F395767

General Info

Members Datasets Scaffolds Average Seq Length
301 107 602 178

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100421013|Ga0070708_1004210132
Length 184
Sequence MTEPLHLSAKAERQYQLQDYGPRPTINGVAIVDLKRFADDGGSMTELARLDGGQLQASGLAGFTLRQINYSEVEPGAIKAFHLHSRQTDVWYVPPSDRCLMILVDVRAGSPTEGTSQRLTLGAGASRLVRIPPGVAHGVRNLGTETARLIYFVDQHFTTDGATCDEGRLPWDYLGPEVWEVARG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
55 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
56 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
57 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
58 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
59 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
75 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
76 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
77 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
78 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
79 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
90 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
91 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
92 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
95 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
103 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
104 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 2.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100421013 3300005445 Bacteria 1260
2 Ga0065707_10100113 3300005295 Bacteria 2954
3 Ga0065707_10209050 3300005295 Unclassified 1274
4 Ga0065707_10698414 3300005295 Bacteria 640
5 Ga0070689_100302242 3300005340 Bacteria 1332
6 Ga0070692_10149031 3300005345 Bacteria 1331
7 Ga0070701_10073306 3300005438 Bacteria 1836
8 Ga0070705_100132734 3300005440 Bacteria 1627
9 Ga0070705_100250119 3300005440 Bacteria 1244
10 Ga0070694_100310482 3300005444 Bacteria 1211
11 Ga0070708_100018280 3300005445 Bacteria 5866
12 Ga0070708_100035921 3300005445 Bacteria 4320
13 Ga0070708_100051860 3300005445 Bacteria 3636
14 Ga0070708_100141280 3300005445 Bacteria 2233
15 Ga0070708_100382893 3300005445 Bacteria 1326
16 Ga0070708_100713706 3300005445 Bacteria 943
17 Ga0068867_100601742 3300005459 Bacteria 959
18 Ga0070706_100013416 3300005467 Bacteria 7575
19 Ga0070706_100155023 3300005467 Bacteria 2138
20 Ga0070706_100222130 3300005467 Bacteria 1763
21 Ga0070706_100343550 3300005467 Bacteria 1391
22 Ga0070707_100002450 3300005468 Bacteria 17677
23 Ga0070707_100049731 3300005468 Bacteria 4018
24 Ga0070707_100132297 3300005468 Bacteria 2426
25 Ga0070707_100340907 3300005468 Bacteria 1456
26 Ga0070707_100628090 3300005468 Bacteria 1037
27 Ga0070707_100776931 3300005468 Bacteria 921
28 Ga0070698_100007324 3300005471 Bacteria 11944
29 Ga0070699_100002872 3300005518 Bacteria 15355
30 Ga0070699_100028821 3300005518 Bacteria 4787
31 Ga0070699_100063686 3300005518 Bacteria 3197
32 Ga0070699_100205207 3300005518 Bacteria 1753
33 Ga0070699_100422158 3300005518 Bacteria 1207
34 Ga0070697_100001072 3300005536 Bacteria 20653
35 Ga0070697_100011661 3300005536 Bacteria 6870
36 Ga0070697_100156193 3300005536 Bacteria 1925
37 Ga0070697_100166834 3300005536 Bacteria 1862
38 Ga0070697_100167305 3300005536 Bacteria 1859
39 Ga0070697_100372088 3300005536 Bacteria 1236
40 Ga0070697_100535244 3300005536 Bacteria 1026
41 Ga0070696_100153662 3300005546 Bacteria 1691
42 Ga0070704_100025551 3300005549 Bacteria 3890
43 Ga0068870_10320903 3300005840 Bacteria 984
44 Ga0068863_100059773 3300005841 Bacteria 3606
45 Ga0068860_100250078 3300005843 Bacteria 1726
46 Ga0068862_100370412 3300005844 Bacteria 1333
47 Ga0081455_10097083 3300005937 Bacteria 2375
48 Ga0081538_10010550 3300005981 Bacteria 7570
49 Ga0081540_1058582 3300005983 Bacteria 1854
50 Ga0075432_10049560 3300006058 Bacteria 1480
51 Ga0075428_100007893 3300006844 Bacteria 11799
52 Ga0075428_100008824 3300006844 Bacteria 11187
53 Ga0075428_100048603 3300006844 Bacteria 4655
54 Ga0075428_100184213 3300006844 Bacteria 2259
55 Ga0075428_100188615 3300006844 Bacteria 2230
56 Ga0075428_100208520 3300006844 Bacteria 2112
57 Ga0075428_100227981 3300006844 Bacteria 2011
58 Ga0075428_100445578 3300006844 Bacteria 1387
59 Ga0075428_101183648 3300006844 Bacteria 806
60 Ga0075430_100002531 3300006846 Bacteria 15234
61 Ga0075430_100028973 3300006846 Bacteria 4700
62 Ga0075430_100093236 3300006846 Bacteria 2517
63 Ga0075430_100198221 3300006846 Bacteria 1668
64 Ga0075431_100000016 3300006847 Bacteria 85421
65 Ga0075431_100000063 3300006847 Bacteria 61188
66 Ga0075431_100000691 3300006847 Bacteria 29037
67 Ga0075431_100000906 3300006847 Bacteria 26122
68 Ga0075431_100003499 3300006847 Bacteria 15227
69 Ga0075431_100004979 3300006847 Bacteria 13072
70 Ga0075431_100014972 3300006847 Bacteria 7850
71 Ga0075431_100015125 3300006847 Bacteria 7816
72 Ga0075431_100032272 3300006847 Bacteria 5396
73 Ga0075431_100141313 3300006847 Bacteria 2481
74 Ga0075431_100908225 3300006847 Bacteria 850
75 Ga0075431_101458871 3300006847 Bacteria 643
76 Ga0075433_10000062 3300006852 Bacteria 46932
77 Ga0075433_10000079 3300006852 Bacteria 43978
78 Ga0075433_10012769 3300006852 Bacteria 6800
79 Ga0075433_10031862 3300006852 Bacteria 4510
80 Ga0075433_10076554 3300006852 Bacteria 2946
81 Ga0075433_10241501 3300006852 Bacteria 1603
82 Ga0075433_10314566 3300006852 Bacteria 1385
83 Ga0075433_10486016 3300006852 Bacteria 1087
84 Ga0075433_10588948 3300006852 Bacteria 977
85 Ga0075434_100000486 3300006871 Bacteria 29858
86 Ga0075434_100010470 3300006871 Bacteria 8695
87 Ga0075434_100018172 3300006871 Bacteria 6788
88 Ga0075434_100018606 3300006871 Bacteria 6712
89 Ga0075434_100040229 3300006871 Bacteria 4630
90 Ga0075434_100072686 3300006871 Bacteria 3431
91 Ga0075434_100187480 3300006871 Bacteria 2089
92 Ga0075434_100209425 3300006871 Bacteria 1970
93 Ga0075434_100378653 3300006871 Bacteria 1436
94 Ga0075434_100536232 3300006871 Bacteria 1190
95 Ga0075434_100930296 3300006871 Bacteria 884
96 Ga0075429_100000504 3300006880 Bacteria 29446
97 Ga0075429_100011292 3300006880 Bacteria 7733
98 Ga0075429_100031428 3300006880 Bacteria 4614
99 Ga0075429_100054579 3300006880 Bacteria 3476
100 Ga0075429_100065868 3300006880 Bacteria 3154
101 Ga0075429_100117910 3300006880 Bacteria 2320
102 Ga0075429_100136781 3300006880 Bacteria 2144
103 Ga0075429_100203788 3300006880 Bacteria 1733
104 Ga0075436_100001689 3300006914 Bacteria 15096
105 Ga0075436_100145929 3300006914 Bacteria 1664
106 Ga0075436_100183943 3300006914 Bacteria 1477
107 Ga0075435_100038124 3300007076 Bacteria 3831
108 Ga0075435_100055517 3300007076 Bacteria 3199
109 Ga0075435_100064266 3300007076 Bacteria 2981
110 Ga0075435_100107560 3300007076 Bacteria 2316
111 Ga0075435_100899420 3300007076 Unclassified 772
112 Ga0099794_10005743 3300007265 Bacteria 5000
113 Ga0111539_10021719 3300009094 Bacteria 7892
114 Ga0111539_10201087 3300009094 Bacteria 2323
115 Ga0111539_10274776 3300009094 Bacteria 1961
116 Ga0111539_10724378 3300009094 Bacteria 1158
117 Ga0111539_10925356 3300009094 Bacteria 1014
118 Ga0114129_10000002 3300009147 Bacteria 204413
119 Ga0114129_10000093 3300009147 Bacteria 85690
120 Ga0114129_10010241 3300009147 Bacteria 13375
121 Ga0114129_10011506 3300009147 Bacteria 12599
122 Ga0114129_10017219 3300009147 Bacteria 10294
123 Ga0114129_10023149 3300009147 Bacteria 8811
124 Ga0114129_10041341 3300009147 Bacteria 6497
125 Ga0114129_10049117 3300009147 Bacteria 5930
126 Ga0114129_10064130 3300009147 Bacteria 5127
127 Ga0114129_10068548 3300009147 Bacteria 4946
128 Ga0114129_10113410 3300009147 Bacteria 3738
129 Ga0114129_10403442 3300009147 Bacteria 1801
130 Ga0114129_10404765 3300009147 Bacteria 1798
131 Ga0114129_10417590 3300009147 Bacteria 1765
132 Ga0114129_10543691 3300009147 Bacteria 1511
133 Ga0114129_10603857 3300009147 Bacteria 1421
134 Ga0114129_10854164 3300009147 Bacteria 1157
135 Ga0114129_11603283 3300009147 Unclassified 797
136 Ga0105249_10090257 3300009553 Bacteria 2865
137 Ga0163162_11242214 3300013306 Bacteria 846
138 Ga0157380_10748810 3300014326 Bacteria 988
139 Ga0207684_10001531 3300025910 Bacteria 24753
140 Ga0207684_10025984 3300025910 Bacteria 4990
141 Ga0207684_10030693 3300025910 Bacteria 4574
142 Ga0207684_10226508 3300025910 Bacteria 1613
143 Ga0207646_10001305 3300025922 Bacteria 30967
144 Ga0207646_10111029 3300025922 Bacteria 2460
145 Ga0207646_10296715 3300025922 Bacteria 1460
146 Ga0207646_10459784 3300025922 Bacteria 1148
147 Ga0207681_10310406 3300025923 Bacteria 1251
148 Ga0207670_10914244 3300025936 Bacteria 735
149 Ga0207712_10821890 3300025961 Bacteria 818
150 Ga0207708_10801556 3300026075 Bacteria 811
151 Ga0207641_10101463 3300026088 Bacteria 2536
152 Ga0207674_10400568 3300026116 Bacteria 1326
153 Ga0207674_11221327 3300026116 Bacteria 721
154 Ga0209588_1051626 3300027671 Bacteria 1330
155 Ga0209974_10041398 3300027876 Bacteria 1533
156 Ga0207428_10000284 3300027907 Bacteria 68587
157 Ga0207428_10248122 3300027907 Bacteria 1328
158 Ga0268265_10350204 3300028380 Bacteria 1348
159 Ga0268264_10551451 3300028381 Unclassified 1130
160 Ga0307412_10239388 3300031911 Bacteria 1403
161 Ga0307412_11166060 3300031911 Bacteria 688
162 Ga0307409_100049947 3300031995 Bacteria 3192
163 Ga0307416_100008624 3300032002 Bacteria 6598
164 Ga0307416_100784241 3300032002 Bacteria 1048
165 Ga0373958_0066374 3300034819 Bacteria 792
166 Ga0373940_0031894 3300035088 Bacteria 1409
167 Ga0373932_0020010 3300035112 Bacteria 1750
168 Ga0373939_0010701 3300035114 Bacteria 2301
169 Ga0373939_0016376 3300035114 Bacteria 1954
170 Ga0373942_0052058 3300035207 Bacteria 1151
171 Ga0373962_0043505 3300035242 Bacteria 1273
172 Ga0373931_0018287 3300035691 Bacteria 3484
173 Ga0373937_1128512 3300036401 Bacteria 733
174 Ga0395899_0017675 3300037312 Bacteria 5432
175 Ga0395900_0000485 3300037418 Bacteria 56437
176 Ga0395900_0044596 3300037418 Bacteria 4568
177 Ga0395898_0003712 3300037466 Bacteria 16942
178 Ga0395901_0002188 3300038443 Bacteria 19956
179 Ga0451577_0209204 3300042876 Bacteria 1762
180 Ga0451577_0260998 3300042876 Bacteria 1569
181 Ga0451576_0023227 3300045051 Bacteria 6717
182 Ga0451576_1242488 3300045051 Bacteria 777
183 Ga0451576_2008987 3300045051 Unclassified 595
184 Ga0495592_0064189 3300046454 Bacteria 2692
185 Ga0495580_0026032 3300046472 Bacteria 4268
186 Ga0495608_0006783 3300046511 Bacteria 8119
187 Ga0495618_0201485 3300046514 Bacteria 1260
188 Ga0495628_0000407 3300046516 Bacteria 39404
189 Ga0495628_0124297 3300046516 Bacteria 1977
190 Ga0495630_0322215 3300046517 Bacteria 1181
191 Ga0495642_0098050 3300046528 Bacteria 1245
192 Ga0495667_0005257 3300046559 Bacteria 8750
193 Ga0495669_0175134 3300046684 Bacteria 1021
194 Ga0495613_0542122 3300046689 Bacteria 779
195 Ga0495684_0037783 3300047471 Bacteria 3703
196 Ga0501039_0372421 3300049575 Bacteria 1122
197 Ga0501040_0115431 3300049576 Bacteria 1880
198 Ga0501040_0128063 3300049576 Bacteria 1784
199 Ga0501041_0229236 3300049577 Bacteria 1166
200 Ga0501042_0217828 3300049578 Bacteria 1377
201 Ga0501042_0902369 3300049578 Bacteria 644
202 Ga0501046_0385194 3300049580 Bacteria 1014
203 Ga0501067_0053484 3300049583 Bacteria 2237
204 Ga0501068_0503551 3300049584 Bacteria 786
205 Ga0501070_0333487 3300049586 Bacteria 1233
206 Ga0501071_0182074 3300049587 Bacteria 1574
207 Ga0501072_0166758 3300049588 Bacteria 1757
208 Ga0501072_0235364 3300049588 Bacteria 1459
209 Ga0501072_0320188 3300049588 Bacteria 1232
210 Ga0501072_0986121 3300049588 Unclassified 657
211 Ga0501075_0038754 3300049591 Bacteria 3564
212 Ga0501075_0066843 3300049591 Bacteria 2713
213 Ga0501075_0130297 3300049591 Bacteria 1916
214 Ga0501075_0217131 3300049591 Bacteria 1459
215 Ga0501075_0501073 3300049591 Bacteria 926
216 Ga0501076_0227279 3300049592 Bacteria 1525
217 Ga0501077_0021429 3300049593 Bacteria 4089
218 Ga0501077_0453724 3300049593 Bacteria 821
219 Ga0501225_0108915 3300049705 Bacteria 815
220 Ga0501079_0329926 3300049741 Bacteria 1195
221 Ga0501079_0632569 3300049741 Unclassified 842
222 Ga0501081_0126738 3300049743 Bacteria 1822
223 Ga0501045_0080983 3300049824 Bacteria 2394
224 Ga0501045_0132647 3300049824 Bacteria 1852
225 nmdc:mga05p37_100_c1 3300050507 Bacteria 77275
226 nmdc:mga05p37_1131097_c1 3300050507 Bacteria 817
227 nmdc:mga05p37_1398_c1 3300050507 Bacteria 28070
228 nmdc:mga05p37_205340_c1 3300050507 Bacteria 2384
229 nmdc:mga05p37_260634_c1 3300050507 Bacteria 2075
230 nmdc:mga05p37_2_c1 3300050507 Bacteria 173421
231 nmdc:mga05p37_32611_c1 3300050507 Bacteria 6371
232 nmdc:mga05p37_438429_c1 3300050507 Bacteria 1516
233 nmdc:mga05p37_54621_c1 3300050507 Bacteria 4913
234 nmdc:mga05p37_597609_c1 3300050507 Bacteria 1246
235 nmdc:mga05p37_65958_c1 3300050507 Bacteria 4454
236 nmdc:mga05p37_688214_c1 3300050507 Bacteria 1138
237 nmdc:mga05p37_783428_c1 3300050507 Bacteria 1046
238 nmdc:mga05p37_928609_c1 3300050507 Bacteria 934
239 nmdc:mga09592_24448_c1 3300050508 Bacteria 4997
240 nmdc:mga09592_27818_c1 3300050508 Bacteria 4693
241 nmdc:mga09592_38326_c1 3300050508 Bacteria 4023
242 nmdc:mga09592_40601_c1 3300050508 Bacteria 3909
243 nmdc:mga09592_6169_c1 3300050508 Bacteria 9759
244 nmdc:mga09592_71132_c1 3300050508 Bacteria 2953
245 nmdc:mga09592_7973_c1 3300050508 Bacteria 8606
246 nmdc:mga0qj67_1635_c1 3300050509 Bacteria 15766
247 nmdc:mga0qj67_199724_c1 3300050509 Bacteria 1625
248 nmdc:mga0qj67_22243_c1 3300050509 Bacteria 4869
249 nmdc:mga0qj67_223028_c1 3300050509 Bacteria 1530
250 nmdc:mga0qj67_61238_c1 3300050509 Bacteria 2988
251 nmdc:mga06r32_11635_c1 3300050510 Bacteria 7921
252 nmdc:mga06r32_117724_c1 3300050510 Bacteria 2619
253 nmdc:mga06r32_1262_c1 3300050510 Bacteria 22732
254 nmdc:mga06r32_156481_c1 3300050510 Bacteria 2260
255 nmdc:mga06r32_24249_c1 3300050510 Bacteria 5627
256 nmdc:mga06r32_345790_c1 3300050510 Bacteria 1472
257 nmdc:mga06r32_71165_c1 3300050510 Bacteria 3365
258 nmdc:mga08y16_113451_c1 3300050511 Bacteria 2821
259 nmdc:mga08y16_1293128_c1 3300050511 Bacteria 696
260 nmdc:mga08y16_131941_c1 3300050511 Bacteria 2597
261 nmdc:mga08y16_1486109_c1 3300050511 Bacteria 638
262 nmdc:mga08y16_1725_c1 3300050511 Bacteria 22185
263 nmdc:mga08y16_634478_c1 3300050511 Bacteria 1074
264 nmdc:mga0n895_130253_c1 3300050512 Bacteria 2540
265 nmdc:mga0n895_17004_c1 3300050512 Bacteria 6691
266 nmdc:mga0n895_21935_c1 3300050512 Bacteria 5982
267 nmdc:mga0n895_29673_c1 3300050512 Bacteria 5220
268 nmdc:mga0n895_296819_c1 3300050512 Bacteria 1638
269 nmdc:mga0n895_322592_c1 3300050512 Bacteria 1565
270 nmdc:mga0n895_36019_c1 3300050512 Bacteria 4776
271 nmdc:mga0n895_41284_c1 3300050512 Bacteria 4484
272 nmdc:mga0n895_426_c1 3300050512 Bacteria 28280
273 nmdc:mga0n895_663224_c1 3300050512 Bacteria 1041
274 nmdc:mga0rr50_10085_c1 3300050513 Bacteria 5978
275 nmdc:mga0rr50_152010_c1 3300050513 Bacteria 1871
276 nmdc:mga0rr50_196000_c1 3300050513 Bacteria 1658
277 nmdc:mga0rr50_31917_c1 3300050513 Bacteria 3746
278 nmdc:mga0rr50_38249_c1 3300050513 Bacteria 3470
279 nmdc:mga0rr50_451658_c1 3300050513 Bacteria 1090
280 nmdc:mga0rr50_56041_c1 3300050513 Bacteria 2943
281 nmdc:mga0rr50_65064_c1 3300050513 Bacteria 2761
282 nmdc:mga0rr50_758380_c1 3300050513 Unclassified 828
283 nmdc:mga08x19_104166_c1 3300050514 Bacteria 1885
284 nmdc:mga08x19_108857_c1 3300050514 Bacteria 1846
285 nmdc:mga08x19_361_c1 3300050514 Bacteria 32660
286 nmdc:mga08x19_40071_c1 3300050514 Bacteria 2980
287 nmdc:mga0a205_142_c1 3300050515 Bacteria 45750
288 nmdc:mga0a205_1484_c1 3300050515 Bacteria 20007
289 nmdc:mga0a205_159003_c1 3300050515 Bacteria 2157
290 nmdc:mga0a205_19010_c1 3300050515 Bacteria 6473
291 nmdc:mga0a205_405079_c1 3300050515 Bacteria 1228
292 nmdc:mga0a205_52501_c1 3300050515 Bacteria 3934
293 nmdc:mga0a205_535_c1 3300050515 Bacteria 29966
294 nmdc:mga0a205_557747_c1 3300050515 Bacteria 1000
295 nmdc:mga0a205_62756_c1 3300050515 Bacteria 3590
296 Ga0501084_0055893 3300054114 Bacteria 3303
297 Ga0501084_0113379 3300054114 Bacteria 2279
298 Ga0501084_0310676 3300054114 Bacteria 1331
299 Ga0501082_0117941 3300060353 Bacteria 2299
300 Ga0501082_0531265 3300060353 Bacteria 1028
301 Ga0530510_0009920 3300061734 Bacteria 6682
302 Ga0070708_100421013
303 Ga0065707_10100113
304 Ga0065707_10209050
305 Ga0065707_10698414
306 Ga0070689_100302242
307 Ga0070692_10149031
308 Ga0070701_10073306
309 Ga0070705_100132734
310 Ga0070705_100250119
311 Ga0070694_100310482
312 Ga0070708_100018280
313 Ga0070708_100035921
314 Ga0070708_100051860
315 Ga0070708_100141280
316 Ga0070708_100382893
317 Ga0070708_100713706
318 Ga0068867_100601742
319 Ga0070706_100013416
320 Ga0070706_100155023
321 Ga0070706_100222130
322 Ga0070706_100343550
323 Ga0070707_100002450
324 Ga0070707_100049731
325 Ga0070707_100132297
326 Ga0070707_100340907
327 Ga0070707_100628090
328 Ga0070707_100776931
329 Ga0070698_100007324
330 Ga0070699_100002872
331 Ga0070699_100028821
332 Ga0070699_100063686
333 Ga0070699_100205207
334 Ga0070699_100422158
335 Ga0070697_100001072
336 Ga0070697_100011661
337 Ga0070697_100156193
338 Ga0070697_100166834
339 Ga0070697_100167305
340 Ga0070697_100372088
341 Ga0070697_100535244
342 Ga0070696_100153662
343 Ga0070704_100025551
344 Ga0068870_10320903
345 Ga0068863_100059773
346 Ga0068860_100250078
347 Ga0068862_100370412
348 Ga0081455_10097083
349 Ga0081538_10010550
350 Ga0081540_1058582
351 Ga0075432_10049560
352 Ga0075428_100007893
353 Ga0075428_100008824
354 Ga0075428_100048603
355 Ga0075428_100184213
356 Ga0075428_100188615
357 Ga0075428_100208520
358 Ga0075428_100227981
359 Ga0075428_100445578
360 Ga0075428_101183648
361 Ga0075430_100002531
362 Ga0075430_100028973
363 Ga0075430_100093236
364 Ga0075430_100198221
365 Ga0075431_100000016
366 Ga0075431_100000063
367 Ga0075431_100000691
368 Ga0075431_100000906
369 Ga0075431_100003499
370 Ga0075431_100004979
371 Ga0075431_100014972
372 Ga0075431_100015125
373 Ga0075431_100032272
374 Ga0075431_100141313
375 Ga0075431_100908225
376 Ga0075431_101458871
377 Ga0075433_10000062
378 Ga0075433_10000079
379 Ga0075433_10012769
380 Ga0075433_10031862
381 Ga0075433_10076554
382 Ga0075433_10241501
383 Ga0075433_10314566
384 Ga0075433_10486016
385 Ga0075433_10588948
386 Ga0075434_100000486
387 Ga0075434_100010470
388 Ga0075434_100018172
389 Ga0075434_100018606
390 Ga0075434_100040229
391 Ga0075434_100072686
392 Ga0075434_100187480
393 Ga0075434_100209425
394 Ga0075434_100378653
395 Ga0075434_100536232
396 Ga0075434_100930296
397 Ga0075429_100000504
398 Ga0075429_100011292
399 Ga0075429_100031428
400 Ga0075429_100054579
401 Ga0075429_100065868
402 Ga0075429_100117910
403 Ga0075429_100136781
404 Ga0075429_100203788
405 Ga0075436_100001689
406 Ga0075436_100145929
407 Ga0075436_100183943
408 Ga0075435_100038124
409 Ga0075435_100055517
410 Ga0075435_100064266
411 Ga0075435_100107560
412 Ga0075435_100899420
413 Ga0099794_10005743
414 Ga0111539_10021719
415 Ga0111539_10201087
416 Ga0111539_10274776
417 Ga0111539_10724378
418 Ga0111539_10925356
419 Ga0114129_10000002
420 Ga0114129_10000093
421 Ga0114129_10010241
422 Ga0114129_10011506
423 Ga0114129_10017219
424 Ga0114129_10023149
425 Ga0114129_10041341
426 Ga0114129_10049117
427 Ga0114129_10064130
428 Ga0114129_10068548
429 Ga0114129_10113410
430 Ga0114129_10403442
431 Ga0114129_10404765
432 Ga0114129_10417590
433 Ga0114129_10543691
434 Ga0114129_10603857
435 Ga0114129_10854164
436 Ga0114129_11603283
437 Ga0105249_10090257
438 Ga0163162_11242214
439 Ga0157380_10748810
440 Ga0207684_10001531
441 Ga0207684_10025984
442 Ga0207684_10030693
443 Ga0207684_10226508
444 Ga0207646_10001305
445 Ga0207646_10111029
446 Ga0207646_10296715
447 Ga0207646_10459784
448 Ga0207681_10310406
449 Ga0207670_10914244
450 Ga0207712_10821890
451 Ga0207708_10801556
452 Ga0207641_10101463
453 Ga0207674_10400568
454 Ga0207674_11221327
455 Ga0209588_1051626
456 Ga0209974_10041398
457 Ga0207428_10000284
458 Ga0207428_10248122
459 Ga0268265_10350204
460 Ga0268264_10551451
461 Ga0307412_10239388
462 Ga0307412_11166060
463 Ga0307409_100049947
464 Ga0307416_100008624
465 Ga0307416_100784241
466 Ga0373958_0066374
467 Ga0373940_0031894
468 Ga0373932_0020010
469 Ga0373939_0010701
470 Ga0373939_0016376
471 Ga0373942_0052058
472 Ga0373962_0043505
473 Ga0373931_0018287
474 Ga0373937_1128512
475 Ga0395899_0017675
476 Ga0395900_0000485
477 Ga0395900_0044596
478 Ga0395898_0003712
479 Ga0395901_0002188
480 Ga0451577_0209204
481 Ga0451577_0260998
482 Ga0451576_0023227
483 Ga0451576_1242488
484 Ga0451576_2008987
485 Ga0495592_0064189
486 Ga0495580_0026032
487 Ga0495608_0006783
488 Ga0495618_0201485
489 Ga0495628_0000407
490 Ga0495628_0124297
491 Ga0495630_0322215
492 Ga0495642_0098050
493 Ga0495667_0005257
494 Ga0495669_0175134
495 Ga0495613_0542122
496 Ga0495684_0037783
497 Ga0501039_0372421
498 Ga0501040_0115431
499 Ga0501040_0128063
500 Ga0501041_0229236
501 Ga0501042_0217828
502 Ga0501042_0902369
503 Ga0501046_0385194
504 Ga0501067_0053484
505 Ga0501068_0503551
506 Ga0501070_0333487
507 Ga0501071_0182074
508 Ga0501072_0166758
509 Ga0501072_0235364
510 Ga0501072_0320188
511 Ga0501072_0986121
512 Ga0501075_0038754
513 Ga0501075_0066843
514 Ga0501075_0130297
515 Ga0501075_0217131
516 Ga0501075_0501073
517 Ga0501076_0227279
518 Ga0501077_0021429
519 Ga0501077_0453724
520 Ga0501225_0108915
521 Ga0501079_0329926
522 Ga0501079_0632569
523 Ga0501081_0126738
524 Ga0501045_0080983
525 Ga0501045_0132647
526 nmdc:mga05p37_100_c1
527 nmdc:mga05p37_1131097_c1
528 nmdc:mga05p37_1398_c1
529 nmdc:mga05p37_205340_c1
530 nmdc:mga05p37_260634_c1
531 nmdc:mga05p37_2_c1
532 nmdc:mga05p37_32611_c1
533 nmdc:mga05p37_438429_c1
534 nmdc:mga05p37_54621_c1
535 nmdc:mga05p37_597609_c1
536 nmdc:mga05p37_65958_c1
537 nmdc:mga05p37_688214_c1
538 nmdc:mga05p37_783428_c1
539 nmdc:mga05p37_928609_c1
540 nmdc:mga09592_24448_c1
541 nmdc:mga09592_27818_c1
542 nmdc:mga09592_38326_c1
543 nmdc:mga09592_40601_c1
544 nmdc:mga09592_6169_c1
545 nmdc:mga09592_71132_c1
546 nmdc:mga09592_7973_c1
547 nmdc:mga0qj67_1635_c1
548 nmdc:mga0qj67_199724_c1
549 nmdc:mga0qj67_22243_c1
550 nmdc:mga0qj67_223028_c1
551 nmdc:mga0qj67_61238_c1
552 nmdc:mga06r32_11635_c1
553 nmdc:mga06r32_117724_c1
554 nmdc:mga06r32_1262_c1
555 nmdc:mga06r32_156481_c1
556 nmdc:mga06r32_24249_c1
557 nmdc:mga06r32_345790_c1
558 nmdc:mga06r32_71165_c1
559 nmdc:mga08y16_113451_c1
560 nmdc:mga08y16_1293128_c1
561 nmdc:mga08y16_131941_c1
562 nmdc:mga08y16_1486109_c1
563 nmdc:mga08y16_1725_c1
564 nmdc:mga08y16_634478_c1
565 nmdc:mga0n895_130253_c1
566 nmdc:mga0n895_17004_c1
567 nmdc:mga0n895_21935_c1
568 nmdc:mga0n895_29673_c1
569 nmdc:mga0n895_296819_c1
570 nmdc:mga0n895_322592_c1
571 nmdc:mga0n895_36019_c1
572 nmdc:mga0n895_41284_c1
573 nmdc:mga0n895_426_c1
574 nmdc:mga0n895_663224_c1
575 nmdc:mga0rr50_10085_c1
576 nmdc:mga0rr50_152010_c1
577 nmdc:mga0rr50_196000_c1
578 nmdc:mga0rr50_31917_c1
579 nmdc:mga0rr50_38249_c1
580 nmdc:mga0rr50_451658_c1
581 nmdc:mga0rr50_56041_c1
582 nmdc:mga0rr50_65064_c1
583 nmdc:mga0rr50_758380_c1
584 nmdc:mga08x19_104166_c1
585 nmdc:mga08x19_108857_c1
586 nmdc:mga08x19_361_c1
587 nmdc:mga08x19_40071_c1
588 nmdc:mga0a205_142_c1
589 nmdc:mga0a205_1484_c1
590 nmdc:mga0a205_159003_c1
591 nmdc:mga0a205_19010_c1
592 nmdc:mga0a205_405079_c1
593 nmdc:mga0a205_52501_c1
594 nmdc:mga0a205_535_c1
595 nmdc:mga0a205_557747_c1
596 nmdc:mga0a205_62756_c1
597 Ga0501084_0055893
598 Ga0501084_0113379
599 Ga0501084_0310676
600 Ga0501082_0117941
601 Ga0501082_0531265
602 Ga0530510_0009920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

23

172

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejk-assembly1.cif.gz_A-2 crystal structure of dtdp sugar isomerase (yp_390184.1) from desulfovibrio desulfuricans g20 at 1.95 a resolution 0.9296 22 168
3c3v-assembly1.cif.gz_A crystal structure of peanut major allergen ara h 3 0.8841 62 148
6l4m-assembly1.cif.gz_A crystal structure of vicilin from solanum lycopersicum (tomato) 0.8832 62 148
5e1r-assembly1.cif.gz_B crystal structure of pecan (carya illinoinensis) vicilin, a new food allergen 0.8773 62 148
1ep0-assembly1.cif.gz_A high resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum 0.8768 20 166
ID Description Score Start End Superfamily
3ejkA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9259 22 168 2.60.120.10
2vqaB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8845 64 148 2.60.120.10
af_Q9FLT3_18_198_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8778 62 148 2.60.120.10
af_A0A1D6KN97_1_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8725 62 148 2.60.120.10
5e1rB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8714 62 148 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1Q7EPN4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9929 22 178 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1F7NNG5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.99 40 178 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1Q7EPN4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9866 22 178 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1F7NNG5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9829 40 178 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A812IUH9-F1-model_v4 deleted 0.9766 11 178

Map