F395837

General Info

Members Datasets Scaffolds Average Seq Length
301 179 602 172

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100057340|Ga0075428_1000573402
Length 197
Sequence MASRSDHKDARNRSTTTGAVDDAAEVPRDDGPADASTDEAADKRSAANADLLAELTEEKNALQDRLLRIAAEFDNYRKRVDRDRRDQADAAVASAVEDLLPIVDNLERALEAPAGEDADSYRQGVELIHRQMMDVLRRRGVTPIESVGTDFDPQVHQAVAHEASPEHREGEVMEEFRRGYKLGDRLLRPAMVKVAKA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
134 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
135 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
136 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
137 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
150 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
151 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
165 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.33
Rhizosphere 99.34
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100057340 3300006844 Bacteria 4264
2 SwRhRL2b_contig_3833844 2162886007 Bacteria 1520
3 Ga0065707_10002177 3300005295 Bacteria 5244
4 Ga0065707_10089685 3300005295 Bacteria 4299
5 Ga0070676_10034457 3300005328 Bacteria 2907
6 Ga0070677_10044415 3300005333 Bacteria 1768
7 Ga0070677_10046407 3300005333 Bacteria 1737
8 Ga0068869_100054341 3300005334 Bacteria 2915
9 Ga0070680_100285337 3300005336 Bacteria 1399
10 Ga0070680_100288099 3300005336 Bacteria 1392
11 Ga0070691_10067171 3300005341 Bacteria 1734
12 Ga0070687_100040985 3300005343 Bacteria 2337
13 Ga0070661_100285197 3300005344 Bacteria 1282
14 Ga0070668_100727080 3300005347 Unclassified 877
15 Ga0070669_100058091 3300005353 Bacteria 2839
16 Ga0070669_100100329 3300005353 Bacteria 2183
17 Ga0070669_100115736 3300005353 Bacteria 2040
18 Ga0070669_100986358 3300005353 Unclassified 722
19 Ga0070675_100002117 3300005354 Bacteria 14660
20 Ga0070675_100177055 3300005354 Bacteria 1842
21 Ga0070675_100270186 3300005354 Bacteria 1492
22 Ga0070675_100409520 3300005354 Bacteria 1211
23 Ga0070671_100081091 3300005355 Bacteria 2713
24 Ga0070671_100196480 3300005355 Bacteria 1710
25 Ga0070674_100078638 3300005356 Bacteria 2351
26 Ga0070673_100028749 3300005364 Bacteria 4138
27 Ga0070673_100068479 3300005364 Bacteria 2842
28 Ga0070688_100359455 3300005365 Bacteria 1068
29 Ga0070667_100306508 3300005367 Bacteria 1431
30 Ga0070667_100476798 3300005367 Bacteria 1142
31 Ga0070703_10105200 3300005406 Bacteria 1001
32 Ga0070701_10001406 3300005438 Bacteria 8919
33 Ga0070701_10063858 3300005438 Bacteria 1949
34 Ga0070701_10197763 3300005438 Bacteria 1186
35 Ga0070705_100000132 3300005440 Bacteria 43669
36 Ga0070705_100043013 3300005440 Bacteria 2586
37 Ga0070705_100068671 3300005440 Bacteria 2134
38 Ga0070705_100188409 3300005440 Bacteria 1404
39 Ga0070700_100025399 3300005441 Bacteria 3487
40 Ga0070700_100081489 3300005441 Bacteria 2091
41 Ga0070694_100000521 3300005444 Bacteria 21231
42 Ga0070694_100018861 3300005444 Bacteria 4383
43 Ga0070708_100256004 3300005445 Bacteria 1645
44 Ga0070678_100232979 3300005456 Bacteria 1536
45 Ga0070681_10008076 3300005458 Bacteria 10296
46 Ga0070681_10137640 3300005458 Unclassified 2372
47 Ga0068867_100005035 3300005459 Bacteria 9323
48 Ga0070707_100098210 3300005468 Bacteria 2836
49 Ga0070707_100685040 3300005468 Bacteria 988
50 Ga0070698_100002674 3300005471 Bacteria 19668
51 Ga0070698_100085825 3300005471 Bacteria 3134
52 Ga0070699_100002887 3300005518 Bacteria 15304
53 Ga0070699_100020370 3300005518 Bacteria 5719
54 Ga0070679_100058858 3300005530 Bacteria 3829
55 Ga0070679_100142733 3300005530 Bacteria 2373
56 Ga0070679_100238400 3300005530 Unclassified 1777
57 Ga0070679_100383078 3300005530 Bacteria 1353
58 Ga0070697_100052219 3300005536 Bacteria 3321
59 Ga0070672_100013620 3300005543 Bacteria 5749
60 Ga0070672_100341155 3300005543 Bacteria 1276
61 Ga0070672_100665912 3300005543 Bacteria 910
62 Ga0070686_100088887 3300005544 Bacteria 2063
63 Ga0070686_100569160 3300005544 Bacteria 889
64 Ga0070695_100000378 3300005545 Bacteria 22911
65 Ga0070695_100292153 3300005545 Bacteria 1202
66 Ga0070695_100672183 3300005545 Bacteria 819
67 Ga0070695_100750689 3300005545 Bacteria 778
68 Ga0070696_100000507 3300005546 Bacteria 24594
69 Ga0070696_100003050 3300005546 Bacteria 11126
70 Ga0070696_100081735 3300005546 Bacteria 2289
71 Ga0070696_100208468 3300005546 Bacteria 1462
72 Ga0070704_100124152 3300005549 Bacteria 1989
73 Ga0070704_100183815 3300005549 Bacteria 1674
74 Ga0070704_100506283 3300005549 Bacteria 1049
75 Ga0070704_100747959 3300005549 Bacteria 870
76 Ga0068855_100043248 3300005563 Bacteria 5337
77 Ga0068855_101071420 3300005563 Bacteria 844
78 Ga0070664_100139771 3300005564 Bacteria 2132
79 Ga0068856_100763323 3300005614 Bacteria 987
80 Ga0070702_100003001 3300005615 Bacteria 7461
81 Ga0070702_100205858 3300005615 Bacteria 1306
82 Ga0068852_100458525 3300005616 Bacteria 1263
83 Ga0068852_101015608 3300005616 Bacteria 848
84 Ga0068859_100689171 3300005617 Bacteria 1113
85 Ga0068859_100825545 3300005617 Bacteria 1014
86 Ga0068859_101512532 3300005617 Bacteria 741
87 Ga0068864_100349011 3300005618 Bacteria 1396
88 Ga0068864_100630366 3300005618 Bacteria 1043
89 Ga0068864_100839444 3300005618 Bacteria 905
90 Ga0068861_100211257 3300005719 Bacteria 1635
91 Ga0068861_100221732 3300005719 Bacteria 1599
92 Ga0068861_100402011 3300005719 Bacteria 1216
93 Ga0068861_101004191 3300005719 Bacteria 797
94 Ga0068870_10178197 3300005840 Bacteria 1274
95 Ga0068863_100238356 3300005841 Bacteria 1756
96 Ga0068863_100286345 3300005841 Bacteria 1597
97 Ga0068863_100702921 3300005841 Bacteria 1005
98 Ga0068863_100795365 3300005841 Bacteria 943
99 Ga0068858_100064367 3300005842 Bacteria 3394
100 Ga0068858_100284731 3300005842 Bacteria 1574
101 Ga0068858_100520535 3300005842 Bacteria 1150
102 Ga0068860_100242712 3300005843 Bacteria 1753
103 Ga0068860_100354737 3300005843 Bacteria 1444
104 Ga0068860_100401515 3300005843 Bacteria 1356
105 Ga0081539_10226689 3300005985 Bacteria 846
106 Ga0075432_10069923 3300006058 Bacteria 1260
107 Ga0097621_100928067 3300006237 Bacteria 812
108 Ga0068871_100885820 3300006358 Bacteria 827
109 Ga0068871_101023202 3300006358 Bacteria 770
110 Ga0075428_100003168 3300006844 Bacteria 17978
111 Ga0075430_100014314 3300006846 Bacteria 6760
112 Ga0075431_100007039 3300006847 Bacteria 11171
113 Ga0075433_10034640 3300006852 Bacteria 4338
114 Ga0075433_10069541 3300006852 Bacteria 3092
115 Ga0075434_100000456 3300006871 Bacteria 30450
116 Ga0075434_100003068 3300006871 Bacteria 14873
117 Ga0075434_100073985 3300006871 Bacteria 3400
118 Ga0075429_100045965 3300006880 Bacteria 3798
119 Ga0068865_100729396 3300006881 Unclassified 849
120 Ga0097620_100689184 3300006931 Bacteria 1113
121 Ga0097620_100825396 3300006931 Bacteria 1014
122 Ga0097620_101512092 3300006931 Bacteria 741
123 Ga0075435_100099291 3300007076 Bacteria 2411
124 Ga0075435_100776628 3300007076 Bacteria 834
125 Ga0105245_10277968 3300009098 Bacteria 1635
126 Ga0114129_10006750 3300009147 Bacteria 16297
127 Ga0114129_10309542 3300009147 Bacteria 2103
128 Ga0114129_10536063 3300009147 Bacteria 1524
129 Ga0105243_10015349 3300009148 Bacteria 5794
130 Ga0105243_10584764 3300009148 Bacteria 1072
131 Ga0105243_11585861 3300009148 Bacteria 681
132 Ga0105242_10083679 3300009176 Bacteria 2673
133 Ga0105242_10273080 3300009176 Bacteria 1532
134 Ga0105248_10688472 3300009177 Bacteria 1153
135 Ga0105248_10872835 3300009177 Bacteria 1016
136 Ga0105238_10325168 3300009551 Bacteria 1524
137 Ga0105249_10114902 3300009553 Bacteria 2549
138 Ga0105246_10042240 3300011119 Bacteria 3087
139 Ga0157370_10053854 3300013104 Bacteria 3836
140 Ga0157378_10546864 3300013297 Bacteria 1163
141 Ga0157375_10167693 3300013308 Bacteria 2342
142 Ga0163163_10015598 3300014325 Bacteria 7028
143 Ga0163163_10020767 3300014325 Bacteria 6191
144 Ga0163163_10175694 3300014325 Bacteria 2188
145 Ga0157380_10004436 3300014326 Bacteria 9721
146 Ga0157380_10004747 3300014326 Bacteria 9460
147 Ga0157380_10067016 3300014326 Bacteria 2889
148 Ga0157380_10216507 3300014326 Bacteria 1711
149 Ga0157377_10865627 3300014745 Bacteria 672
150 Ga0157376_11379198 3300014969 Bacteria 736
151 Ga0207682_10012888 3300025893 Bacteria 3260
152 Ga0207682_10159852 3300025893 Bacteria 1020
153 Ga0207688_10273688 3300025901 Bacteria 1027
154 Ga0207645_10005300 3300025907 Bacteria 9385
155 Ga0207645_10408268 3300025907 Bacteria 914
156 Ga0207643_10124128 3300025908 Bacteria 1532
157 Ga0207643_10232363 3300025908 Bacteria 1131
158 Ga0207643_10537763 3300025908 Bacteria 749
159 Ga0207660_10138887 3300025917 Bacteria 1856
160 Ga0207660_10177569 3300025917 Bacteria 1652
161 Ga0207657_10033015 3300025919 Bacteria 4669
162 Ga0207649_10156066 3300025920 Bacteria 1577
163 Ga0207652_10050367 3300025921 Bacteria 3568
164 Ga0207652_10060557 3300025921 Bacteria 3266
165 Ga0207652_10081033 3300025921 Bacteria 2839
166 Ga0207646_10091314 3300025922 Bacteria 2726
167 Ga0207681_10049719 3300025923 Bacteria 2835
168 Ga0207681_10060772 3300025923 Bacteria 2595
169 Ga0207681_10418826 3300025923 Bacteria 1085
170 Ga0207681_10794471 3300025923 Bacteria 790
171 Ga0207694_10246032 3300025924 Bacteria 1462
172 Ga0207650_10028967 3300025925 Bacteria 3976
173 Ga0207650_11208809 3300025925 Bacteria 643
174 Ga0207659_10002724 3300025926 Bacteria 10535
175 Ga0207659_10482871 3300025926 Bacteria 1047
176 Ga0207687_10490647 3300025927 Bacteria 1024
177 Ga0207644_10261015 3300025931 Bacteria 1385
178 Ga0207644_10450635 3300025931 Bacteria 1057
179 Ga0207706_10206623 3300025933 Bacteria 1722
180 Ga0207686_10031578 3300025934 Bacteria 3146
181 Ga0207686_10072158 3300025934 Bacteria 2224
182 Ga0207709_10025571 3300025935 Bacteria 3382
183 Ga0207709_10149215 3300025935 Bacteria 1617
184 Ga0207669_10031918 3300025937 Bacteria 2950
185 Ga0207669_10192579 3300025937 Bacteria 1472
186 Ga0207704_10647449 3300025938 Unclassified 870
187 Ga0207691_10019667 3300025940 Bacteria 6387
188 Ga0207691_10192460 3300025940 Bacteria 1778
189 Ga0207711_10549130 3300025941 Bacteria 1078
190 Ga0207689_10031553 3300025942 Bacteria 4410
191 Ga0207661_10403320 3300025944 Bacteria 1240
192 Ga0207679_10096166 3300025945 Bacteria 2304
193 Ga0207667_10096659 3300025949 Bacteria 3048
194 Ga0207667_10974616 3300025949 Bacteria 836
195 Ga0207651_10039969 3300025960 Bacteria 3098
196 Ga0207651_10180399 3300025960 Unclassified 1675
197 Ga0207712_10307360 3300025961 Bacteria 1304
198 Ga0207712_11022258 3300025961 Unclassified 734
199 Ga0207658_10471408 3300025986 Bacteria 1114
200 Ga0207658_10507024 3300025986 Bacteria 1075
201 Ga0207677_10149507 3300026023 Bacteria 1800
202 Ga0207703_10704938 3300026035 Bacteria 960
203 Ga0207639_11194075 3300026041 Bacteria 714
204 Ga0207708_10224478 3300026075 Bacteria 1506
205 Ga0207702_10600545 3300026078 Bacteria 1080
206 Ga0207641_10141811 3300026088 Bacteria 2169
207 Ga0207641_10612233 3300026088 Bacteria 1067
208 Ga0207648_10002329 3300026089 Bacteria 20499
209 Ga0207676_10615633 3300026095 Bacteria 1044
210 Ga0207675_100047512 3300026118 Bacteria 4007
211 Ga0207675_100336745 3300026118 Bacteria 1476
212 Ga0207683_10201756 3300026121 Bacteria 1808
213 Ga0207698_10288473 3300026142 Bacteria 1522
214 Ga0268266_10861392 3300028379 Bacteria 876
215 Ga0268264_10236948 3300028381 Bacteria 1688
216 Ga0268264_10315398 3300028381 Bacteria 1477
217 Ga0268264_10413045 3300028381 Bacteria 1300
218 Ga0307405_10712800 3300031731 Bacteria 832
219 Ga0307410_10461086 3300031852 Bacteria 1039
220 Ga0307407_10028269 3300031903 Bacteria 2996
221 Ga0307412_10006507 3300031911 Bacteria 6609
222 Ga0307412_10577991 3300031911 Bacteria 948
223 Ga0307409_100016848 3300031995 Bacteria 4850
224 Ga0307409_100018819 3300031995 Bacteria 4658
225 Ga0307409_100160405 3300031995 Bacteria 1966
226 Ga0307416_100006065 3300032002 Bacteria 7527
227 Ga0307416_100120096 3300032002 Bacteria 2340
228 Ga0307414_10262121 3300032004 Bacteria 1443
229 Ga0307411_10032222 3300032005 Bacteria 3236
230 Ga0307411_10250191 3300032005 Bacteria 1393
231 Ga0307411_10275776 3300032005 Bacteria 1336
232 Ga0307415_100072356 3300032126 Bacteria 2428
233 Ga0373937_0530084 3300036401 Bacteria 1119
234 Ga0395898_0653762 3300037466 Bacteria 994
235 Ga0395901_0787910 3300038443 Bacteria 941
236 Ga0451804_0885900 3300041463 Unclassified 641
237 Ga0451853_0273308 3300041512 Bacteria 2146
238 Ga0450920_020931 3300042122 Bacteria 1262
239 Ga0450894_014729 3300042131 Bacteria 1033
240 Ga0450908_055931 3300042184 Bacteria 689
241 Ga0439435_0006635 3300042436 Bacteria 2606
242 Ga0439460_0043288 3300042461 Bacteria 1330
243 Ga0451577_0217183 3300042876 Bacteria 1728
244 Ga0451577_0229051 3300042876 Bacteria 1680
245 Ga0451576_0029685 3300045051 Bacteria 5849
246 Ga0451576_0067876 3300045051 Unclassified 3711
247 Ga0451576_0267044 3300045051 Bacteria 1789
248 Ga0466967_0106492 3300045976 Bacteria 2570
249 Ga0495584_0111306 3300046491 Bacteria 1385
250 Ga0495584_0261393 3300046491 Bacteria 880
251 Ga0495643_0011852 3300046522 Bacteria 5287
252 Ga0495642_0037418 3300046528 Bacteria 1963
253 Ga0495642_0070829 3300046528 Bacteria 1458
254 Ga0495642_0220911 3300046528 Bacteria 827
255 Ga0495609_0108512 3300046538 Bacteria 1199
256 Ga0495621_0000909 3300046539 Bacteria 7512
257 Ga0495621_0025421 3300046539 Bacteria 1989
258 Ga0495621_0041003 3300046539 Bacteria 1624
259 Ga0495621_0065646 3300046539 Bacteria 1326
260 Ga0495656_0162949 3300046615 Bacteria 1085
261 Ga0495659_0002543 3300046664 Bacteria 5882
262 Ga0495659_0035409 3300046664 Bacteria 1759
263 Ga0495659_0088725 3300046664 Bacteria 1184
264 Ga0495669_0043335 3300046684 Bacteria 2003
265 Ga0495669_0370276 3300046684 Bacteria 693
266 Ga0495636_0015392 3300047318 Bacteria 3048
267 Ga0495636_0172418 3300047318 Bacteria 979
268 Ga0495685_044513 3300047447 Bacteria 1513
269 Ga0501292_041110 3300049515 Bacteria 799
270 Ga0501036_1257034 3300049572 Bacteria 602
271 Ga0501038_0294850 3300049574 Unclassified 1274
272 Ga0501039_0072435 3300049575 Bacteria 2677
273 Ga0501040_0211374 3300049576 Bacteria 1379
274 Ga0501042_0006920 3300049578 Bacteria 7401
275 Ga0501046_0096340 3300049580 Bacteria 2273
276 Ga0501048_0016095 3300049582 Bacteria 5515
277 Ga0501071_0385807 3300049587 Bacteria 1069
278 Ga0501072_0117392 3300049588 Bacteria 2119
279 Ga0501073_0112592 3300049589 Bacteria 1888
280 Ga0501074_0050455 3300049590 Bacteria 3004
281 Ga0501075_0071180 3300049591 Bacteria 2628
282 Ga0501249_139358 3300049679 Bacteria 603
283 Ga0501259_122488 3300049688 Bacteria 620
284 Ga0501079_0113820 3300049741 Bacteria 2103
285 Ga0501080_0811830 3300049742 Bacteria 820
286 Ga0501081_0077266 3300049743 Bacteria 2326
287 Ga0501045_0118686 3300049824 Bacteria 1963
288 nmdc:mga05p37_186145_c1 3300050507 Bacteria 2524
289 nmdc:mga05p37_3651_c1 3300050507 Bacteria 17997
290 nmdc:mga05p37_996426_c1 3300050507 Bacteria 891
291 nmdc:mga09592_48028_c1 3300050508 Bacteria 2966
292 nmdc:mga0qj67_18168_c1 3300050509 Bacteria 5358
293 nmdc:mga06r32_36142_c1 3300050510 Bacteria 4666
294 nmdc:mga0n895_27945_c1 3300050512 Bacteria 5361
295 nmdc:mga0rr50_11294_c1 3300050513 Bacteria 5710
296 nmdc:mga0rr50_24806_c1 3300050513 Bacteria 4159
297 nmdc:mga08x19_218859_c1 3300050514 Bacteria 1308
298 nmdc:mga0a205_106762_c1 3300050515 Bacteria 2698
299 nmdc:mga0a205_191419_c1 3300050515 Bacteria 1938
300 Ga0501084_0101094 3300054114 Bacteria 2421
301 Ga0530510_0013281 3300061734 Bacteria 5790
302 Ga0075428_100057340
303 SwRhRL2b_contig_3833844
304 Ga0065707_10002177
305 Ga0065707_10089685
306 Ga0070676_10034457
307 Ga0070677_10044415
308 Ga0070677_10046407
309 Ga0068869_100054341
310 Ga0070680_100285337
311 Ga0070680_100288099
312 Ga0070691_10067171
313 Ga0070687_100040985
314 Ga0070661_100285197
315 Ga0070668_100727080
316 Ga0070669_100058091
317 Ga0070669_100100329
318 Ga0070669_100115736
319 Ga0070669_100986358
320 Ga0070675_100002117
321 Ga0070675_100177055
322 Ga0070675_100270186
323 Ga0070675_100409520
324 Ga0070671_100081091
325 Ga0070671_100196480
326 Ga0070674_100078638
327 Ga0070673_100028749
328 Ga0070673_100068479
329 Ga0070688_100359455
330 Ga0070667_100306508
331 Ga0070667_100476798
332 Ga0070703_10105200
333 Ga0070701_10001406
334 Ga0070701_10063858
335 Ga0070701_10197763
336 Ga0070705_100000132
337 Ga0070705_100043013
338 Ga0070705_100068671
339 Ga0070705_100188409
340 Ga0070700_100025399
341 Ga0070700_100081489
342 Ga0070694_100000521
343 Ga0070694_100018861
344 Ga0070708_100256004
345 Ga0070678_100232979
346 Ga0070681_10008076
347 Ga0070681_10137640
348 Ga0068867_100005035
349 Ga0070707_100098210
350 Ga0070707_100685040
351 Ga0070698_100002674
352 Ga0070698_100085825
353 Ga0070699_100002887
354 Ga0070699_100020370
355 Ga0070679_100058858
356 Ga0070679_100142733
357 Ga0070679_100238400
358 Ga0070679_100383078
359 Ga0070697_100052219
360 Ga0070672_100013620
361 Ga0070672_100341155
362 Ga0070672_100665912
363 Ga0070686_100088887
364 Ga0070686_100569160
365 Ga0070695_100000378
366 Ga0070695_100292153
367 Ga0070695_100672183
368 Ga0070695_100750689
369 Ga0070696_100000507
370 Ga0070696_100003050
371 Ga0070696_100081735
372 Ga0070696_100208468
373 Ga0070704_100124152
374 Ga0070704_100183815
375 Ga0070704_100506283
376 Ga0070704_100747959
377 Ga0068855_100043248
378 Ga0068855_101071420
379 Ga0070664_100139771
380 Ga0068856_100763323
381 Ga0070702_100003001
382 Ga0070702_100205858
383 Ga0068852_100458525
384 Ga0068852_101015608
385 Ga0068859_100689171
386 Ga0068859_100825545
387 Ga0068859_101512532
388 Ga0068864_100349011
389 Ga0068864_100630366
390 Ga0068864_100839444
391 Ga0068861_100211257
392 Ga0068861_100221732
393 Ga0068861_100402011
394 Ga0068861_101004191
395 Ga0068870_10178197
396 Ga0068863_100238356
397 Ga0068863_100286345
398 Ga0068863_100702921
399 Ga0068863_100795365
400 Ga0068858_100064367
401 Ga0068858_100284731
402 Ga0068858_100520535
403 Ga0068860_100242712
404 Ga0068860_100354737
405 Ga0068860_100401515
406 Ga0081539_10226689
407 Ga0075432_10069923
408 Ga0097621_100928067
409 Ga0068871_100885820
410 Ga0068871_101023202
411 Ga0075428_100003168
412 Ga0075430_100014314
413 Ga0075431_100007039
414 Ga0075433_10034640
415 Ga0075433_10069541
416 Ga0075434_100000456
417 Ga0075434_100003068
418 Ga0075434_100073985
419 Ga0075429_100045965
420 Ga0068865_100729396
421 Ga0097620_100689184
422 Ga0097620_100825396
423 Ga0097620_101512092
424 Ga0075435_100099291
425 Ga0075435_100776628
426 Ga0105245_10277968
427 Ga0114129_10006750
428 Ga0114129_10309542
429 Ga0114129_10536063
430 Ga0105243_10015349
431 Ga0105243_10584764
432 Ga0105243_11585861
433 Ga0105242_10083679
434 Ga0105242_10273080
435 Ga0105248_10688472
436 Ga0105248_10872835
437 Ga0105238_10325168
438 Ga0105249_10114902
439 Ga0105246_10042240
440 Ga0157370_10053854
441 Ga0157378_10546864
442 Ga0157375_10167693
443 Ga0163163_10015598
444 Ga0163163_10020767
445 Ga0163163_10175694
446 Ga0157380_10004436
447 Ga0157380_10004747
448 Ga0157380_10067016
449 Ga0157380_10216507
450 Ga0157377_10865627
451 Ga0157376_11379198
452 Ga0207682_10012888
453 Ga0207682_10159852
454 Ga0207688_10273688
455 Ga0207645_10005300
456 Ga0207645_10408268
457 Ga0207643_10124128
458 Ga0207643_10232363
459 Ga0207643_10537763
460 Ga0207660_10138887
461 Ga0207660_10177569
462 Ga0207657_10033015
463 Ga0207649_10156066
464 Ga0207652_10050367
465 Ga0207652_10060557
466 Ga0207652_10081033
467 Ga0207646_10091314
468 Ga0207681_10049719
469 Ga0207681_10060772
470 Ga0207681_10418826
471 Ga0207681_10794471
472 Ga0207694_10246032
473 Ga0207650_10028967
474 Ga0207650_11208809
475 Ga0207659_10002724
476 Ga0207659_10482871
477 Ga0207687_10490647
478 Ga0207644_10261015
479 Ga0207644_10450635
480 Ga0207706_10206623
481 Ga0207686_10031578
482 Ga0207686_10072158
483 Ga0207709_10025571
484 Ga0207709_10149215
485 Ga0207669_10031918
486 Ga0207669_10192579
487 Ga0207704_10647449
488 Ga0207691_10019667
489 Ga0207691_10192460
490 Ga0207711_10549130
491 Ga0207689_10031553
492 Ga0207661_10403320
493 Ga0207679_10096166
494 Ga0207667_10096659
495 Ga0207667_10974616
496 Ga0207651_10039969
497 Ga0207651_10180399
498 Ga0207712_10307360
499 Ga0207712_11022258
500 Ga0207658_10471408
501 Ga0207658_10507024
502 Ga0207677_10149507
503 Ga0207703_10704938
504 Ga0207639_11194075
505 Ga0207708_10224478
506 Ga0207702_10600545
507 Ga0207641_10141811
508 Ga0207641_10612233
509 Ga0207648_10002329
510 Ga0207676_10615633
511 Ga0207675_100047512
512 Ga0207675_100336745
513 Ga0207683_10201756
514 Ga0207698_10288473
515 Ga0268266_10861392
516 Ga0268264_10236948
517 Ga0268264_10315398
518 Ga0268264_10413045
519 Ga0307405_10712800
520 Ga0307410_10461086
521 Ga0307407_10028269
522 Ga0307412_10006507
523 Ga0307412_10577991
524 Ga0307409_100016848
525 Ga0307409_100018819
526 Ga0307409_100160405
527 Ga0307416_100006065
528 Ga0307416_100120096
529 Ga0307414_10262121
530 Ga0307411_10032222
531 Ga0307411_10250191
532 Ga0307411_10275776
533 Ga0307415_100072356
534 Ga0373937_0530084
535 Ga0395898_0653762
536 Ga0395901_0787910
537 Ga0451804_0885900
538 Ga0451853_0273308
539 Ga0450920_020931
540 Ga0450894_014729
541 Ga0450908_055931
542 Ga0439435_0006635
543 Ga0439460_0043288
544 Ga0451577_0217183
545 Ga0451577_0229051
546 Ga0451576_0029685
547 Ga0451576_0067876
548 Ga0451576_0267044
549 Ga0466967_0106492
550 Ga0495584_0111306
551 Ga0495584_0261393
552 Ga0495643_0011852
553 Ga0495642_0037418
554 Ga0495642_0070829
555 Ga0495642_0220911
556 Ga0495609_0108512
557 Ga0495621_0000909
558 Ga0495621_0025421
559 Ga0495621_0041003
560 Ga0495621_0065646
561 Ga0495656_0162949
562 Ga0495659_0002543
563 Ga0495659_0035409
564 Ga0495659_0088725
565 Ga0495669_0043335
566 Ga0495669_0370276
567 Ga0495636_0015392
568 Ga0495636_0172418
569 Ga0495685_044513
570 Ga0501292_041110
571 Ga0501036_1257034
572 Ga0501038_0294850
573 Ga0501039_0072435
574 Ga0501040_0211374
575 Ga0501042_0006920
576 Ga0501046_0096340
577 Ga0501048_0016095
578 Ga0501071_0385807
579 Ga0501072_0117392
580 Ga0501073_0112592
581 Ga0501074_0050455
582 Ga0501075_0071180
583 Ga0501249_139358
584 Ga0501259_122488
585 Ga0501079_0113820
586 Ga0501080_0811830
587 Ga0501081_0077266
588 Ga0501045_0118686
589 nmdc:mga05p37_186145_c1
590 nmdc:mga05p37_3651_c1
591 nmdc:mga05p37_996426_c1
592 nmdc:mga09592_48028_c1
593 nmdc:mga0qj67_18168_c1
594 nmdc:mga06r32_36142_c1
595 nmdc:mga0n895_27945_c1
596 nmdc:mga0rr50_11294_c1
597 nmdc:mga0rr50_24806_c1
598 nmdc:mga08x19_218859_c1
599 nmdc:mga0a205_106762_c1
600 nmdc:mga0a205_191419_c1
601 Ga0501084_0101094
602 Ga0530510_0013281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01025

GrpE

GrpE

30

196

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e8r-assembly2.cif.gz_B structure of the snx32 px domain in complex with chlamydial protein ince in space group i121 0.8018 76 115
4err-assembly1.cif.gz_A 1.55 angstrom crystal structure of the four helical bundle membrane localization domain (4hbm) of the vibrio vulnificus martx effector domain duf5 0.7649 70 115
3a6m-assembly1.cif.gz_B crystal structure of grpe from thermus thermophilus hb8 0.7564 29 174
4v6c-assembly2.cif.gz_CT crystal structure of the e. coli 70s ribosome in an intermediate state of ratcheting 0.7424 59 108
7mt3-assembly1.cif.gz_t mtb 70s with p/e trna 0.738 58 115
ID Description Score Start End Superfamily
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 1.002 117 171 2.30.22.10
af_Q2FXZ1_152_207_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9849 117 171 2.30.22.10
af_A0A1D6EAQ0_210_272_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9795 117 173 2.30.22.10
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.967 117 171 2.30.22.10
af_Q99LP6_159_215_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9668 117 173 2.30.22.10
ID Description Score Start End GO Terms
AF-A0A1F2T6U1-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9702 33 174 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A645D385-F1-model_v4 Protein GrpE 0.9652 29 173 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A1F2T6U1-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9571 33 174 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A3N9NA14-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9565 29 173 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-I8RD90-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.954 29 174 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087

Map