102_0035231 3300048905 Bacteria 4504
253 Ga0496103_0007033 3300048906 Bacteria 6716
254 Ga0496103_0024105 3300048906 Bacteria 3670
255 Ga0496106_0000862 3300048909 Bacteria 22049
256 Ga0496107_0002070 3300048910 Bacteria 12826
257 Ga0496109_0219933 3300048912 Bacteria 1786
258 Ga0496113_0212553 3300048916 Bacteria 1540
259 Ga0501298_003399 3300049521 Bacteria 2467
260 Ga0501299_002296 3300049522 Bacteria 2639
261 Ga0501036_0083395 3300049572 Bacteria 2702
262 Ga0501039_0088592 3300049575 Bacteria 2411
263 Ga0501039_0273192 3300049575 Bacteria 1328
264 Ga0501040_0015509 3300049576 Bacteria 5036
265 Ga0501040_0059330 3300049576 Bacteria 2629
266 Ga0501042_0300803 3300049578 Bacteria 1159
267 Ga0501048_0237499 3300049582 Bacteria 1293
268 Ga0501067_0033998 3300049583 Bacteria 2829
269 Ga0501071_0036477 3300049587 Bacteria 3507
270 Ga0501072_0045842 3300049588 Bacteria 3439
271 Ga0501072_0181833 3300049588 Bacteria 1677
272 Ga0501072_0243070 3300049588 Bacteria 1434
273 Ga0501075_0038162 3300049591 Bacteria 3591
274 Ga0501076_0026355 3300049592 Bacteria 4502
275 Ga0501202_004672 3300049652 Bacteria 2400
276 Ga0501216_000224 3300049660 Bacteria 6219
277 Ga0501235_000297 3300049669 Bacteria 9352
278 Ga0501243_002136 3300049675 Bacteria 2879
279 Ga0501257_023460 3300049686 Bacteria 1463
280 Ga0501259_007708 3300049688 Bacteria 1725
281 Ga0501079_0084245 3300049741 Bacteria 2459
282 Ga0501266_002347 3300049763 Bacteria 2396
283 Ga0501268_001632 3300049765 Bacteria 2832
284 Ga0501035_0088201 3300049822 Bacteria 2734
285 Ga0501044_0002560 3300049823 Bacteria 20710
286 nmdc:mga05p37_25689_c1 3300050507 Bacteria 7164
287 nmdc:mga09592_22969_c1 3300050508 Bacteria 5147
288 nmdc:mga0qj67_59971_c1 3300050509 Bacteria 3018
289 nmdc:mga06r32_162179_c1 3300050510 Bacteria 2218
290 nmdc:mga08y16_498_c1 3300050511 Bacteria 36164
291 nmdc:mga08x19_124619_c1 3300050514 Bacteria 1729
292 nmdc:mga08x19_56638_c1 3300050514 Bacteria 2530
293 Ga0500568_0000558 3300053139 Bacteria 27353
294 Ga0501084_0013137 3300054114 Bacteria 6851
295 Ga0501084_0138467 3300054114 Bacteria 2049
296 Ga0590071_000126 3300059421 Bacteria 21337
297 Ga0590071_000780 3300059421 Bacteria 8923
298 Ga0590074_001121 3300059423 Bacteria 4223
299 Ga0590075_001183 3300059424 Bacteria 6605
300 Ga0590077_001637 3300059426 Bacteria 5124
301 Ga0501082_0416683 3300060353 Bacteria 1173
302 Ga0307415_100167734
303 MBSR1b_contig_10798678
304 JGI25406J46586_10000566
305 JGI25406J46586_10000579
306 Ga0065712_10192307
307 Ga0065715_10003118
308 Ga0070676_10003976
309 Ga0070676_10008454
310 Ga0070690_100000537
311 Ga0070690_100000789
312 Ga0070690_100064022
313 Ga0070670_100001737
314 Ga0070666_10000335
315 Ga0070666_10001791
316 Ga0070682_100000145
317 Ga0068868_100060576
318 Ga0070689_100011597
319 Ga0070689_100089463
320 Ga0070687_100008021
321 Ga0070669_100000761
322 Ga0070675_100004404
323 Ga0070675_100279326
324 Ga0070671_100008611
325 Ga0070674_100088222
326 Ga0070673_100019823
327 Ga0070673_100082353
328 Ga0070688_100001296
329 Ga0070667_100001371
330 Ga0070667_100038955
331 Ga0070701_10025338
332 Ga0070662_100002977
333 Ga0070706_100071640
334 Ga0068853_100237434
335 Ga0070672_100002026
336 Ga0070672_100015829
337 Ga0070672_100093711
338 Ga0070686_100004462
339 Ga0070686_100017011
340 Ga0070686_100093964
341 Ga0070686_100172616
342 Ga0070693_100049336
343 Ga0070665_100069865
344 Ga0070704_100025495
345 Ga0070704_100127019
346 Ga0068855_100008093
347 Ga0068855_100038366
348 Ga0070664_100001727
349 Ga0070664_100069867
350 Ga0070664_100201276
351 Ga0068857_100205151
352 Ga0068854_100201664
353 Ga0068856_100009201
354 Ga0068859_100002647
355 Ga0068859_100012645
356 Ga0068859_100045527
357 Ga0068859_100154124
358 Ga0068864_100026915
359 Ga0068861_100225007
360 Ga0068863_100003179
361 Ga0068863_100157869
362 Ga0068863_100225656
363 Ga0068858_100001543
364 Ga0081539_10000084
365 Ga0081539_10000795
366 Ga0081539_10005185
367 Ga0081539_10014470
368 Ga0081539_10058269
369 Ga0081539_10071123
370 Ga0081539_10132631
371 Ga0075367_10148204
372 Ga0097621_100343940
373 Ga0075430_100026812
374 Ga0075430_100162633
375 Ga0075431_100007846
376 Ga0075431_100012017
377 Ga0075431_100039197
378 Ga0075429_100024870
379 Ga0097620_100002647
380 Ga0097620_100012645
381 Ga0097620_100045528
382 Ga0097620_100154124
383 Ga0105240_10044712
384 Ga0105240_10170342
385 Ga0105240_10242891
386 Ga0111539_10000155
387 Ga0105245_10147702
388 Ga0105245_10442475
389 Ga0114129_10148967
390 Ga0105243_10040519
391 Ga0105243_10087759
392 Ga0105241_10333855
393 Ga0105248_10002228
394 Ga0105248_10198839
395 Ga0105238_10044951
396 Ga0105238_10156420
397 Ga0105249_10617739
398 Ga0105239_10062393
399 Ga0157369_10072950
400 Ga0157369_10151466
401 Ga0157369_10171076
402 Ga0157374_10069862
403 Ga0157374_10243011
404 Ga0157378_10030733
405 Ga0163162_10230707
406 Ga0157375_10019834
407 Ga0157375_10065532
408 Ga0163163_10265907
409 Ga0157377_10045940
410 Ga0157379_10005010
411 Ga0157376_10344284
412 Ga0163161_10050818
413 Ga0206351_10564620
414 Ga0206350_10981650
415 Ga0213876_10000006
416 Ga0224712_10032055
417 Ga0207680_10000770
418 Ga0207645_10018683
419 Ga0207645_10092356
420 Ga0207684_10342357
421 Ga0207654_10055876
422 Ga0207695_10025462
423 Ga0207695_10040958
424 Ga0207662_10012232
425 Ga0207662_10017546
426 Ga0207681_10026849
427 Ga0207650_10012351
428 Ga0207650_10158028
429 Ga0207650_10237298
430 Ga0207659_10002676
431 Ga0207659_10054839
432 Ga0207706_10001729
433 Ga0207670_10001567
434 Ga0207669_10040041
435 Ga0207691_10012203
436 Ga0207691_10024163
437 Ga0207691_10039377
438 Ga0207691_10072874
439 Ga0207711_10001140
440 Ga0207711_10189651
441 Ga0207661_10020472
442 Ga0207679_10009399
443 Ga0207667_10012514
444 Ga0207651_10000945
445 Ga0207651_10232248
446 Ga0207658_10000994
447 Ga0207677_10181493
448 Ga0207677_10235869
449 Ga0207639_10009212
450 Ga0207639_10178192
451 Ga0207678_10006145
452 Ga0207708_10004778
453 Ga0207702_10005921
454 Ga0207702_10365941
455 Ga0207641_10005334
456 Ga0207641_10036635
457 Ga0207641_10425649
458 Ga0207648_10207451
459 Ga0207674_10174106
460 Ga0207698_10241797
461 Ga0209969_1005224
462 Ga0209996_1004908
463 Ga0209968_1003068
464 Ga0209999_1015496
465 Ga0209966_1001649
466 Ga0209998_10002632
467 Ga0207428_10002409
468 Ga0268266_10048547
469 Ga0268264_10001464
470 Ga0307408_100006204
471 Ga0307408_100028131
472 Ga0307408_100061901
473 Ga0307408_100161182
474 Ga0307405_10003427
475 Ga0307405_10006715
476 Ga0307405_10140371
477 Ga0307413_10001333
478 Ga0307413_10003372
479 Ga0307413_10006494
480 Ga0307413_10198209
481 Ga0307410_10001978
482 Ga0307410_10002587
483 Ga0307410_10039621
484 Ga0307410_10046679
485 Ga0307410_10062225
486 Ga0307410_10158136
487 Ga0307410_10160743
488 Ga0307406_10003696
489 Ga0307406_10009108
490 Ga0307406_10082173
491 Ga0307406_10180161
492 Ga0307407_10005092
493 Ga0307407_10030388
494 Ga0307407_10036683
495 Ga0307407_10041096
496 Ga0307407_10340146
497 Ga0307412_10063059
498 Ga0307412_10077273
499 Ga0307412_10096162
500 Ga0307412_10108575
501 Ga0307409_100002206
502 Ga0307409_100010442
503 Ga0307409_100015104
504 Ga0307409_100023840
505 Ga0307409_100066608
506 Ga0307409_100263070
507 Ga0307416_100003186
508 Ga0307416_100008411
509 Ga0307416_100008895
510 Ga0307416_100013707
511 Ga0307416_100039409
512 Ga0307416_100117533
513 Ga0307416_100185345
514 Ga0307416_100399151
515 Ga0307414_10019005
516 Ga0307414_10022399
517 Ga0307414_10026395
518 Ga0307414_10033790
519 Ga0307414_10204277
520 Ga0307411_10001984
521 Ga0307411_10002406
522 Ga0307411_10008093
523 Ga0307411_10039102
524 Ga0307411_10063900
525 Ga0307411_10195114
526 Ga0307415_100003415
527 Ga0307415_100010769
528 Ga0307415_100055521
529 Ga0307415_100121506
530 Ga0373932_0100201
531 Ga0373925_0004548
532 Ga0395900_0078388
533 Ga0395905_0011104
534 Ga0395905_0026456
535 Ga0395901_0621380
536 Ga0436365_0695157
537 Ga0439433_0022541
538 Ga0450920_024602
539 Ga0450923_018247
540 Ga0450894_002708
541 Ga0450896_002572
542 Ga0450906_014425
543 Ga0466963_0001208
544 Ga0466963_0266394
545 Ga0466957_0000487
546 Ga0466957_0198578
547 Ga0451576_0025638
548 Ga0466967_0000869
549 Ga0495621_0002666
550 Ga0495659_0006428
551 Ga0496101_0116516
552 Ga0496102_0001480
553 Ga0496102_0035231
554 Ga0496103_0007033
555 Ga0496103_0024105
556 Ga0496106_0000862
557 Ga0496107_0002070
558 Ga0496109_0219933
559 Ga0496113_0212553
560 Ga0501298_003399
561 Ga0501299_002296
562 Ga0501036_0083395
563 Ga0501039_0088592
564 Ga0501039_0273192
565 Ga0501040_0015509
566 Ga0501040_0059330
567 Ga0501042_0300803
568 Ga0501048_0237499
569 Ga0501067_0033998
570 Ga0501071_0036477
571 Ga0501072_0045842
572 Ga0501072_0181833
573 Ga0501072_0243070
574 Ga0501075_0038162
575 Ga0501076_0026355
576 Ga0501202_004672
577 Ga0501216_000224
578 Ga0501235_000297
579 Ga0501243_002136
580 Ga0501257_023460
581 Ga0501259_007708
582 Ga0501079_0084245
583 Ga0501266_002347
584 Ga0501268_001632
585 Ga0501035_0088201
586 Ga0501044_0002560
587 nmdc:mga05p37_25689_c1
588 nmdc:mga09592_22969_c1
589 nmdc:mga0qj67_59971_c1
590 nmdc:mga06r32_162179_c1
591 nmdc:mga08y16_498_c1
592 nmdc:mga08x19_124619_c1
593 nmdc:mga08x19_56638_c1
594 Ga0500568_0000558
595 Ga0501084_0013137
596 Ga0501084_0138467
597 Ga0590071_000126
598 Ga0590071_000780
599 Ga0590074_001121
600 Ga0590075_001183
601 Ga0590077_001637
602 Ga0501082_0416683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

274

363

0.96

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

148

250

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bqs-assembly1.cif.gz_Db cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila 0.9293 125 209
7w5z-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.9269 125 208
2cua-assembly2.cif.gz_B the cua domain of cytochrome ba3 from thermus thermophilus 0.9136 97 198
1cyw-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii) (cyoa) 0.9126 94 209
6ptt-assembly2.cif.gz_B soluble model of arabidopsis thaliana cua (tt3lat) 0.9023 93 198
ID Description Score Start End Superfamily
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9456 124 206 2.60.40.420
af_A0A2P2CLF0_113_253_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9231 93 210 2.60.40.420
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9049 93 307 2.60.40.420
5wehH02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.903 96 208 2.60.40.420
3hb3B01 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.866 86 210 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A7C3J855-F1-model_v4 C-type cytochrome 0.9866 195 307 GO:0009055
GO:0020037
GO:0046872
AF-A0A529M468-F1-model_v4 C-type cytochrome 0.9838 102 307 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A435FK68-F1-model_v4 Cytochrome c 0.9801 204 307 GO:0009055
GO:0020037
GO:0046872
AF-A0A7V9QDC1-F1-model_v4 C-type cytochrome 0.9766 122 307 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A2V8GJU3-F1-model_v4 Cytochrome c oxidase subunit II 0.9759 150 307 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773

Map