F395618
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 300 | 216 | 300 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300053730|Ga0500645_012970|Ga0500645_012970_1565_2221 |
| Length | 218 |
| Sequence | MRARLIAPWPPVNPGRAAYLAVPLPPVYLAGMADFFEALNEAHRGFIAKQPVFFVATAAEGARINLSPKGMDCFRVLDERTVAYLDVAGSGNETNAHLLADGRITIMFCAFESPALIFRIYGRGTPVLPQDDRWAELAPHFTLLPGTRQIFVVDIDNVQTSCGWGVPHMAFERERETLSKYHVKHGEEVRFAKYAVRTRSIDGLPVRNPSGAPTDGAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 62 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 113 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 114 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 115 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 116 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 117 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 119 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 120 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 121 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 122 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 123 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 124 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 127 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 128 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 130 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 131 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 132 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 168 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 169 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 170 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 172 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 173 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 174 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 175 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 176 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 177 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 178 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 179 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 180 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 181 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 182 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 183 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 184 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 185 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 186 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 191 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 194 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 195 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 196 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 197 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 198 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 199 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 200 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 201 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 202 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 203 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 204 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 205 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 206 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 207 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 208 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 209 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 210 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 211 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 212 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 213 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 214 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 215 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 216 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 1.67 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23 |
| Nodule | 0 |
| Rhizoplane | 4 |
| Rhizosphere | 65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1007064 | 3300001915 | Bacteria | 2204 |
| 2 | JGI24740J21852_10023388 | 3300001979 | Bacteria | 2112 |
| 3 | JGI24737J22298_10002107 | 3300001990 | Bacteria | 7096 |
| 4 | JGI24737J22298_10008118 | 3300001990 | Bacteria | 3529 |
| 5 | JGI25165J46597_1000010 | 3300003214 | Bacteria | 442113 |
| 6 | JGI25153J46596_10000034 | 3300003215 | Bacteria | 192215 |
| 7 | Ga0055525_1000139 | 3300003759 | Bacteria | 102623 |
| 8 | Ga0055542_1000012 | 3300003762 | Bacteria | 391808 |
| 9 | Ga0055529_1000004 | 3300003763 | Bacteria | 433331 |
| 10 | Ga0055526_1005294 | 3300003771 | Bacteria | 7471 |
| 11 | Ga0055526_1027335 | 3300003771 | Bacteria | 1766 |
| 12 | Ga0055537_1003446 | 3300003773 | Bacteria | 4863 |
| 13 | Ga0055536_1019152 | 3300003781 | Bacteria | 2163 |
| 14 | Ga0055530_10002624 | 3300003791 | Bacteria | 11287 |
| 15 | Ga0055540_1001490 | 3300003792 | Bacteria | 13910 |
| 16 | Ga0055531_10003511 | 3300003794 | Bacteria | 9966 |
| 17 | JGI25405J52794_10014963 | 3300003911 | Bacteria | 1520 |
| 18 | Ga0065165_1109146 | 3300005262 | Bacteria | 683 |
| 19 | Ga0070658_10035480 | 3300005327 | Bacteria | 4017 |
| 20 | Ga0068869_100218754 | 3300005334 | Bacteria | 1509 |
| 21 | Ga0068869_100565647 | 3300005334 | Bacteria | 957 |
| 22 | Ga0070661_100071212 | 3300005344 | Bacteria | 2558 |
| 23 | Ga0070669_100148496 | 3300005353 | Bacteria | 1813 |
| 24 | Ga0070675_100090297 | 3300005354 | Bacteria | 2566 |
| 25 | Ga0070659_100496898 | 3300005366 | Bacteria | 1039 |
| 26 | Ga0070678_100001426 | 3300005456 | Bacteria | 12735 |
| 27 | Ga0070662_100345763 | 3300005457 | Bacteria | 1217 |
| 28 | Ga0070684_100425105 | 3300005535 | Bacteria | 1227 |
| 29 | Ga0070665_100000317 | 3300005548 | Bacteria | 74997 |
| 30 | Ga0070665_100197876 | 3300005548 | Bacteria | 2010 |
| 31 | Ga0070665_100356774 | 3300005548 | Bacteria | 1468 |
| 32 | Ga0068855_100201849 | 3300005563 | Bacteria | 2238 |
| 33 | Ga0068857_100183682 | 3300005577 | Bacteria | 1903 |
| 34 | Ga0068854_100095881 | 3300005578 | Bacteria | 2215 |
| 35 | Ga0068854_100375325 | 3300005578 | Bacteria | 1170 |
| 36 | Ga0068854_100548149 | 3300005578 | Bacteria | 980 |
| 37 | Ga0068852_100262277 | 3300005616 | Bacteria | 1659 |
| 38 | Ga0068851_10188887 | 3300005834 | Bacteria | 1144 |
| 39 | Ga0068863_100006311 | 3300005841 | Bacteria | 11635 |
| 40 | Ga0068863_100119426 | 3300005841 | Bacteria | 2513 |
| 41 | Ga0068858_100000274 | 3300005842 | Bacteria | 55319 |
| 42 | Ga0068860_100011180 | 3300005843 | Bacteria | 8847 |
| 43 | Ga0081455_10000552 | 3300005937 | Bacteria | 48660 |
| 44 | Ga0081455_10001022 | 3300005937 | Bacteria | 35293 |
| 45 | Ga0070717_10401627 | 3300006028 | Bacteria | 1231 |
| 46 | Ga0075366_10023802 | 3300006195 | Bacteria | 3569 |
| 47 | Ga0075366_10302160 | 3300006195 | Bacteria | 979 |
| 48 | Ga0097621_101039670 | 3300006237 | Bacteria | 767 |
| 49 | Ga0075370_10033030 | 3300006353 | Bacteria | 2895 |
| 50 | Ga0097620_100018294 | 3300006931 | Bacteria | 7044 |
| 51 | Ga0105240_10030710 | 3300009093 | Bacteria | 6979 |
| 52 | Ga0105240_10841411 | 3300009093 | Bacteria | 991 |
| 53 | Ga0105245_10001591 | 3300009098 | Bacteria | 20657 |
| 54 | Ga0105247_10029277 | 3300009101 | Bacteria | 3336 |
| 55 | Ga0105243_10001132 | 3300009148 | Bacteria | 24182 |
| 56 | Ga0105243_10402728 | 3300009148 | Bacteria | 1272 |
| 57 | Ga0105241_10027632 | 3300009174 | Bacteria | 4226 |
| 58 | Ga0105241_11297432 | 3300009174 | Bacteria | 693 |
| 59 | Ga0105248_10508848 | 3300009177 | Bacteria | 1358 |
| 60 | Ga0105238_10003777 | 3300009551 | Bacteria | 15046 |
| 61 | Ga0105249_10000015 | 3300009553 | Bacteria | 282138 |
| 62 | Ga0105239_10668793 | 3300010375 | Bacteria | 1186 |
| 63 | Ga0157317_1002740 | 3300012475 | Bacteria | 1059 |
| 64 | Ga0157373_10049492 | 3300013100 | Bacteria | 2995 |
| 65 | Ga0157371_10000452 | 3300013102 | Bacteria | 50337 |
| 66 | Ga0157371_10819308 | 3300013102 | Bacteria | 702 |
| 67 | Ga0157374_10843651 | 3300013296 | Bacteria | 933 |
| 68 | Ga0157378_10060790 | 3300013297 | Bacteria | 3371 |
| 69 | Ga0163162_10095969 | 3300013306 | Bacteria | 3053 |
| 70 | Ga0163162_12195557 | 3300013306 | Bacteria | 634 |
| 71 | Ga0157372_10418203 | 3300013307 | Bacteria | 1562 |
| 72 | Ga0163163_10807486 | 3300014325 | Bacteria | 1001 |
| 73 | Ga0157380_10269301 | 3300014326 | Bacteria | 1552 |
| 74 | Ga0163161_10143140 | 3300017792 | Bacteria | 1811 |
| 75 | Ga0206356_11749622 | 3300020070 | Bacteria | 1861 |
| 76 | Ga0206355_1181064 | 3300020076 | Bacteria | 1853 |
| 77 | Ga0206350_10943281 | 3300020080 | Bacteria | 2713 |
| 78 | Ga0206353_11854900 | 3300020082 | Bacteria | 812 |
| 79 | Ga0224712_10250646 | 3300022467 | Unclassified | 818 |
| 80 | Ga0209674_103598 | 3300025226 | Bacteria | 2794 |
| 81 | Ga0209674_112787 | 3300025226 | Bacteria | 805 |
| 82 | Ga0209563_100070 | 3300025230 | Bacteria | 249779 |
| 83 | Ga0209437_109989 | 3300025233 | Bacteria | 1462 |
| 84 | Ga0209646_1003232 | 3300025246 | Bacteria | 3269 |
| 85 | Ga0209677_103628 | 3300025253 | Bacteria | 4874 |
| 86 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 87 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 88 | Ga0209565_1000052 | 3300025263 | Bacteria | 212056 |
| 89 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 90 | Ga0209455_1028980 | 3300025272 | Bacteria | 961 |
| 91 | Ga0209676_1004959 | 3300025292 | Bacteria | 7146 |
| 92 | Ga0209564_1000783 | 3300025295 | Bacteria | 44071 |
| 93 | Ga0209564_1006593 | 3300025295 | Bacteria | 6222 |
| 94 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 95 | Ga0209758_1011965 | 3300025297 | Bacteria | 4932 |
| 96 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 97 | Ga0209050_1001214 | 3300025298 | Bacteria | 30169 |
| 98 | Ga0209050_1035261 | 3300025298 | Bacteria | 1482 |
| 99 | Ga0209051_1000297 | 3300025303 | Bacteria | 79062 |
| 100 | Ga0209257_1001308 | 3300025304 | Bacteria | 30326 |
| 101 | Ga0207710_10017344 | 3300025900 | Bacteria | 3053 |
| 102 | Ga0207688_10071226 | 3300025901 | Bacteria | 1973 |
| 103 | Ga0207647_10008921 | 3300025904 | Bacteria | 7151 |
| 104 | Ga0207647_10038580 | 3300025904 | Bacteria | 3019 |
| 105 | Ga0207705_10000512 | 3300025909 | Bacteria | 33029 |
| 106 | Ga0207654_10000500 | 3300025911 | Bacteria | 22386 |
| 107 | Ga0207654_10868813 | 3300025911 | Unclassified | 653 |
| 108 | Ga0207695_10017382 | 3300025913 | Bacteria | 8369 |
| 109 | Ga0207695_10611866 | 3300025913 | Bacteria | 971 |
| 110 | Ga0207657_10029324 | 3300025919 | Bacteria | 5011 |
| 111 | Ga0207649_10001188 | 3300025920 | Bacteria | 15686 |
| 112 | Ga0207694_10030395 | 3300025924 | Bacteria | 4125 |
| 113 | Ga0207694_10941180 | 3300025924 | Bacteria | 731 |
| 114 | Ga0207650_10473765 | 3300025925 | Bacteria | 1044 |
| 115 | Ga0207659_10092631 | 3300025926 | Bacteria | 2260 |
| 116 | Ga0207687_10001688 | 3300025927 | Bacteria | 15211 |
| 117 | Ga0207690_10000666 | 3300025932 | Bacteria | 21974 |
| 118 | Ga0207706_10755951 | 3300025933 | Bacteria | 828 |
| 119 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 120 | Ga0207709_10030137 | 3300025935 | Bacteria | 3153 |
| 121 | Ga0207669_10000170 | 3300025937 | Bacteria | 30685 |
| 122 | Ga0207669_10382926 | 3300025937 | Bacteria | 1096 |
| 123 | Ga0207689_10170471 | 3300025942 | Bacteria | 1794 |
| 124 | Ga0207661_10289509 | 3300025944 | Bacteria | 1466 |
| 125 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 126 | Ga0207667_10012901 | 3300025949 | Bacteria | 9599 |
| 127 | Ga0207667_10485380 | 3300025949 | Bacteria | 1254 |
| 128 | Ga0207712_10000023 | 3300025961 | Bacteria | 282081 |
| 129 | Ga0207668_10266276 | 3300025972 | Bacteria | 1399 |
| 130 | Ga0207640_10002121 | 3300025981 | Bacteria | 10647 |
| 131 | Ga0207658_10247304 | 3300025986 | Bacteria | 1514 |
| 132 | Ga0207703_10001826 | 3300026035 | Bacteria | 18987 |
| 133 | Ga0207639_10003983 | 3300026041 | Bacteria | 9971 |
| 134 | Ga0207702_10003993 | 3300026078 | Bacteria | 13247 |
| 135 | Ga0207641_10004733 | 3300026088 | Bacteria | 11734 |
| 136 | Ga0207641_10147784 | 3300026088 | Bacteria | 2126 |
| 137 | Ga0207674_10183841 | 3300026116 | Bacteria | 2041 |
| 138 | Ga0207674_10271775 | 3300026116 | Bacteria | 1642 |
| 139 | Ga0207683_10021168 | 3300026121 | Bacteria | 5565 |
| 140 | Ga0207698_10311000 | 3300026142 | Bacteria | 1471 |
| 141 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 142 | Ga0268266_10000388 | 3300028379 | Bacteria | 66871 |
| 143 | Ga0268266_10823044 | 3300028379 | Bacteria | 897 |
| 144 | Ga0268264_10000990 | 3300028381 | Bacteria | 28980 |
| 145 | Ga0307517_10092445 | 3300028786 | Bacteria | 2461 |
| 146 | Ga0307513_10030657 | 3300031456 | Bacteria | 6107 |
| 147 | Ga0307513_10066538 | 3300031456 | Bacteria | 3785 |
| 148 | Ga0307509_10016195 | 3300031507 | Bacteria | 8639 |
| 149 | Ga0307509_10265489 | 3300031507 | Bacteria | 1488 |
| 150 | Ga0307508_10000011 | 3300031616 | Bacteria | 248001 |
| 151 | Ga0316579_10000170 | 3300031691 | Bacteria | 18884 |
| 152 | Ga0316579_10013865 | 3300031691 | Bacteria | 3476 |
| 153 | Ga0316579_10099972 | 3300031691 | Bacteria | 1388 |
| 154 | Ga0265342_10303359 | 3300031712 | Bacteria | 841 |
| 155 | Ga0316578_10005815 | 3300031728 | Bacteria | 6029 |
| 156 | Ga0316578_10092207 | 3300031728 | Bacteria | 1810 |
| 157 | Ga0316583_10003049 | 3300032133 | Bacteria | 5879 |
| 158 | Ga0316583_10003698 | 3300032133 | Bacteria | 5407 |
| 159 | Ga0316585_10042353 | 3300032137 | Bacteria | 1452 |
| 160 | Ga0316580_10074867 | 3300032139 | Unclassified | 1036 |
| 161 | Ga0307510_10031059 | 3300033180 | Bacteria | 6040 |
| 162 | Ga0316582_0002560 | 3300036647 | Bacteria | 8604 |
| 163 | Ga0316582_0006811 | 3300036647 | Bacteria | 6036 |
| 164 | Ga0316582_0009651 | 3300036647 | Bacteria | 5246 |
| 165 | Ga0316584_0016575 | 3300036712 | Bacteria | 5283 |
| 166 | Ga0316584_0062974 | 3300036712 | Bacteria | 2777 |
| 167 | Ga0316584_0213664 | 3300036712 | Bacteria | 1419 |
| 168 | Ga0316584_0249854 | 3300036712 | Bacteria | 1296 |
| 169 | Ga0395899_0074500 | 3300037312 | Bacteria | 2480 |
| 170 | Ga0316581_0001359 | 3300037588 | Bacteria | 5446 |
| 171 | Ga0316581_0007543 | 3300037588 | Bacteria | 2925 |
| 172 | Ga0436364_0498149 | 3300037853 | Bacteria | 1323 |
| 173 | Ga0451789_0535598 | 3300041443 | Bacteria | 724 |
| 174 | Ga0451795_0562533 | 3300041456 | Bacteria | 1154 |
| 175 | Ga0451853_2476269 | 3300041512 | Bacteria | 959 |
| 176 | Ga0439448_0080365 | 3300042005 | Bacteria | 1094 |
| 177 | Ga0453684_0430232 | 3300044712 | Unclassified | 1473 |
| 178 | Ga0495638_0000741 | 3300046460 | Bacteria | 35061 |
| 179 | Ga0495650_0000364 | 3300046471 | Bacteria | 79811 |
| 180 | Ga0495639_0132536 | 3300046475 | Bacteria | 1194 |
| 181 | Ga0495584_0021302 | 3300046491 | Bacteria | 3294 |
| 182 | Ga0495584_0126571 | 3300046491 | Bacteria | 1295 |
| 183 | Ga0495585_0012292 | 3300046492 | Bacteria | 5043 |
| 184 | Ga0495585_0064889 | 3300046492 | Bacteria | 2001 |
| 185 | Ga0495585_0317621 | 3300046492 | Bacteria | 762 |
| 186 | Ga0495596_0012944 | 3300046500 | Bacteria | 3554 |
| 187 | Ga0495583_0000311 | 3300046506 | Bacteria | 76925 |
| 188 | Ga0495583_0008509 | 3300046506 | Bacteria | 6261 |
| 189 | Ga0495583_0018405 | 3300046506 | Bacteria | 3677 |
| 190 | Ga0495606_0001040 | 3300046507 | Bacteria | 40138 |
| 191 | Ga0495606_0100990 | 3300046507 | Bacteria | 1756 |
| 192 | Ga0495637_0033787 | 3300046520 | Bacteria | 2244 |
| 193 | Ga0495637_0087106 | 3300046520 | Bacteria | 1237 |
| 194 | Ga0495643_0002504 | 3300046522 | Bacteria | 14435 |
| 195 | Ga0495643_0069584 | 3300046522 | Bacteria | 1849 |
| 196 | Ga0495643_0150976 | 3300046522 | Bacteria | 1150 |
| 197 | Ga0495643_0325696 | 3300046522 | Bacteria | 693 |
| 198 | Ga0495648_0000387 | 3300046524 | Bacteria | 48332 |
| 199 | Ga0495648_0161505 | 3300046524 | Bacteria | 1158 |
| 200 | Ga0495663_0000779 | 3300046525 | Bacteria | 10894 |
| 201 | Ga0495663_0041390 | 3300046525 | Bacteria | 1401 |
| 202 | Ga0495666_0058419 | 3300046526 | Bacteria | 1845 |
| 203 | Ga0495642_0015173 | 3300046528 | Bacteria | 2990 |
| 204 | Ga0495642_0022743 | 3300046528 | Bacteria | 2471 |
| 205 | Ga0495652_0221747 | 3300046529 | Bacteria | 1421 |
| 206 | Ga0495597_0030318 | 3300046542 | Bacteria | 2465 |
| 207 | Ga0495633_0000538 | 3300046558 | Bacteria | 37829 |
| 208 | Ga0495633_0015533 | 3300046558 | Bacteria | 3947 |
| 209 | Ga0495668_0000468 | 3300046616 | Bacteria | 51229 |
| 210 | Ga0495668_0024051 | 3300046616 | Bacteria | 3467 |
| 211 | Ga0495611_0007586 | 3300046648 | Bacteria | 4602 |
| 212 | Ga0495625_0000094 | 3300046660 | Bacteria | 144517 |
| 213 | Ga0495625_0002092 | 3300046660 | Bacteria | 22304 |
| 214 | Ga0495625_0009614 | 3300046660 | Bacteria | 8069 |
| 215 | Ga0495625_0022650 | 3300046660 | Bacteria | 4813 |
| 216 | Ga0495625_0199048 | 3300046660 | Bacteria | 1323 |
| 217 | Ga0495661_0039618 | 3300046665 | Bacteria | 2927 |
| 218 | Ga0495669_0000118 | 3300046684 | Bacteria | 51189 |
| 219 | Ga0495613_0318948 | 3300046689 | Bacteria | 1073 |
| 220 | Ga0495670_0000016 | 3300046691 | Bacteria | 128045 |
| 221 | Ga0495670_0002812 | 3300046691 | Bacteria | 8611 |
| 222 | Ga0495670_0104567 | 3300046691 | Bacteria | 1461 |
| 223 | Ga0495670_0134104 | 3300046691 | Bacteria | 1292 |
| 224 | Ga0495649_0056953 | 3300046694 | Bacteria | 2108 |
| 225 | Ga0495600_0000858 | 3300046809 | Bacteria | 16218 |
| 226 | Ga0495660_0031843 | 3300046810 | Bacteria | 2963 |
| 227 | Ga0495683_0006599 | 3300047323 | Bacteria | 6328 |
| 228 | Ga0495683_0083976 | 3300047323 | Bacteria | 1550 |
| 229 | Ga0495687_000499 | 3300047443 | Bacteria | 47300 |
| 230 | Ga0495677_0001980 | 3300047445 | Bacteria | 8171 |
| 231 | Ga0495681_0201417 | 3300047470 | Bacteria | 807 |
| 232 | Ga0495686_0013024 | 3300047472 | Bacteria | 5792 |
| 233 | Ga0495686_0048711 | 3300047472 | Bacteria | 2670 |
| 234 | Ga0496101_0377883 | 3300048904 | Bacteria | 1115 |
| 235 | Ga0496102_0000022 | 3300048905 | Bacteria | 246314 |
| 236 | Ga0496103_0000075 | 3300048906 | Bacteria | 114569 |
| 237 | Ga0496104_0008397 | 3300048907 | Bacteria | 9180 |
| 238 | Ga0496105_0013090 | 3300048908 | Bacteria | 6577 |
| 239 | Ga0496109_0399266 | 3300048912 | Bacteria | 1299 |
| 240 | Ga0496110_0004080 | 3300048913 | Bacteria | 11274 |
| 241 | Ga0496111_0015353 | 3300048914 | Bacteria | 5254 |
| 242 | Ga0496114_0011288 | 3300048917 | Bacteria | 7133 |
| 243 | Ga0496115_0000384 | 3300048918 | Bacteria | 36457 |
| 244 | Ga0496116_0004132 | 3300048919 | Bacteria | 13988 |
| 245 | Ga0496117_0000439 | 3300048920 | Bacteria | 69213 |
| 246 | Ga0496118_0000039 | 3300048921 | Bacteria | 305458 |
| 247 | Ga0496119_0009148 | 3300048922 | Bacteria | 8564 |
| 248 | Ga0496120_0021297 | 3300048923 | Bacteria | 4099 |
| 249 | Ga0496121_0000269 | 3300048924 | Bacteria | 108869 |
| 250 | Ga0496121_0116075 | 3300048924 | Bacteria | 2031 |
| 251 | Ga0496122_0009622 | 3300048925 | Bacteria | 10124 |
| 252 | Ga0496123_0071563 | 3300048926 | Bacteria | 2162 |
| 253 | Ga0496123_0159762 | 3300048926 | Bacteria | 1203 |
| 254 | Ga0496124_0000076 | 3300048927 | Bacteria | 215767 |
| 255 | Ga0496125_0031798 | 3300048928 | Bacteria | 4697 |
| 256 | Ga0496126_0001584 | 3300048929 | Bacteria | 34722 |
| 257 | Ga0496126_0208529 | 3300048929 | Unclassified | 1646 |
| 258 | Ga0501032_0045784 | 3300049569 | Bacteria | 2958 |
| 259 | Ga0501034_0004238 | 3300049571 | Bacteria | 16003 |
| 260 | Ga0501034_0029928 | 3300049571 | Bacteria | 5535 |
| 261 | Ga0501037_0072069 | 3300049573 | Bacteria | 2513 |
| 262 | Ga0501047_0030117 | 3300049581 | Bacteria | 5233 |
| 263 | Ga0501242_017006 | 3300049674 | Bacteria | 914 |
| 264 | Ga0501080_0113383 | 3300049742 | Bacteria | 2513 |
| 265 | Ga0501044_0000733 | 3300049823 | Bacteria | 39526 |
| 266 | Ga0501044_0006757 | 3300049823 | Bacteria | 12645 |
| 267 | nmdc:mga0k408_96666_c1 | 3300050493 | Bacteria | 1739 |
| 268 | nmdc:mga07m45_375422_c1 | 3300050496 | Bacteria | 826 |
| 269 | nmdc:mga07m45_599720_c1 | 3300050496 | Bacteria | 636 |
| 270 | Ga0500610_0005178 | 3300053079 | Bacteria | 5310 |
| 271 | Ga0500647_0062159 | 3300053091 | Bacteria | 1797 |
| 272 | Ga0500651_0081476 | 3300053093 | Bacteria | 2004 |
| 273 | Ga0500641_0013346 | 3300053096 | Bacteria | 3017 |
| 274 | Ga0500641_0122662 | 3300053096 | Bacteria | 1120 |
| 275 | Ga0500556_0126607 | 3300053104 | Bacteria | 999 |
| 276 | Ga0500562_024339 | 3300053108 | Bacteria | 1583 |
| 277 | Ga0500595_001071 | 3300053119 | Bacteria | 15187 |
| 278 | Ga0500595_001233 | 3300053119 | Bacteria | 14110 |
| 279 | Ga0500608_298052 | 3300053122 | Bacteria | 600 |
| 280 | Ga0500642_0001699 | 3300053130 | Bacteria | 6350 |
| 281 | Ga0500652_130492 | 3300053131 | Bacteria | 1049 |
| 282 | Ga0500658_0001088 | 3300053134 | Bacteria | 11124 |
| 283 | Ga0500559_0005175 | 3300053136 | Bacteria | 6023 |
| 284 | Ga0500559_0097064 | 3300053136 | Bacteria | 1354 |
| 285 | Ga0500568_0009480 | 3300053139 | Bacteria | 4617 |
| 286 | Ga0500568_0125027 | 3300053139 | Bacteria | 957 |
| 287 | Ga0500585_195176 | 3300053144 | Bacteria | 678 |
| 288 | Ga0500604_0000013 | 3300053151 | Bacteria | 92467 |
| 289 | Ga0500616_0000161 | 3300053153 | Bacteria | 111424 |
| 290 | Ga0500616_0035942 | 3300053153 | Bacteria | 2691 |
| 291 | Ga0500636_0103885 | 3300053177 | Bacteria | 1612 |
| 292 | Ga0500636_0223263 | 3300053177 | Bacteria | 980 |
| 293 | Ga0500645_000003 | 3300053730 | Bacteria | 305887 |
| 294 | Ga0500645_000924 | 3300053730 | Bacteria | 16899 |
| 295 | Ga0500645_012970 | 3300053730 | Bacteria | 2684 |
| 296 | Ga0500609_015674 | 3300053731 | Bacteria | 1027 |
| 297 | Ga0500596_015630 | 3300053735 | Bacteria | 1139 |
| 298 | Ga0500661_014092 | 3300055283 | Bacteria | 1440 |
| 299 | Ga0500661_019135 | 3300055283 | Bacteria | 1219 |
| 300 | Ga0501082_0695992 | 3300060353 | Bacteria | 889 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049742 | Ga0501080_0113383 | Ga0501080_0113383_10_477 | 149 |
| 2 | 3300009177 | Ga0105248_10508848 | Ga0105248_105088482 | 176 |
| 3 | 3300046524 | Ga0495648_0161505 | Ga0495648_0161505_470_1030 | 176 |
| 4 | 3300046689 | Ga0495613_0318948 | Ga0495613_0318948_91_627 | 176 |
| 5 | 3300003762 | Ga0055542_1000012 | Ga0055542_100001282 | 177 |
| 6 | 3300003763 | Ga0055529_1000004 | Ga0055529_1000004225 | 177 |
| 7 | 3300025226 | Ga0209674_103598 | Ga0209674_1035982 | 177 |
| 8 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008715 | 177 |
| 9 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002709 | 177 |
| 10 | 3300031456 | Ga0307513_10066538 | Ga0307513_100665384 | 177 |
| 11 | 3300046524 | Ga0495648_0000387 | Ga0495648_0000387_8875_9450 | 177 |
| 12 | 3300047323 | Ga0495683_0006599 | Ga0495683_0006599_1156_1731 | 177 |
| 13 | 3300053144 | Ga0500585_195176 | Ga0500585_195176_72_665 | 177 |
| 14 | 3300003911 | JGI25405J52794_10014963 | JGI25405J52794_100149632 | 178 |
| 15 | 3300005937 | Ga0081455_10001022 | Ga0081455_1000102228 | 178 |
| 16 | 3300046665 | Ga0495661_0039618 | Ga0495661_0039618_2181_2774 | 178 |
| 17 | 3300005563 | Ga0068855_100201849 | Ga0068855_1002018493 | 179 |
| 18 | 3300005578 | Ga0068854_100548149 | Ga0068854_1005481491 | 179 |
| 19 | 3300009093 | Ga0105240_10030710 | Ga0105240_100307104 | 179 |
| 20 | 3300025911 | Ga0207654_10868813 | Ga0207654_108688131 | 179 |
| 21 | 3300025913 | Ga0207695_10017382 | Ga0207695_100173824 | 179 |
| 22 | 3300025949 | Ga0207667_10012901 | Ga0207667_100129014 | 179 |
| 23 | 3300031691 | Ga0316579_10000170 | Ga0316579_100001709 | 179 |
| 24 | 3300031691 | Ga0316579_10099972 | Ga0316579_100999721 | 179 |
| 25 | 3300031728 | Ga0316578_10005815 | Ga0316578_100058154 | 179 |
| 26 | 3300031728 | Ga0316578_10092207 | Ga0316578_100922072 | 179 |
| 27 | 3300032133 | Ga0316583_10003049 | Ga0316583_100030494 | 179 |
| 28 | 3300032133 | Ga0316583_10003698 | Ga0316583_100036982 | 179 |
| 29 | 3300032137 | Ga0316585_10042353 | Ga0316585_100423532 | 179 |
| 30 | 3300032139 | Ga0316580_10074867 | Ga0316580_100748672 | 179 |
| 31 | 3300036647 | Ga0316582_0002560 | Ga0316582_0002560_5058_5603 | 179 |
| 32 | 3300036647 | Ga0316582_0006811 | Ga0316582_0006811_4429_4974 | 179 |
| 33 | 3300036647 | Ga0316582_0009651 | Ga0316582_0009651_1158_1703 | 179 |
| 34 | 3300036712 | Ga0316584_0016575 | Ga0316584_0016575_390_935 | 179 |
| 35 | 3300036712 | Ga0316584_0213664 | Ga0316584_0213664_313_858 | 179 |
| 36 | 3300036712 | Ga0316584_0249854 | Ga0316584_0249854_45_590 | 179 |
| 37 | 3300037588 | Ga0316581_0001359 | Ga0316581_0001359_1125_1670 | 179 |
| 38 | 3300037588 | Ga0316581_0007543 | Ga0316581_0007543_1273_1818 | 179 |
| 39 | 3300046475 | Ga0495639_0132536 | Ga0495639_0132536_433_1026 | 179 |
| 40 | 3300046492 | Ga0495585_0064889 | Ga0495585_0064889_236_829 | 179 |
| 41 | 3300053091 | Ga0500647_0062159 | Ga0500647_0062159_31_624 | 179 |
| 42 | 3300053119 | Ga0500595_001233 | Ga0500595_001233_8024_8617 | 179 |
| 43 | 3300048929 | Ga0496126_0208529 | Ga0496126_0208529_929_1498 | 180 |
| 44 | 3300005937 | Ga0081455_10000552 | Ga0081455_1000055217 | 181 |
| 45 | 3300006028 | Ga0070717_10401627 | Ga0070717_104016272 | 181 |
| 46 | 3300009174 | Ga0105241_11297432 | Ga0105241_112974322 | 181 |
| 47 | 3300014325 | Ga0163163_10807486 | Ga0163163_108074861 | 181 |
| 48 | 3300020070 | Ga0206356_11749622 | Ga0206356_117496222 | 181 |
| 49 | 3300020076 | Ga0206355_1181064 | Ga0206355_11810641 | 181 |
| 50 | 3300020080 | Ga0206350_10943281 | Ga0206350_109432813 | 181 |
| 51 | 3300020082 | Ga0206353_11854900 | Ga0206353_118549001 | 181 |
| 52 | 3300022467 | Ga0224712_10250646 | Ga0224712_102506461 | 181 |
| 53 | 3300025253 | Ga0209677_103628 | Ga0209677_1036284 | 181 |
| 54 | 3300031691 | Ga0316579_10013865 | Ga0316579_100138653 | 181 |
| 55 | 3300031712 | Ga0265342_10303359 | Ga0265342_103033591 | 181 |
| 56 | 3300036712 | Ga0316584_0062974 | Ga0316584_0062974_105_659 | 181 |
| 57 | 3300037853 | Ga0436364_0498149 | Ga0436364_0498149_336_899 | 181 |
| 58 | 3300044712 | Ga0453684_0430232 | Ga0453684_0430232_124_681 | 181 |
| 59 | 3300049569 | Ga0501032_0045784 | Ga0501032_0045784_1113_1676 | 181 |
| 60 | 3300049571 | Ga0501034_0004238 | Ga0501034_0004238_1212_1787 | 181 |
| 61 | 3300049571 | Ga0501034_0029928 | Ga0501034_0029928_3951_4514 | 181 |
| 62 | 3300049573 | Ga0501037_0072069 | Ga0501037_0072069_809_1372 | 181 |
| 63 | 3300049581 | Ga0501047_0030117 | Ga0501047_0030117_4654_5217 | 181 |
| 64 | 3300049674 | Ga0501242_017006 | Ga0501242_017006_323_871 | 181 |
| 65 | 3300049823 | Ga0501044_0000733 | Ga0501044_0000733_29794_30357 | 181 |
| 66 | 3300049823 | Ga0501044_0006757 | Ga0501044_0006757_1496_2053 | 181 |
| 67 | 3300053139 | Ga0500568_0009480 | Ga0500568_0009480_3884_4438 | 181 |
| 68 | 3300053151 | Ga0500604_0000013 | Ga0500604_0000013_78818_79372 | 181 |
| 69 | 3300053153 | Ga0500616_0000161 | Ga0500616_0000161_21949_22503 | 181 |
| 70 | 3300060353 | Ga0501082_0695992 | Ga0501082_0695992_53_616 | 181 |
| 71 | 3300001915 | JGI24741J21665_1007064 | JGI24741J21665_10070642 | 182 |
| 72 | 3300001979 | JGI24740J21852_10023388 | JGI24740J21852_100233882 | 182 |
| 73 | 3300001990 | JGI24737J22298_10002107 | JGI24737J22298_100021074 | 182 |
| 74 | 3300001990 | JGI24737J22298_10008118 | JGI24737J22298_100081185 | 182 |
| 75 | 3300003214 | JGI25165J46597_1000010 | JGI25165J46597_1000010156 | 182 |
| 76 | 3300003215 | JGI25153J46596_10000034 | JGI25153J46596_10000034163 | 182 |
| 77 | 3300003759 | Ga0055525_1000139 | Ga0055525_100013929 | 182 |
| 78 | 3300003771 | Ga0055526_1005294 | Ga0055526_10052949 | 182 |
| 79 | 3300003771 | Ga0055526_1027335 | Ga0055526_10273352 | 182 |
| 80 | 3300003773 | Ga0055537_1003446 | Ga0055537_10034466 | 182 |
| 81 | 3300003781 | Ga0055536_1019152 | Ga0055536_10191523 | 182 |
| 82 | 3300003791 | Ga0055530_10002624 | Ga0055530_100026246 | 182 |
| 83 | 3300003792 | Ga0055540_1001490 | Ga0055540_100149011 | 182 |
| 84 | 3300003794 | Ga0055531_10003511 | Ga0055531_100035116 | 182 |
| 85 | 3300005262 | Ga0065165_1109146 | Ga0065165_11091461 | 182 |
| 86 | 3300005327 | Ga0070658_10035480 | Ga0070658_100354807 | 182 |
| 87 | 3300005334 | Ga0068869_100218754 | Ga0068869_1002187542 | 182 |
| 88 | 3300005334 | Ga0068869_100565647 | Ga0068869_1005656472 | 182 |
| 89 | 3300005344 | Ga0070661_100071212 | Ga0070661_1000712122 | 182 |
| 90 | 3300005353 | Ga0070669_100148496 | Ga0070669_1001484963 | 182 |
| 91 | 3300005354 | Ga0070675_100090297 | Ga0070675_1000902974 | 182 |
| 92 | 3300005366 | Ga0070659_100496898 | Ga0070659_1004968982 | 182 |
| 93 | 3300005456 | Ga0070678_100001426 | Ga0070678_1000014263 | 182 |
| 94 | 3300005457 | Ga0070662_100345763 | Ga0070662_1003457632 | 182 |
| 95 | 3300005535 | Ga0070684_100425105 | Ga0070684_1004251052 | 182 |
| 96 | 3300005548 | Ga0070665_100000317 | Ga0070665_10000031739 | 182 |
| 97 | 3300005548 | Ga0070665_100197876 | Ga0070665_1001978762 | 182 |
| 98 | 3300005548 | Ga0070665_100356774 | Ga0070665_1003567742 | 182 |
| 99 | 3300005577 | Ga0068857_100183682 | Ga0068857_1001836822 | 182 |
| 100 | 3300005578 | Ga0068854_100095881 | Ga0068854_1000958813 | 182 |
| 101 | 3300005578 | Ga0068854_100375325 | Ga0068854_1003753252 | 182 |
| 102 | 3300005616 | Ga0068852_100262277 | Ga0068852_1002622773 | 182 |
| 103 | 3300005834 | Ga0068851_10188887 | Ga0068851_101888872 | 182 |
| 104 | 3300005841 | Ga0068863_100006311 | Ga0068863_1000063119 | 182 |
| 105 | 3300005841 | Ga0068863_100119426 | Ga0068863_1001194262 | 182 |
| 106 | 3300005842 | Ga0068858_100000274 | Ga0068858_10000027438 | 182 |
| 107 | 3300005843 | Ga0068860_100011180 | Ga0068860_1000111807 | 182 |
| 108 | 3300006195 | Ga0075366_10023802 | Ga0075366_100238023 | 182 |
| 109 | 3300006195 | Ga0075366_10302160 | Ga0075366_103021602 | 182 |
| 110 | 3300006237 | Ga0097621_101039670 | Ga0097621_1010396701 | 182 |
| 111 | 3300006353 | Ga0075370_10033030 | Ga0075370_100330302 | 182 |
| 112 | 3300006931 | Ga0097620_100018294 | Ga0097620_1000182947 | 182 |
| 113 | 3300009093 | Ga0105240_10841411 | Ga0105240_108414111 | 182 |
| 114 | 3300009098 | Ga0105245_10001591 | Ga0105245_1000159110 | 182 |
| 115 | 3300009101 | Ga0105247_10029277 | Ga0105247_100292775 | 182 |
| 116 | 3300009148 | Ga0105243_10001132 | Ga0105243_100011322 | 182 |
| 117 | 3300009148 | Ga0105243_10402728 | Ga0105243_104027283 | 182 |
| 118 | 3300009174 | Ga0105241_10027632 | Ga0105241_100276324 | 182 |
| 119 | 3300009551 | Ga0105238_10003777 | Ga0105238_100037774 | 182 |
| 120 | 3300009553 | Ga0105249_10000015 | Ga0105249_10000015266 | 182 |
| 121 | 3300010375 | Ga0105239_10668793 | Ga0105239_106687932 | 182 |
| 122 | 3300012475 | Ga0157317_1002740 | Ga0157317_10027402 | 182 |
| 123 | 3300013100 | Ga0157373_10049492 | Ga0157373_100494922 | 182 |
| 124 | 3300013102 | Ga0157371_10000452 | Ga0157371_1000045231 | 182 |
| 125 | 3300013102 | Ga0157371_10819308 | Ga0157371_108193081 | 182 |
| 126 | 3300013296 | Ga0157374_10843651 | Ga0157374_108436512 | 182 |
| 127 | 3300013297 | Ga0157378_10060790 | Ga0157378_100607902 | 182 |
| 128 | 3300013306 | Ga0163162_10095969 | Ga0163162_100959694 | 182 |
| 129 | 3300013306 | Ga0163162_12195557 | Ga0163162_121955571 | 182 |
| 130 | 3300013307 | Ga0157372_10418203 | Ga0157372_104182033 | 182 |
| 131 | 3300014326 | Ga0157380_10269301 | Ga0157380_102693012 | 182 |
| 132 | 3300017792 | Ga0163161_10143140 | Ga0163161_101431404 | 182 |
| 133 | 3300025226 | Ga0209674_112787 | Ga0209674_1127871 | 182 |
| 134 | 3300025230 | Ga0209563_100070 | Ga0209563_100070180 | 182 |
| 135 | 3300025233 | Ga0209437_109989 | Ga0209437_1099892 | 182 |
| 136 | 3300025246 | Ga0209646_1003232 | Ga0209646_10032322 | 182 |
| 137 | 3300025261 | Ga0209233_1000044 | Ga0209233_1000044327 | 182 |
| 138 | 3300025263 | Ga0209565_1000052 | Ga0209565_1000052165 | 182 |
| 139 | 3300025272 | Ga0209455_1028980 | Ga0209455_10289801 | 182 |
| 140 | 3300025292 | Ga0209676_1004959 | Ga0209676_10049597 | 182 |
| 141 | 3300025295 | Ga0209564_1000783 | Ga0209564_100078342 | 182 |
| 142 | 3300025295 | Ga0209564_1006593 | Ga0209564_10065936 | 182 |
| 143 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007633 | 182 |
| 144 | 3300025297 | Ga0209758_1011965 | Ga0209758_10119656 | 182 |
| 145 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001407 | 182 |
| 146 | 3300025298 | Ga0209050_1001214 | Ga0209050_100121414 | 182 |
| 147 | 3300025298 | Ga0209050_1035261 | Ga0209050_10352613 | 182 |
| 148 | 3300025303 | Ga0209051_1000297 | Ga0209051_100029727 | 182 |
| 149 | 3300025304 | Ga0209257_1001308 | Ga0209257_100130816 | 182 |
| 150 | 3300025900 | Ga0207710_10017344 | Ga0207710_100173444 | 182 |
| 151 | 3300025901 | Ga0207688_10071226 | Ga0207688_100712264 | 182 |
| 152 | 3300025904 | Ga0207647_10008921 | Ga0207647_100089219 | 182 |
| 153 | 3300025904 | Ga0207647_10038580 | Ga0207647_100385806 | 182 |
| 154 | 3300025909 | Ga0207705_10000512 | Ga0207705_1000051229 | 182 |
| 155 | 3300025911 | Ga0207654_10000500 | Ga0207654_1000050010 | 182 |
| 156 | 3300025913 | Ga0207695_10611866 | Ga0207695_106118661 | 182 |
| 157 | 3300025919 | Ga0207657_10029324 | Ga0207657_100293243 | 182 |
| 158 | 3300025920 | Ga0207649_10001188 | Ga0207649_100011887 | 182 |
| 159 | 3300025924 | Ga0207694_10030395 | Ga0207694_100303954 | 182 |
| 160 | 3300025924 | Ga0207694_10941180 | Ga0207694_109411802 | 182 |
| 161 | 3300025925 | Ga0207650_10473765 | Ga0207650_104737652 | 182 |
| 162 | 3300025926 | Ga0207659_10092631 | Ga0207659_100926313 | 182 |
| 163 | 3300025927 | Ga0207687_10001688 | Ga0207687_1000168813 | 182 |
| 164 | 3300025932 | Ga0207690_10000666 | Ga0207690_1000066614 | 182 |
| 165 | 3300025933 | Ga0207706_10755951 | Ga0207706_107559512 | 182 |
| 166 | 3300025935 | Ga0207709_10000005 | Ga0207709_10000005377 | 182 |
| 167 | 3300025935 | Ga0207709_10030137 | Ga0207709_100301374 | 182 |
| 168 | 3300025937 | Ga0207669_10000170 | Ga0207669_100001708 | 182 |
| 169 | 3300025937 | Ga0207669_10382926 | Ga0207669_103829263 | 182 |
| 170 | 3300025942 | Ga0207689_10170471 | Ga0207689_101704713 | 182 |
| 171 | 3300025944 | Ga0207661_10289509 | Ga0207661_102895092 | 182 |
| 172 | 3300025949 | Ga0207667_10000001 | Ga0207667_10000001929 | 182 |
| 173 | 3300025949 | Ga0207667_10485380 | Ga0207667_104853802 | 182 |
| 174 | 3300025961 | Ga0207712_10000023 | Ga0207712_1000002319 | 182 |
| 175 | 3300025972 | Ga0207668_10266276 | Ga0207668_102662761 | 182 |
| 176 | 3300025981 | Ga0207640_10002121 | Ga0207640_100021217 | 182 |
| 177 | 3300025986 | Ga0207658_10247304 | Ga0207658_102473042 | 182 |
| 178 | 3300026035 | Ga0207703_10001826 | Ga0207703_100018262 | 182 |
| 179 | 3300026041 | Ga0207639_10003983 | Ga0207639_100039834 | 182 |
| 180 | 3300026078 | Ga0207702_10003993 | Ga0207702_1000399311 | 182 |
| 181 | 3300026088 | Ga0207641_10004733 | Ga0207641_100047339 | 182 |
| 182 | 3300026088 | Ga0207641_10147784 | Ga0207641_101477842 | 182 |
| 183 | 3300026116 | Ga0207674_10183841 | Ga0207674_101838412 | 182 |
| 184 | 3300026116 | Ga0207674_10271775 | Ga0207674_102717752 | 182 |
| 185 | 3300026121 | Ga0207683_10021168 | Ga0207683_100211683 | 182 |
| 186 | 3300026142 | Ga0207698_10311000 | Ga0207698_103110002 | 182 |
| 187 | 3300028379 | Ga0268266_10000002 | Ga0268266_10000002494 | 182 |
| 188 | 3300028379 | Ga0268266_10000388 | Ga0268266_1000038839 | 182 |
| 189 | 3300028379 | Ga0268266_10823044 | Ga0268266_108230442 | 182 |
| 190 | 3300028381 | Ga0268264_10000990 | Ga0268264_100009908 | 182 |
| 191 | 3300028786 | Ga0307517_10092445 | Ga0307517_100924453 | 182 |
| 192 | 3300031456 | Ga0307513_10030657 | Ga0307513_100306577 | 182 |
| 193 | 3300031507 | Ga0307509_10016195 | Ga0307509_100161958 | 182 |
| 194 | 3300031507 | Ga0307509_10265489 | Ga0307509_102654892 | 182 |
| 195 | 3300031616 | Ga0307508_10000011 | Ga0307508_1000001167 | 182 |
| 196 | 3300033180 | Ga0307510_10031059 | Ga0307510_100310594 | 182 |
| 197 | 3300037312 | Ga0395899_0074500 | Ga0395899_0074500_712_1293 | 182 |
| 198 | 3300041443 | Ga0451789_0535598 | Ga0451789_0535598_38_595 | 182 |
| 199 | 3300041456 | Ga0451795_0562533 | Ga0451795_0562533_314_895 | 182 |
| 200 | 3300041512 | Ga0451853_2476269 | Ga0451853_2476269_258_839 | 182 |
| 201 | 3300042005 | Ga0439448_0080365 | Ga0439448_0080365_389_970 | 182 |
| 202 | 3300046460 | Ga0495638_0000741 | Ga0495638_0000741_23172_23723 | 182 |
| 203 | 3300046471 | Ga0495650_0000364 | Ga0495650_0000364_63059_63640 | 182 |
| 204 | 3300046491 | Ga0495584_0021302 | Ga0495584_0021302_423_1004 | 182 |
| 205 | 3300046491 | Ga0495584_0126571 | Ga0495584_0126571_131_712 | 182 |
| 206 | 3300046492 | Ga0495585_0012292 | Ga0495585_0012292_2663_3214 | 182 |
| 207 | 3300046492 | Ga0495585_0317621 | Ga0495585_0317621_106_687 | 182 |
| 208 | 3300046500 | Ga0495596_0012944 | Ga0495596_0012944_2139_2720 | 182 |
| 209 | 3300046506 | Ga0495583_0000311 | Ga0495583_0000311_25573_26154 | 182 |
| 210 | 3300046506 | Ga0495583_0008509 | Ga0495583_0008509_5176_5757 | 182 |
| 211 | 3300046506 | Ga0495583_0018405 | Ga0495583_0018405_2632_3213 | 182 |
| 212 | 3300046507 | Ga0495606_0001040 | Ga0495606_0001040_856_1437 | 182 |
| 213 | 3300046507 | Ga0495606_0100990 | Ga0495606_0100990_283_876 | 182 |
| 214 | 3300046520 | Ga0495637_0033787 | Ga0495637_0033787_67_648 | 182 |
| 215 | 3300046520 | Ga0495637_0087106 | Ga0495637_0087106_145_726 | 182 |
| 216 | 3300046522 | Ga0495643_0002504 | Ga0495643_0002504_3417_3998 | 182 |
| 217 | 3300046522 | Ga0495643_0069584 | Ga0495643_0069584_1108_1689 | 182 |
| 218 | 3300046522 | Ga0495643_0150976 | Ga0495643_0150976_114_707 | 182 |
| 219 | 3300046522 | Ga0495643_0325696 | Ga0495643_0325696_84_665 | 182 |
| 220 | 3300046525 | Ga0495663_0000779 | Ga0495663_0000779_274_855 | 182 |
| 221 | 3300046525 | Ga0495663_0041390 | Ga0495663_0041390_374_925 | 182 |
| 222 | 3300046526 | Ga0495666_0058419 | Ga0495666_0058419_456_1040 | 182 |
| 223 | 3300046528 | Ga0495642_0015173 | Ga0495642_0015173_2154_2747 | 182 |
| 224 | 3300046528 | Ga0495642_0022743 | Ga0495642_0022743_121_678 | 182 |
| 225 | 3300046529 | Ga0495652_0221747 | Ga0495652_0221747_738_1289 | 182 |
| 226 | 3300046542 | Ga0495597_0030318 | Ga0495597_0030318_393_974 | 182 |
| 227 | 3300046558 | Ga0495633_0000538 | Ga0495633_0000538_16286_16867 | 182 |
| 228 | 3300046558 | Ga0495633_0015533 | Ga0495633_0015533_2735_3316 | 182 |
| 229 | 3300046616 | Ga0495668_0000468 | Ga0495668_0000468_23196_23777 | 182 |
| 230 | 3300046616 | Ga0495668_0024051 | Ga0495668_0024051_278_859 | 182 |
| 231 | 3300046648 | Ga0495611_0007586 | Ga0495611_0007586_392_973 | 182 |
| 232 | 3300046660 | Ga0495625_0000094 | Ga0495625_0000094_23154_23705 | 182 |
| 233 | 3300046660 | Ga0495625_0002092 | Ga0495625_0002092_21436_22017 | 182 |
| 234 | 3300046660 | Ga0495625_0009614 | Ga0495625_0009614_6905_7486 | 182 |
| 235 | 3300046660 | Ga0495625_0022650 | Ga0495625_0022650_504_1055 | 182 |
| 236 | 3300046660 | Ga0495625_0199048 | Ga0495625_0199048_669_1250 | 182 |
| 237 | 3300046684 | Ga0495669_0000118 | Ga0495669_0000118_26995_27576 | 182 |
| 238 | 3300046691 | Ga0495670_0000016 | Ga0495670_0000016_24811_25362 | 182 |
| 239 | 3300046691 | Ga0495670_0002812 | Ga0495670_0002812_2392_2943 | 182 |
| 240 | 3300046691 | Ga0495670_0104567 | Ga0495670_0104567_144_695 | 182 |
| 241 | 3300046691 | Ga0495670_0134104 | Ga0495670_0134104_40_591 | 182 |
| 242 | 3300046694 | Ga0495649_0056953 | Ga0495649_0056953_1085_1666 | 182 |
| 243 | 3300046809 | Ga0495600_0000858 | Ga0495600_0000858_15539_16120 | 182 |
| 244 | 3300046810 | Ga0495660_0031843 | Ga0495660_0031843_245_826 | 182 |
| 245 | 3300047323 | Ga0495683_0083976 | Ga0495683_0083976_738_1319 | 182 |
| 246 | 3300047443 | Ga0495687_000499 | Ga0495687_000499_29850_30431 | 182 |
| 247 | 3300047445 | Ga0495677_0001980 | Ga0495677_0001980_7284_7877 | 182 |
| 248 | 3300047470 | Ga0495681_0201417 | Ga0495681_0201417_49_600 | 182 |
| 249 | 3300047472 | Ga0495686_0013024 | Ga0495686_0013024_5046_5597 | 182 |
| 250 | 3300047472 | Ga0495686_0048711 | Ga0495686_0048711_744_1295 | 182 |
| 251 | 3300048904 | Ga0496101_0377883 | Ga0496101_0377883_509_1084 | 182 |
| 252 | 3300048905 | Ga0496102_0000022 | Ga0496102_0000022_15978_16553 | 182 |
| 253 | 3300048906 | Ga0496103_0000075 | Ga0496103_0000075_16222_16797 | 182 |
| 254 | 3300048907 | Ga0496104_0008397 | Ga0496104_0008397_7088_7663 | 182 |
| 255 | 3300048908 | Ga0496105_0013090 | Ga0496105_0013090_3704_4279 | 182 |
| 256 | 3300048912 | Ga0496109_0399266 | Ga0496109_0399266_653_1234 | 182 |
| 257 | 3300048913 | Ga0496110_0004080 | Ga0496110_0004080_10203_10778 | 182 |
| 258 | 3300048914 | Ga0496111_0015353 | Ga0496111_0015353_2638_3213 | 182 |
| 259 | 3300048917 | Ga0496114_0011288 | Ga0496114_0011288_2040_2615 | 182 |
| 260 | 3300048918 | Ga0496115_0000384 | Ga0496115_0000384_10764_11339 | 182 |
| 261 | 3300048919 | Ga0496116_0004132 | Ga0496116_0004132_10770_11345 | 182 |
| 262 | 3300048920 | Ga0496117_0000439 | Ga0496117_0000439_60759_61334 | 182 |
| 263 | 3300048921 | Ga0496118_0000039 | Ga0496118_0000039_106877_107452 | 182 |
| 264 | 3300048922 | Ga0496119_0009148 | Ga0496119_0009148_4169_4744 | 182 |
| 265 | 3300048923 | Ga0496120_0021297 | Ga0496120_0021297_2115_2690 | 182 |
| 266 | 3300048924 | Ga0496121_0000269 | Ga0496121_0000269_10768_11343 | 182 |
| 267 | 3300048924 | Ga0496121_0116075 | Ga0496121_0116075_1408_1959 | 182 |
| 268 | 3300048925 | Ga0496122_0009622 | Ga0496122_0009622_4549_5130 | 182 |
| 269 | 3300048926 | Ga0496123_0071563 | Ga0496123_0071563_1160_1741 | 182 |
| 270 | 3300048926 | Ga0496123_0159762 | Ga0496123_0159762_342_890 | 182 |
| 271 | 3300048927 | Ga0496124_0000076 | Ga0496124_0000076_198916_199491 | 182 |
| 272 | 3300048928 | Ga0496125_0031798 | Ga0496125_0031798_1901_2482 | 182 |
| 273 | 3300048929 | Ga0496126_0001584 | Ga0496126_0001584_23367_23942 | 182 |
| 274 | 3300050493 | nmdc:mga0k408_96666_c1 | nmdc:mga0k408_96666_c1_933_1514 | 182 |
| 275 | 3300050496 | nmdc:mga07m45_375422_c1 | nmdc:mga07m45_375422_c1_229_780 | 182 |
| 276 | 3300050496 | nmdc:mga07m45_599720_c1 | nmdc:mga07m45_599720_c1_40_588 | 182 |
| 277 | 3300053079 | Ga0500610_0005178 | Ga0500610_0005178_4275_4856 | 182 |
| 278 | 3300053093 | Ga0500651_0081476 | Ga0500651_0081476_1043_1594 | 182 |
| 279 | 3300053096 | Ga0500641_0013346 | Ga0500641_0013346_533_1084 | 182 |
| 280 | 3300053096 | Ga0500641_0122662 | Ga0500641_0122662_302_853 | 182 |
| 281 | 3300053104 | Ga0500556_0126607 | Ga0500556_0126607_256_819 | 182 |
| 282 | 3300053108 | Ga0500562_024339 | Ga0500562_024339_837_1388 | 182 |
| 283 | 3300053119 | Ga0500595_001071 | Ga0500595_001071_1561_2109 | 182 |
| 284 | 3300053122 | Ga0500608_298052 | Ga0500608_298052_30_581 | 182 |
| 285 | 3300053130 | Ga0500642_0001699 | Ga0500642_0001699_1990_2571 | 182 |
| 286 | 3300053131 | Ga0500652_130492 | Ga0500652_130492_28_579 | 182 |
| 287 | 3300053134 | Ga0500658_0001088 | Ga0500658_0001088_2013_2564 | 182 |
| 288 | 3300053136 | Ga0500559_0005175 | Ga0500559_0005175_3254_3805 | 182 |
| 289 | 3300053136 | Ga0500559_0097064 | Ga0500559_0097064_482_1033 | 182 |
| 290 | 3300053139 | Ga0500568_0125027 | Ga0500568_0125027_390_941 | 182 |
| 291 | 3300053153 | Ga0500616_0035942 | Ga0500616_0035942_709_1260 | 182 |
| 292 | 3300053177 | Ga0500636_0103885 | Ga0500636_0103885_136_717 | 182 |
| 293 | 3300053177 | Ga0500636_0223263 | Ga0500636_0223263_362_913 | 182 |
| 294 | 3300053730 | Ga0500645_000003 | Ga0500645_000003_20960_21541 | 182 |
| 295 | 3300053730 | Ga0500645_000924 | Ga0500645_000924_13632_14195 | 182 |
| 296 | 3300053730 | Ga0500645_012970 | Ga0500645_012970_1565_2221 | 182 |
| 297 | 3300053731 | Ga0500609_015674 | Ga0500609_015674_402_983 | 182 |
| 298 | 3300053735 | Ga0500596_015630 | Ga0500596_015630_514_1095 | 182 |
| 299 | 3300055283 | Ga0500661_014092 | Ga0500661_014092_492_1043 | 182 |
| 300 | 3300055283 | Ga0500661_019135 | Ga0500661_019135_475_1056 | 182 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2htd-assembly1.cif.gz_A | crystal structure of a putative pyridoxamine 5'-phosphate oxidase (ldb0262) from lactobacillus delbrueckii subsp. at 1.60 a resolution | 0.8399 | 5 | 127 |
| 3amf-assembly1.cif.gz_B | e13r mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) | 0.8112 | 8 | 130 |
| 3vy2-assembly1.cif.gz_B | n33d mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) | 0.81 | 8 | 130 |
| 7kq2-assembly1.cif.gz_A | 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 | 0.8075 | 8 | 130 |
| 3a6q-assembly1.cif.gz_B | e13t mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) | 0.8064 | 8 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5escD00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8024 | 8 | 127 | 2.30.110.10 |
| 1wliA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7995 | 8 | 130 | 2.30.110.10 |
| 1wliA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7818 | 8 | 130 | 2.30.110.10 |
| 5escD00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7657 | 8 | 127 | 2.30.110.10 |
| af_Q57730_15_149_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7298 | 8 | 127 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W5KBI7-F1-model_v4 | Putative pyridoxine 5'-phosphate oxidase superfamily flavin-nucleotide-binding protein | 0.9756 | 1 | 182 |
|
| AF-A0A0B8ZV90-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase-like FMN-binding protein | 0.9724 | 1 | 178 |
|
| AF-A0A2N0H6X8-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.9713 | 1 | 179 |
|
| AF-A0A7W5KBI7-F1-model_v4 | Putative pyridoxine 5'-phosphate oxidase superfamily flavin-nucleotide-binding protein | 0.9703 | 1 | 182 |
|
| AF-A0A7V9YQK6-F1-model_v4 | deleted | 0.9674 | 1 | 182 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar