F395996

General Info

Members Datasets Scaffolds Average Seq Length
301 213 602 217

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100840007|Ga0307408_1008400071
Length 239
Sequence MALQAAGSQDGGRRQGILFDVDGTLIDSSYIHTISWWGAFRQQGYDIPMASIHHFVGMGGDRLVDSLLPASRDRSLDSEIMASHGALYASHWPALRTFDGAKDLLAQCHAAGLAVALASSARTQDLQVMKATLDADAFIDAATSANDAKDSKPAPDILVAALEAIGVEAADAVFVGDAVWDMKAAAALGIPAIAVTCGGVNAGELRDAGAVEVYEGPRDLLENLTSSAIGRLLSLAANS

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
17 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
27 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
28 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
29 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
30 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
37 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
38 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
39 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
44 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
45 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
52 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
53 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
54 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
55 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
56 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
57 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
58 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
61 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
62 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
63 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
64 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
65 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
66 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
67 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
88 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
104 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
105 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
106 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
107 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
148 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
149 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
150 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
151 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
152 2643221647 Streptomyces sp. Root369 Isolate Unclassified
153 2643221670 Streptomyces sp. Root431 Isolate Unclassified
154 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
155 2643221714 Streptomyces sp. Root264 Isolate Unclassified
156 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
157 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
158 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
159 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
160 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
161 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
162 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
163 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
164 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
165 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
166 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
167 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
168 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
169 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
170 2808606448 Streptomyces sp. 193411 Isolate Unclassified
171 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
172 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
173 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
174 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
175 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
176 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
177 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
178 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
179 2867428634 Streptomyces sp. RP5T Isolate Unclassified
180 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
181 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
182 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
183 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
184 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
185 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
186 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
187 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
188 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
189 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
190 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
191 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
192 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
193 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
194 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
195 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
196 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
197 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
198 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
199 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
200 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
201 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
202 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
203 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
204 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
205 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
206 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
207 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
208 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
209 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
210 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
211 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
212 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
213 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.07
Metatranscriptomes 0
Isolates 21.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0
Rhizoplane 4.65
Rhizosphere 77.41
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100840007 3300031548 Bacteria 836
2 JGI24739J22299_10087734 3300001989 Bacteria 950
3 JGI24737J22298_10004072 3300001990 Bacteria 5113
4 JGI24738J21930_10060460 3300002075 Bacteria 778
5 Ga0068868_100389848 3300005338 Bacteria 1200
6 Ga0068856_100349554 3300005614 Bacteria 1497
7 Ga0068856_100927561 3300005614 Bacteria 889
8 Ga0068860_100405675 3300005843 Bacteria 1349
9 Ga0075368_10000679 3300006042 Bacteria 10353
10 Ga0075363_100032914 3300006048 Bacteria 2696
11 Ga0075367_10001005 3300006178 Bacteria 11580
12 Ga0075370_10010381 3300006353 Bacteria 4868
13 Ga0111539_10596073 3300009094 Unclassified 1287
14 Ga0105245_10502659 3300009098 Bacteria 1228
15 Ga0105243_10159398 3300009148 Bacteria 1944
16 Ga0157369_10127356 3300013105 Bacteria 2699
17 Ga0163162_10078490 3300013306 Bacteria 3367
18 Ga0163163_10492306 3300014325 Bacteria 1288
19 Ga0182008_10010771 3300014497 Bacteria 4886
20 Ga0182006_1063476 3300015261 Bacteria 1387
21 Ga0182007_10011069 3300015262 Bacteria 3529
22 Ga0183367_1016 3300015688 Bacteria 290198
23 Ga0207647_10169510 3300025904 Bacteria 1272
24 Ga0207667_10863730 3300025949 Bacteria 898
25 Ga0207677_10468001 3300026023 Bacteria 1083
26 Ga0209371_1014180 3300027312 Bacteria 2196
27 Ga0209813_10011538 3300027866 Bacteria 2312
28 Ga0307517_10002470 3300028786 Bacteria 29566
29 Ga0307515_10001437 3300028794 Bacteria 53784
30 Ga0268256_1051249 3300030500 Bacteria 869
31 Ga0307513_10308149 3300031456 Bacteria 1347
32 Ga0307408_100030053 3300031548 Bacteria 3770
33 Ga0307408_100031994 3300031548 Bacteria 3666
34 Ga0307408_100059707 3300031548 Bacteria 2776
35 Ga0307408_100161041 3300031548 Bacteria 1782
36 Ga0307508_10059278 3300031616 Bacteria 3386
37 Ga0307514_10078105 3300031649 Bacteria 2460
38 Ga0307516_10051507 3300031730 Bacteria 4035
39 Ga0307405_10004301 3300031731 Bacteria 6704
40 Ga0307405_10042534 3300031731 Bacteria 2766
41 Ga0307405_10119417 3300031731 Bacteria 1801
42 Ga0307405_10123002 3300031731 Bacteria 1779
43 Ga0307405_10137634 3300031731 Bacteria 1697
44 Ga0307413_10407116 3300031824 Bacteria 1067
45 Ga0307518_10002757 3300031838 Bacteria 12754
46 Ga0307518_10141788 3300031838 Bacteria 1675
47 Ga0307410_10010378 3300031852 Bacteria 5271
48 Ga0307406_10003336 3300031901 Bacteria 8754
49 Ga0307406_10015862 3300031901 Bacteria 4368
50 Ga0307407_10022387 3300031903 Bacteria 3278
51 Ga0307407_10030478 3300031903 Bacteria 2910
52 Ga0307407_10143488 3300031903 Bacteria 1543
53 Ga0307412_10029390 3300031911 Bacteria 3449
54 Ga0307412_10073271 3300031911 Bacteria 2342
55 Ga0307412_10112113 3300031911 Bacteria 1949
56 Ga0307409_100051000 3300031995 Bacteria 3164
57 Ga0307409_100090547 3300031995 Bacteria 2504
58 Ga0307409_100122253 3300031995 Bacteria 2207
59 Ga0307409_100728552 3300031995 Bacteria 993
60 Ga0307416_100020966 3300032002 Bacteria 4678
61 Ga0307416_100183366 3300032002 Bacteria 1964
62 Ga0307411_10021469 3300032005 Bacteria 3779
63 Ga0307415_100002474 3300032126 Bacteria 9230
64 Ga0307415_100320831 3300032126 Bacteria 1292
65 Ga0307507_10027442 3300033179 Bacteria 6103
66 Ga0395899_0528352 3300037312 Bacteria 761
67 Ga0395900_0026971 3300037418 Bacteria 5880
68 Ga0395900_0029940 3300037418 Bacteria 5587
69 Ga0395900_0437438 3300037418 Bacteria 1266
70 Ga0395898_0002748 3300037466 Bacteria 20290
71 Ga0395898_0022403 3300037466 Bacteria 6398
72 Ga0395898_0859604 3300037466 Bacteria 846
73 Ga0395905_0253146 3300037471 Bacteria 1645
74 Ga0395901_0398865 3300038443 Bacteria 1413
75 Ga0439436_0000380 3300041404 Bacteria 11039
76 Ga0439436_0014516 3300041404 Bacteria 2375
77 Ga0439466_0027181 3300041411 Bacteria 1983
78 Ga0439465_0002264 3300041413 Bacteria 6321
79 Ga0451833_0053590 3300041491 Bacteria 1278
80 Ga0451837_0393195 3300041494 Bacteria 2321
81 Ga0439433_0015128 3300041999 Bacteria 1703
82 Ga0439442_002231 3300042002 Bacteria 3810
83 Ga0439442_004366 3300042002 Bacteria 2807
84 Ga0439448_0018605 3300042005 Bacteria 2132
85 Ga0439449_0001204 3300042007 Bacteria 10154
86 Ga0439449_0026670 3300042007 Bacteria 2156
87 Ga0439449_0094750 3300042007 Bacteria 1102
88 Ga0439455_0057595 3300042012 Bacteria 1025
89 Ga0439457_000269 3300042014 Bacteria 14293
90 Ga0439457_000994 3300042014 Bacteria 8543
91 Ga0439457_024906 3300042014 Bacteria 1325
92 Ga0439462_0005275 3300042015 Bacteria 3184
93 Ga0450894_000197 3300042131 Bacteria 10922
94 Ga0450896_000874 3300042133 Bacteria 3456
95 Ga0450899_000325 3300042135 Bacteria 5233
96 Ga0450903_000011 3300042138 Bacteria 34416
97 Ga0450906_000262 3300042145 Bacteria 10207
98 Ga0439458_0001175 3300042157 Bacteria 6653
99 Ga0439458_0023682 3300042157 Bacteria 1433
100 Ga0466969_0084126 3300044656 Bacteria 1514
101 Ga0466972_0005565 3300044658 Bacteria 6308
102 Ga0466972_0273450 3300044658 Bacteria 789
103 Ga0466965_0001033 3300044683 Bacteria 10780
104 Ga0466965_0270081 3300044683 Bacteria 916
105 Ga0466966_0000641 3300044684 Bacteria 22267
106 Ga0466961_0001001 3300044693 Bacteria 17438
107 Ga0466961_0070452 3300044693 Bacteria 2220
108 Ga0466963_0018307 3300044694 Bacteria 4376
109 Ga0466971_0000758 3300044719 Bacteria 12964
110 Ga0466971_0055822 3300044719 Bacteria 1781
111 Ga0466970_0001881 3300044765 Bacteria 10154
112 Ga0466970_0014810 3300044765 Bacteria 4009
113 Ga0466957_0000294 3300044842 Bacteria 24478
114 Ga0466957_0343350 3300044842 Bacteria 1011
115 Ga0466960_0001416 3300044901 Bacteria 8728
116 Ga0466959_0002183 3300045049 Bacteria 12443
117 Ga0466959_0448429 3300045049 Bacteria 875
118 Ga0466958_0001953 3300045836 Bacteria 10120
119 Ga0466958_0228689 3300045836 Bacteria 1187
120 Ga0466967_0005750 3300045976 Bacteria 8661
121 Ga0466967_0013165 3300045976 Bacteria 6376
122 Ga0466967_0038261 3300045976 Bacteria 4112
123 Ga0466967_0214019 3300045976 Bacteria 1829
124 Ga0466967_0834484 3300045976 Bacteria 916
125 Ga0495629_0002178 3300046459 Bacteria 15130
126 Ga0495629_0102688 3300046459 Bacteria 1994
127 Ga0495582_0019118 3300046473 Bacteria 3749
128 Ga0495662_0005775 3300046476 Bacteria 6192
129 Ga0495662_0016079 3300046476 Bacteria 3628
130 Ga0495596_0195071 3300046500 Bacteria 787
131 Ga0495606_0210825 3300046507 Bacteria 1100
132 Ga0495616_0080203 3300046513 Bacteria 1563
133 Ga0495620_0050272 3300046515 Bacteria 1779
134 Ga0495643_0049237 3300046522 Bacteria 2273
135 Ga0495648_0062037 3300046524 Bacteria 2216
136 Ga0495640_0002176 3300046533 Bacteria 15668
137 Ga0495609_0136756 3300046538 Bacteria 1047
138 Ga0495597_0008832 3300046542 Bacteria 5027
139 Ga0495667_0203637 3300046559 Bacteria 1266
140 Ga0495668_0098344 3300046616 Bacteria 1601
141 Ga0495625_0015579 3300046660 Bacteria 6014
142 Ga0495625_0039467 3300046660 Bacteria 3447
143 Ga0495657_0003453 3300046675 Bacteria 12888
144 Ga0495657_0024908 3300046675 Bacteria 4253
145 Ga0495613_0002915 3300046689 Bacteria 12815
146 Ga0495613_0553567 3300046689 Bacteria 769
147 Ga0495660_0039238 3300046810 Bacteria 2630
148 Ga0495604_0030160 3300047317 Bacteria 4310
149 Ga0495636_0036072 3300047318 Bacteria 2038
150 Ga0495636_0037976 3300047318 Bacteria 1990
151 Ga0495676_0121941 3300047321 Bacteria 1895
152 Ga0495683_0157135 3300047323 Bacteria 1054
153 Ga0495687_010512 3300047443 Bacteria 5070
154 Ga0495687_070975 3300047443 Bacteria 1396
155 Ga0495677_0206986 3300047445 Bacteria 763
156 Ga0495685_022215 3300047447 Bacteria 2183
157 Ga0495685_060728 3300047447 Bacteria 1274
158 Ga0495681_0003209 3300047470 Bacteria 11418
159 Ga0495686_0079806 3300047472 Bacteria 2001
160 Ga0495593_0028673 3300047673 Bacteria 3057
161 Ga0495614_0004400 3300048089 Bacteria 6353
162 Ga0495614_0017198 3300048089 Bacteria 3143
163 Ga0496102_0086639 3300048905 Bacteria 2893
164 Ga0496102_0465915 3300048905 Unclassified 1184
165 Ga0496103_0196052 3300048906 Bacteria 1299
166 Ga0496104_0011959 3300048907 Bacteria 7788
167 Ga0496105_0062579 3300048908 Bacteria 3071
168 Ga0496108_0027449 3300048911 Bacteria 4701
169 Ga0496108_0082620 3300048911 Bacteria 2724
170 Ga0496109_0068200 3300048912 Unclassified 3261
171 Ga0496109_0078991 3300048912 Bacteria 3030
172 Ga0496110_0015968 3300048913 Bacteria 6262
173 Ga0496111_0029290 3300048914 Unclassified 3910
174 Ga0496112_0648724 3300048915 Bacteria 985
175 Ga0496113_0112391 3300048916 Bacteria 2122
176 Ga0496114_0290455 3300048917 Bacteria 1443
177 Ga0501032_0079129 3300049569 Bacteria 2188
178 Ga0501032_0110955 3300049569 Bacteria 1815
179 Ga0501033_0008633 3300049570 Bacteria 7886
180 Ga0501033_0013106 3300049570 Bacteria 6318
181 Ga0501034_0016179 3300049571 Bacteria 7651
182 Ga0501034_0028975 3300049571 Bacteria 5631
183 Ga0501034_0219631 3300049571 Bacteria 1853
184 Ga0501034_0312213 3300049571 Bacteria 1506
185 Ga0501036_0002814 3300049572 Bacteria 13789
186 Ga0501036_0006162 3300049572 Bacteria 9729
187 Ga0501036_0237954 3300049572 Bacteria 1527
188 Ga0501036_0238805 3300049572 Bacteria 1524
189 Ga0501037_0013547 3300049573 Bacteria 6004
190 Ga0501037_0034052 3300049573 Bacteria 3761
191 Ga0501037_0264761 3300049573 Bacteria 1201
192 Ga0501038_0043592 3300049574 Bacteria 3901
193 Ga0501038_0050241 3300049574 Bacteria 3604
194 Ga0501038_0050630 3300049574 Bacteria 3588
195 Ga0501038_0079086 3300049574 Bacteria 2773
196 Ga0501038_0272384 3300049574 Bacteria 1334
197 Ga0501038_0320128 3300049574 Bacteria 1213
198 Ga0501039_0010640 3300049575 Bacteria 7008
199 Ga0501039_0718641 3300049575 Bacteria 781
200 Ga0501042_0040071 3300049578 Bacteria 3330
201 Ga0501043_0022127 3300049579 Bacteria 4988
202 Ga0501043_0028836 3300049579 Bacteria 4357
203 Ga0501043_0127752 3300049579 Bacteria 1993
204 Ga0501046_0186122 3300049580 Bacteria 1550
205 Ga0501046_0217937 3300049580 Bacteria 1414
206 Ga0501047_0003319 3300049581 Bacteria 15240
207 Ga0501047_0023235 3300049581 Bacteria 5953
208 Ga0501047_0032989 3300049581 Bacteria 4999
209 Ga0501047_0058578 3300049581 Bacteria 3720
210 Ga0501047_0536145 3300049581 Bacteria 995
211 Ga0501048_0004480 3300049582 Bacteria 10629
212 Ga0501048_0045017 3300049582 Bacteria 3153
213 Ga0501067_0282015 3300049583 Bacteria 925
214 Ga0501068_0031051 3300049584 Bacteria 3172
215 Ga0501068_0357797 3300049584 Bacteria 939
216 Ga0501069_0304419 3300049585 Bacteria 935
217 Ga0501070_0032061 3300049586 Bacteria 4399
218 Ga0501070_0112793 3300049586 Bacteria 2247
219 Ga0501070_0386725 3300049586 Bacteria 1133
220 Ga0501074_0017392 3300049590 Bacteria 5216
221 Ga0501080_0076258 3300049742 Bacteria 3118
222 Ga0501035_0014484 3300049822 Bacteria 7278
223 Ga0501035_0014510 3300049822 Bacteria 7272
224 Ga0501035_0262263 3300049822 Bacteria 1464
225 Ga0501044_0059890 3300049823 Bacteria 3900
226 Ga0501044_0132101 3300049823 Bacteria 2490
227 Ga0501044_0138271 3300049823 Bacteria 2425
228 Ga0501044_0659678 3300049823 Bacteria 934
229 nmdc:mga03n38_25144_c1 3300050490 Bacteria 2442
230 nmdc:mga06z11_1373_c1 3300050494 Bacteria 9014
231 nmdc:mga04h51_13527_c1 3300050495 Bacteria 2312
232 nmdc:mga07m45_32438_c1 3300050496 Bacteria 2897
233 Ga0500560_103867 3300053107 Bacteria 952
234 Ga0466962_0000263 3300061719 Bacteria 22192
235 Ga0466962_0124383 3300061719 Bacteria 1245
236 2547409309 2547132111 Bacteria 8013147
237 2554261219 2554235005 Bacteria 6457341
238 2585303325 2582581313 Bacteria 10042643
239 2643947246 2643221587 Bacteria 7586415
240 2644266727 2643221647 Bacteria 10741251
241 2644385937 2643221670 Bacteria 6497041
242 2644440652 2643221678 Bacteria 9540101
243 2644627805 2643221714 Bacteria 9015452
244 2691515340 2690315906 Bacteria 4517044
245 2739206319 2738543005 Bacteria 5278128
246 2775658177 2775506735 Bacteria 4556596
247 2784592269 2784132148 Bacteria 8627943
248 2785339308 2784746763 Bacteria 9783172
249 2785374156 2784746768 Bacteria 10036182
250 2786674393 2786546132 Bacteria 10419719
251 2808828534 2808606357 Bacteria 4466944
252 2808845681 2808606359 Bacteria 9866990
253 2808849779 2808606360 Bacteria 4404006
254 2808877630 2808606366 Bacteria 4415912
255 2808892747 2808606370 Bacteria 4942454
256 2808899086 2808606371 Bacteria 4251511
257 2808915486 2808606375 Bacteria 9466072
258 2809235913 2808606448 Bacteria 8656184
259 2811846263 2808606982 Bacteria 7791042
260 2812319760 2811994871 Bacteria 4497550
261 2812353932 2811994879 Bacteria 9313447
262 2852639124 2852635781 Bacteria 8251373
263 2862185898 2862178590 Bacteria 8583590
264 2862282765 2862281513 Bacteria 9621493
265 2862516720 2862507626 Bacteria 9425308
266 2863410643 2863404153 Bacteria 9672205
267 2867429201 2867428634 Bacteria 9590268
268 2875392381 2875391855 Bacteria 7600475
269 2877677322 2877676314 Bacteria 9512378
270 2895660270 2895660088 Bacteria 3782833
271 2912715628 2912715099 Bacteria 9460473
272 2912728440 2912723979 Bacteria 8557534
273 2919472973 2919468124 Bacteria 9133025
274 2928147141 2928142448 Bacteria 5288925
275 2945922203 2945920336 Bacteria 4501603
276 2946037536 2946037020 Bacteria 4900426
277 2946071763 2946064051 Bacteria 8957905
278 2946079537 2946072368 Bacteria 8999607
279 2947232649 2947224130 Bacteria 9938529
280 2953998805 2953998280 Bacteria 4812144
281 2954382059 2954380949 Bacteria 10050426
282 2954681013 2954673503 Bacteria 9685905
283 2954683144 2954682443 Bacteria 9862841
284 2954692872 2954691527 Bacteria 10720516
285 2954707945 2954701450 Bacteria 10834262
286 2954712501 2954711539 Bacteria 10867210
287 2954722456 2954721474 Bacteria 10456478
288 2954739401 2954731030 Bacteria 10243860
289 2954741334 2954740390 Bacteria 10229294
290 2954758229 2954749733 Bacteria 10366972
291 2954760351 2954759201 Bacteria 9358192
292 2974305569 2974302888 Bacteria 4369871
293 2990064390 2990059506 Bacteria 9321252
294 3006398662 3006393351 Bacteria 6615579
295 3006492875 3006486233 Bacteria 8157040
296 3006495764 3006493962 Bacteria 8825450
297 8008575575 8008574985 Bacteria 7815457
298 8023626568 8023623736 Bacteria 8593882
299 8048411253 8048406513 Bacteria 8936924
300 8054161508 8054160619 Bacteria 7783213
301 8056832324 8056829672 Bacteria 9045328
302 Ga0307408_100840007
303 JGI24739J22299_10087734
304 JGI24737J22298_10004072
305 JGI24738J21930_10060460
306 Ga0068868_100389848
307 Ga0068856_100349554
308 Ga0068856_100927561
309 Ga0068860_100405675
310 Ga0075368_10000679
311 Ga0075363_100032914
312 Ga0075367_10001005
313 Ga0075370_10010381
314 Ga0111539_10596073
315 Ga0105245_10502659
316 Ga0105243_10159398
317 Ga0157369_10127356
318 Ga0163162_10078490
319 Ga0163163_10492306
320 Ga0182008_10010771
321 Ga0182006_1063476
322 Ga0182007_10011069
323 Ga0183367_1016
324 Ga0207647_10169510
325 Ga0207667_10863730
326 Ga0207677_10468001
327 Ga0209371_1014180
328 Ga0209813_10011538
329 Ga0307517_10002470
330 Ga0307515_10001437
331 Ga0268256_1051249
332 Ga0307513_10308149
333 Ga0307408_100030053
334 Ga0307408_100031994
335 Ga0307408_100059707
336 Ga0307408_100161041
337 Ga0307508_10059278
338 Ga0307514_10078105
339 Ga0307516_10051507
340 Ga0307405_10004301
341 Ga0307405_10042534
342 Ga0307405_10119417
343 Ga0307405_10123002
344 Ga0307405_10137634
345 Ga0307413_10407116
346 Ga0307518_10002757
347 Ga0307518_10141788
348 Ga0307410_10010378
349 Ga0307406_10003336
350 Ga0307406_10015862
351 Ga0307407_10022387
352 Ga0307407_10030478
353 Ga0307407_10143488
354 Ga0307412_10029390
355 Ga0307412_10073271
356 Ga0307412_10112113
357 Ga0307409_100051000
358 Ga0307409_100090547
359 Ga0307409_100122253
360 Ga0307409_100728552
361 Ga0307416_100020966
362 Ga0307416_100183366
363 Ga0307411_10021469
364 Ga0307415_100002474
365 Ga0307415_100320831
366 Ga0307507_10027442
367 Ga0395899_0528352
368 Ga0395900_0026971
369 Ga0395900_0029940
370 Ga0395900_0437438
371 Ga0395898_0002748
372 Ga0395898_0022403
373 Ga0395898_0859604
374 Ga0395905_0253146
375 Ga0395901_0398865
376 Ga0439436_0000380
377 Ga0439436_0014516
378 Ga0439466_0027181
379 Ga0439465_0002264
380 Ga0451833_0053590
381 Ga0451837_0393195
382 Ga0439433_0015128
383 Ga0439442_002231
384 Ga0439442_004366
385 Ga0439448_0018605
386 Ga0439449_0001204
387 Ga0439449_0026670
388 Ga0439449_0094750
389 Ga0439455_0057595
390 Ga0439457_000269
391 Ga0439457_000994
392 Ga0439457_024906
393 Ga0439462_0005275
394 Ga0450894_000197
395 Ga0450896_000874
396 Ga0450899_000325
397 Ga0450903_000011
398 Ga0450906_000262
399 Ga0439458_0001175
400 Ga0439458_0023682
401 Ga0466969_0084126
402 Ga0466972_0005565
403 Ga0466972_0273450
404 Ga0466965_0001033
405 Ga0466965_0270081
406 Ga0466966_0000641
407 Ga0466961_0001001
408 Ga0466961_0070452
409 Ga0466963_0018307
410 Ga0466971_0000758
411 Ga0466971_0055822
412 Ga0466970_0001881
413 Ga0466970_0014810
414 Ga0466957_0000294
415 Ga0466957_0343350
416 Ga0466960_0001416
417 Ga0466959_0002183
418 Ga0466959_0448429
419 Ga0466958_0001953
420 Ga0466958_0228689
421 Ga0466967_0005750
422 Ga0466967_0013165
423 Ga0466967_0038261
424 Ga0466967_0214019
425 Ga0466967_0834484
426 Ga0495629_0002178
427 Ga0495629_0102688
428 Ga0495582_0019118
429 Ga0495662_0005775
430 Ga0495662_0016079
431 Ga0495596_0195071
432 Ga0495606_0210825
433 Ga0495616_0080203
434 Ga0495620_0050272
435 Ga0495643_0049237
436 Ga0495648_0062037
437 Ga0495640_0002176
438 Ga0495609_0136756
439 Ga0495597_0008832
440 Ga0495667_0203637
441 Ga0495668_0098344
442 Ga0495625_0015579
443 Ga0495625_0039467
444 Ga0495657_0003453
445 Ga0495657_0024908
446 Ga0495613_0002915
447 Ga0495613_0553567
448 Ga0495660_0039238
449 Ga0495604_0030160
450 Ga0495636_0036072
451 Ga0495636_0037976
452 Ga0495676_0121941
453 Ga0495683_0157135
454 Ga0495687_010512
455 Ga0495687_070975
456 Ga0495677_0206986
457 Ga0495685_022215
458 Ga0495685_060728
459 Ga0495681_0003209
460 Ga0495686_0079806
461 Ga0495593_0028673
462 Ga0495614_0004400
463 Ga0495614_0017198
464 Ga0496102_0086639
465 Ga0496102_0465915
466 Ga0496103_0196052
467 Ga0496104_0011959
468 Ga0496105_0062579
469 Ga0496108_0027449
470 Ga0496108_0082620
471 Ga0496109_0068200
472 Ga0496109_0078991
473 Ga0496110_0015968
474 Ga0496111_0029290
475 Ga0496112_0648724
476 Ga0496113_0112391
477 Ga0496114_0290455
478 Ga0501032_0079129
479 Ga0501032_0110955
480 Ga0501033_0008633
481 Ga0501033_0013106
482 Ga0501034_0016179
483 Ga0501034_0028975
484 Ga0501034_0219631
485 Ga0501034_0312213
486 Ga0501036_0002814
487 Ga0501036_0006162
488 Ga0501036_0237954
489 Ga0501036_0238805
490 Ga0501037_0013547
491 Ga0501037_0034052
492 Ga0501037_0264761
493 Ga0501038_0043592
494 Ga0501038_0050241
495 Ga0501038_0050630
496 Ga0501038_0079086
497 Ga0501038_0272384
498 Ga0501038_0320128
499 Ga0501039_0010640
500 Ga0501039_0718641
501 Ga0501042_0040071
502 Ga0501043_0022127
503 Ga0501043_0028836
504 Ga0501043_0127752
505 Ga0501046_0186122
506 Ga0501046_0217937
507 Ga0501047_0003319
508 Ga0501047_0023235
509 Ga0501047_0032989
510 Ga0501047_0058578
511 Ga0501047_0536145
512 Ga0501048_0004480
513 Ga0501048_0045017
514 Ga0501067_0282015
515 Ga0501068_0031051
516 Ga0501068_0357797
517 Ga0501069_0304419
518 Ga0501070_0032061
519 Ga0501070_0112793
520 Ga0501070_0386725
521 Ga0501074_0017392
522 Ga0501080_0076258
523 Ga0501035_0014484
524 Ga0501035_0014510
525 Ga0501035_0262263
526 Ga0501044_0059890
527 Ga0501044_0132101
528 Ga0501044_0138271
529 Ga0501044_0659678
530 nmdc:mga03n38_25144_c1
531 nmdc:mga06z11_1373_c1
532 nmdc:mga04h51_13527_c1
533 nmdc:mga07m45_32438_c1
534 Ga0500560_103867
535 Ga0466962_0000263
536 Ga0466962_0124383
537 2547409309
538 2554261219
539 2585303325
540 2643947246
541 2644266727
542 2644385937
543 2644440652
544 2644627805
545 2691515340
546 2739206319
547 2775658177
548 2784592269
549 2785339308
550 2785374156
551 2786674393
552 2808828534
553 2808845681
554 2808849779
555 2808877630
556 2808892747
557 2808899086
558 2808915486
559 2809235913
560 2811846263
561 2812319760
562 2812353932
563 2852639124
564 2862185898
565 2862282765
566 2862516720
567 2863410643
568 2867429201
569 2875392381
570 2877677322
571 2895660270
572 2912715628
573 2912728440
574 2919472973
575 2928147141
576 2945922203
577 2946037536
578 2946071763
579 2946079537
580 2947232649
581 2953998805
582 2954382059
583 2954681013
584 2954683144
585 2954692872
586 2954707945
587 2954712501
588 2954722456
589 2954739401
590 2954741334
591 2954758229
592 2954760351
593 2974305569
594 2990064390
595 3006398662
596 3006492875
597 3006495764
598 8008575575
599 8023626568
600 8048411253
601 8054161508
602 8056832324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

17

195

0.92

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

15

189

0.89

PF13242

Hydrolase_like

HAD-hyrolase-like

150

226

0.88

PF12710

HAD

haloacid dehalogenase-like hydrolase

17

186

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s6j-assembly3.cif.gz_D the crystal structure of a hydrolase from pseudomonas syringae 0.9462 2 214
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.945 1 214
3s6j-assembly2.cif.gz_F the crystal structure of a hydrolase from pseudomonas syringae 0.9393 2 214
3s6j-assembly2.cif.gz_B the crystal structure of a hydrolase from pseudomonas syringae 0.9338 2 214
3s6j-assembly3.cif.gz_C the crystal structure of a hydrolase from pseudomonas syringae 0.9338 4 214
ID Description Score Start End Superfamily
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9388 102 204 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9275 86 182 3.40.50.1000
af_A0A0R0KYK9_29_156_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.925 93 207 3.40.50.1000
3s6jB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9184 2 214 3.40.50.1000
4ex7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9057 2 215 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A3R9UDY3-F1-model_v4 HAD family hydrolase 1.001 1 218 GO:0005829
GO:0006281
GO:0008967
AF-A0A6I5ME82-F1-model_v4 deleted 1.001 1 130
AF-A0A124I0W5-F1-model_v4 HAD family hydrolase 1 1 218 GO:0005829
GO:0006281
GO:0008967
AF-A0A1Q5KSS7-F1-model_v4 HAD family hydrolase 0.9999 1 218 GO:0005829
GO:0006281
GO:0008967
AF-A0A1H5PSN1-F1-model_v4 Haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E 0.9996 1 218 GO:0005829
GO:0006281
GO:0008967

Map