F395618

General Info

Members Datasets Scaffolds Average Seq Length
300 216 300 183

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_012970|Ga0500645_012970_1565_2221
Length 218
Sequence MRARLIAPWPPVNPGRAAYLAVPLPPVYLAGMADFFEALNEAHRGFIAKQPVFFVATAAEGARINLSPKGMDCFRVLDERTVAYLDVAGSGNETNAHLLADGRITIMFCAFESPALIFRIYGRGTPVLPQDDRWAELAPHFTLLPGTRQIFVVDIDNVQTSCGWGVPHMAFERERETLSKYHVKHGEEVRFAKYAVRTRSIDGLPVRNPSGAPTDGAG

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
62 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
119 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
120 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
121 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
124 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
129 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
196 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
200 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
203 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
204 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
205 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
206 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
209 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
213 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
214 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
215 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23
Nodule 0
Rhizoplane 4
Rhizosphere 65
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1007064 3300001915 Bacteria 2204
2 JGI24740J21852_10023388 3300001979 Bacteria 2112
3 JGI24737J22298_10002107 3300001990 Bacteria 7096
4 JGI24737J22298_10008118 3300001990 Bacteria 3529
5 JGI25165J46597_1000010 3300003214 Bacteria 442113
6 JGI25153J46596_10000034 3300003215 Bacteria 192215
7 Ga0055525_1000139 3300003759 Bacteria 102623
8 Ga0055542_1000012 3300003762 Bacteria 391808
9 Ga0055529_1000004 3300003763 Bacteria 433331
10 Ga0055526_1005294 3300003771 Bacteria 7471
11 Ga0055526_1027335 3300003771 Bacteria 1766
12 Ga0055537_1003446 3300003773 Bacteria 4863
13 Ga0055536_1019152 3300003781 Bacteria 2163
14 Ga0055530_10002624 3300003791 Bacteria 11287
15 Ga0055540_1001490 3300003792 Bacteria 13910
16 Ga0055531_10003511 3300003794 Bacteria 9966
17 JGI25405J52794_10014963 3300003911 Bacteria 1520
18 Ga0065165_1109146 3300005262 Bacteria 683
19 Ga0070658_10035480 3300005327 Bacteria 4017
20 Ga0068869_100218754 3300005334 Bacteria 1509
21 Ga0068869_100565647 3300005334 Bacteria 957
22 Ga0070661_100071212 3300005344 Bacteria 2558
23 Ga0070669_100148496 3300005353 Bacteria 1813
24 Ga0070675_100090297 3300005354 Bacteria 2566
25 Ga0070659_100496898 3300005366 Bacteria 1039
26 Ga0070678_100001426 3300005456 Bacteria 12735
27 Ga0070662_100345763 3300005457 Bacteria 1217
28 Ga0070684_100425105 3300005535 Bacteria 1227
29 Ga0070665_100000317 3300005548 Bacteria 74997
30 Ga0070665_100197876 3300005548 Bacteria 2010
31 Ga0070665_100356774 3300005548 Bacteria 1468
32 Ga0068855_100201849 3300005563 Bacteria 2238
33 Ga0068857_100183682 3300005577 Bacteria 1903
34 Ga0068854_100095881 3300005578 Bacteria 2215
35 Ga0068854_100375325 3300005578 Bacteria 1170
36 Ga0068854_100548149 3300005578 Bacteria 980
37 Ga0068852_100262277 3300005616 Bacteria 1659
38 Ga0068851_10188887 3300005834 Bacteria 1144
39 Ga0068863_100006311 3300005841 Bacteria 11635
40 Ga0068863_100119426 3300005841 Bacteria 2513
41 Ga0068858_100000274 3300005842 Bacteria 55319
42 Ga0068860_100011180 3300005843 Bacteria 8847
43 Ga0081455_10000552 3300005937 Bacteria 48660
44 Ga0081455_10001022 3300005937 Bacteria 35293
45 Ga0070717_10401627 3300006028 Bacteria 1231
46 Ga0075366_10023802 3300006195 Bacteria 3569
47 Ga0075366_10302160 3300006195 Bacteria 979
48 Ga0097621_101039670 3300006237 Bacteria 767
49 Ga0075370_10033030 3300006353 Bacteria 2895
50 Ga0097620_100018294 3300006931 Bacteria 7044
51 Ga0105240_10030710 3300009093 Bacteria 6979
52 Ga0105240_10841411 3300009093 Bacteria 991
53 Ga0105245_10001591 3300009098 Bacteria 20657
54 Ga0105247_10029277 3300009101 Bacteria 3336
55 Ga0105243_10001132 3300009148 Bacteria 24182
56 Ga0105243_10402728 3300009148 Bacteria 1272
57 Ga0105241_10027632 3300009174 Bacteria 4226
58 Ga0105241_11297432 3300009174 Bacteria 693
59 Ga0105248_10508848 3300009177 Bacteria 1358
60 Ga0105238_10003777 3300009551 Bacteria 15046
61 Ga0105249_10000015 3300009553 Bacteria 282138
62 Ga0105239_10668793 3300010375 Bacteria 1186
63 Ga0157317_1002740 3300012475 Bacteria 1059
64 Ga0157373_10049492 3300013100 Bacteria 2995
65 Ga0157371_10000452 3300013102 Bacteria 50337
66 Ga0157371_10819308 3300013102 Bacteria 702
67 Ga0157374_10843651 3300013296 Bacteria 933
68 Ga0157378_10060790 3300013297 Bacteria 3371
69 Ga0163162_10095969 3300013306 Bacteria 3053
70 Ga0163162_12195557 3300013306 Bacteria 634
71 Ga0157372_10418203 3300013307 Bacteria 1562
72 Ga0163163_10807486 3300014325 Bacteria 1001
73 Ga0157380_10269301 3300014326 Bacteria 1552
74 Ga0163161_10143140 3300017792 Bacteria 1811
75 Ga0206356_11749622 3300020070 Bacteria 1861
76 Ga0206355_1181064 3300020076 Bacteria 1853
77 Ga0206350_10943281 3300020080 Bacteria 2713
78 Ga0206353_11854900 3300020082 Bacteria 812
79 Ga0224712_10250646 3300022467 Unclassified 818
80 Ga0209674_103598 3300025226 Bacteria 2794
81 Ga0209674_112787 3300025226 Bacteria 805
82 Ga0209563_100070 3300025230 Bacteria 249779
83 Ga0209437_109989 3300025233 Bacteria 1462
84 Ga0209646_1003232 3300025246 Bacteria 3269
85 Ga0209677_103628 3300025253 Bacteria 4874
86 Ga0209148_1000008 3300025254 Bacteria 1504371
87 Ga0209233_1000044 3300025261 Bacteria 489783
88 Ga0209565_1000052 3300025263 Bacteria 212056
89 Ga0209455_1000002 3300025272 Bacteria 1505459
90 Ga0209455_1028980 3300025272 Bacteria 961
91 Ga0209676_1004959 3300025292 Bacteria 7146
92 Ga0209564_1000783 3300025295 Bacteria 44071
93 Ga0209564_1006593 3300025295 Bacteria 6222
94 Ga0209758_1000007 3300025297 Bacteria 1270410
95 Ga0209758_1011965 3300025297 Bacteria 4932
96 Ga0209050_1000001 3300025298 Bacteria 3563507
97 Ga0209050_1001214 3300025298 Bacteria 30169
98 Ga0209050_1035261 3300025298 Bacteria 1482
99 Ga0209051_1000297 3300025303 Bacteria 79062
100 Ga0209257_1001308 3300025304 Bacteria 30326
101 Ga0207710_10017344 3300025900 Bacteria 3053
102 Ga0207688_10071226 3300025901 Bacteria 1973
103 Ga0207647_10008921 3300025904 Bacteria 7151
104 Ga0207647_10038580 3300025904 Bacteria 3019
105 Ga0207705_10000512 3300025909 Bacteria 33029
106 Ga0207654_10000500 3300025911 Bacteria 22386
107 Ga0207654_10868813 3300025911 Unclassified 653
108 Ga0207695_10017382 3300025913 Bacteria 8369
109 Ga0207695_10611866 3300025913 Bacteria 971
110 Ga0207657_10029324 3300025919 Bacteria 5011
111 Ga0207649_10001188 3300025920 Bacteria 15686
112 Ga0207694_10030395 3300025924 Bacteria 4125
113 Ga0207694_10941180 3300025924 Bacteria 731
114 Ga0207650_10473765 3300025925 Bacteria 1044
115 Ga0207659_10092631 3300025926 Bacteria 2260
116 Ga0207687_10001688 3300025927 Bacteria 15211
117 Ga0207690_10000666 3300025932 Bacteria 21974
118 Ga0207706_10755951 3300025933 Bacteria 828
119 Ga0207709_10000005 3300025935 Bacteria 806813
120 Ga0207709_10030137 3300025935 Bacteria 3153
121 Ga0207669_10000170 3300025937 Bacteria 30685
122 Ga0207669_10382926 3300025937 Bacteria 1096
123 Ga0207689_10170471 3300025942 Bacteria 1794
124 Ga0207661_10289509 3300025944 Bacteria 1466
125 Ga0207667_10000001 3300025949 Bacteria 1178522
126 Ga0207667_10012901 3300025949 Bacteria 9599
127 Ga0207667_10485380 3300025949 Bacteria 1254
128 Ga0207712_10000023 3300025961 Bacteria 282081
129 Ga0207668_10266276 3300025972 Bacteria 1399
130 Ga0207640_10002121 3300025981 Bacteria 10647
131 Ga0207658_10247304 3300025986 Bacteria 1514
132 Ga0207703_10001826 3300026035 Bacteria 18987
133 Ga0207639_10003983 3300026041 Bacteria 9971
134 Ga0207702_10003993 3300026078 Bacteria 13247
135 Ga0207641_10004733 3300026088 Bacteria 11734
136 Ga0207641_10147784 3300026088 Bacteria 2126
137 Ga0207674_10183841 3300026116 Bacteria 2041
138 Ga0207674_10271775 3300026116 Bacteria 1642
139 Ga0207683_10021168 3300026121 Bacteria 5565
140 Ga0207698_10311000 3300026142 Bacteria 1471
141 Ga0268266_10000002 3300028379 Bacteria 3059047
142 Ga0268266_10000388 3300028379 Bacteria 66871
143 Ga0268266_10823044 3300028379 Bacteria 897
144 Ga0268264_10000990 3300028381 Bacteria 28980
145 Ga0307517_10092445 3300028786 Bacteria 2461
146 Ga0307513_10030657 3300031456 Bacteria 6107
147 Ga0307513_10066538 3300031456 Bacteria 3785
148 Ga0307509_10016195 3300031507 Bacteria 8639
149 Ga0307509_10265489 3300031507 Bacteria 1488
150 Ga0307508_10000011 3300031616 Bacteria 248001
151 Ga0316579_10000170 3300031691 Bacteria 18884
152 Ga0316579_10013865 3300031691 Bacteria 3476
153 Ga0316579_10099972 3300031691 Bacteria 1388
154 Ga0265342_10303359 3300031712 Bacteria 841
155 Ga0316578_10005815 3300031728 Bacteria 6029
156 Ga0316578_10092207 3300031728 Bacteria 1810
157 Ga0316583_10003049 3300032133 Bacteria 5879
158 Ga0316583_10003698 3300032133 Bacteria 5407
159 Ga0316585_10042353 3300032137 Bacteria 1452
160 Ga0316580_10074867 3300032139 Unclassified 1036
161 Ga0307510_10031059 3300033180 Bacteria 6040
162 Ga0316582_0002560 3300036647 Bacteria 8604
163 Ga0316582_0006811 3300036647 Bacteria 6036
164 Ga0316582_0009651 3300036647 Bacteria 5246
165 Ga0316584_0016575 3300036712 Bacteria 5283
166 Ga0316584_0062974 3300036712 Bacteria 2777
167 Ga0316584_0213664 3300036712 Bacteria 1419
168 Ga0316584_0249854 3300036712 Bacteria 1296
169 Ga0395899_0074500 3300037312 Bacteria 2480
170 Ga0316581_0001359 3300037588 Bacteria 5446
171 Ga0316581_0007543 3300037588 Bacteria 2925
172 Ga0436364_0498149 3300037853 Bacteria 1323
173 Ga0451789_0535598 3300041443 Bacteria 724
174 Ga0451795_0562533 3300041456 Bacteria 1154
175 Ga0451853_2476269 3300041512 Bacteria 959
176 Ga0439448_0080365 3300042005 Bacteria 1094
177 Ga0453684_0430232 3300044712 Unclassified 1473
178 Ga0495638_0000741 3300046460 Bacteria 35061
179 Ga0495650_0000364 3300046471 Bacteria 79811
180 Ga0495639_0132536 3300046475 Bacteria 1194
181 Ga0495584_0021302 3300046491 Bacteria 3294
182 Ga0495584_0126571 3300046491 Bacteria 1295
183 Ga0495585_0012292 3300046492 Bacteria 5043
184 Ga0495585_0064889 3300046492 Bacteria 2001
185 Ga0495585_0317621 3300046492 Bacteria 762
186 Ga0495596_0012944 3300046500 Bacteria 3554
187 Ga0495583_0000311 3300046506 Bacteria 76925
188 Ga0495583_0008509 3300046506 Bacteria 6261
189 Ga0495583_0018405 3300046506 Bacteria 3677
190 Ga0495606_0001040 3300046507 Bacteria 40138
191 Ga0495606_0100990 3300046507 Bacteria 1756
192 Ga0495637_0033787 3300046520 Bacteria 2244
193 Ga0495637_0087106 3300046520 Bacteria 1237
194 Ga0495643_0002504 3300046522 Bacteria 14435
195 Ga0495643_0069584 3300046522 Bacteria 1849
196 Ga0495643_0150976 3300046522 Bacteria 1150
197 Ga0495643_0325696 3300046522 Bacteria 693
198 Ga0495648_0000387 3300046524 Bacteria 48332
199 Ga0495648_0161505 3300046524 Bacteria 1158
200 Ga0495663_0000779 3300046525 Bacteria 10894
201 Ga0495663_0041390 3300046525 Bacteria 1401
202 Ga0495666_0058419 3300046526 Bacteria 1845
203 Ga0495642_0015173 3300046528 Bacteria 2990
204 Ga0495642_0022743 3300046528 Bacteria 2471
205 Ga0495652_0221747 3300046529 Bacteria 1421
206 Ga0495597_0030318 3300046542 Bacteria 2465
207 Ga0495633_0000538 3300046558 Bacteria 37829
208 Ga0495633_0015533 3300046558 Bacteria 3947
209 Ga0495668_0000468 3300046616 Bacteria 51229
210 Ga0495668_0024051 3300046616 Bacteria 3467
211 Ga0495611_0007586 3300046648 Bacteria 4602
212 Ga0495625_0000094 3300046660 Bacteria 144517
213 Ga0495625_0002092 3300046660 Bacteria 22304
214 Ga0495625_0009614 3300046660 Bacteria 8069
215 Ga0495625_0022650 3300046660 Bacteria 4813
216 Ga0495625_0199048 3300046660 Bacteria 1323
217 Ga0495661_0039618 3300046665 Bacteria 2927
218 Ga0495669_0000118 3300046684 Bacteria 51189
219 Ga0495613_0318948 3300046689 Bacteria 1073
220 Ga0495670_0000016 3300046691 Bacteria 128045
221 Ga0495670_0002812 3300046691 Bacteria 8611
222 Ga0495670_0104567 3300046691 Bacteria 1461
223 Ga0495670_0134104 3300046691 Bacteria 1292
224 Ga0495649_0056953 3300046694 Bacteria 2108
225 Ga0495600_0000858 3300046809 Bacteria 16218
226 Ga0495660_0031843 3300046810 Bacteria 2963
227 Ga0495683_0006599 3300047323 Bacteria 6328
228 Ga0495683_0083976 3300047323 Bacteria 1550
229 Ga0495687_000499 3300047443 Bacteria 47300
230 Ga0495677_0001980 3300047445 Bacteria 8171
231 Ga0495681_0201417 3300047470 Bacteria 807
232 Ga0495686_0013024 3300047472 Bacteria 5792
233 Ga0495686_0048711 3300047472 Bacteria 2670
234 Ga0496101_0377883 3300048904 Bacteria 1115
235 Ga0496102_0000022 3300048905 Bacteria 246314
236 Ga0496103_0000075 3300048906 Bacteria 114569
237 Ga0496104_0008397 3300048907 Bacteria 9180
238 Ga0496105_0013090 3300048908 Bacteria 6577
239 Ga0496109_0399266 3300048912 Bacteria 1299
240 Ga0496110_0004080 3300048913 Bacteria 11274
241 Ga0496111_0015353 3300048914 Bacteria 5254
242 Ga0496114_0011288 3300048917 Bacteria 7133
243 Ga0496115_0000384 3300048918 Bacteria 36457
244 Ga0496116_0004132 3300048919 Bacteria 13988
245 Ga0496117_0000439 3300048920 Bacteria 69213
246 Ga0496118_0000039 3300048921 Bacteria 305458
247 Ga0496119_0009148 3300048922 Bacteria 8564
248 Ga0496120_0021297 3300048923 Bacteria 4099
249 Ga0496121_0000269 3300048924 Bacteria 108869
250 Ga0496121_0116075 3300048924 Bacteria 2031
251 Ga0496122_0009622 3300048925 Bacteria 10124
252 Ga0496123_0071563 3300048926 Bacteria 2162
253 Ga0496123_0159762 3300048926 Bacteria 1203
254 Ga0496124_0000076 3300048927 Bacteria 215767
255 Ga0496125_0031798 3300048928 Bacteria 4697
256 Ga0496126_0001584 3300048929 Bacteria 34722
257 Ga0496126_0208529 3300048929 Unclassified 1646
258 Ga0501032_0045784 3300049569 Bacteria 2958
259 Ga0501034_0004238 3300049571 Bacteria 16003
260 Ga0501034_0029928 3300049571 Bacteria 5535
261 Ga0501037_0072069 3300049573 Bacteria 2513
262 Ga0501047_0030117 3300049581 Bacteria 5233
263 Ga0501242_017006 3300049674 Bacteria 914
264 Ga0501080_0113383 3300049742 Bacteria 2513
265 Ga0501044_0000733 3300049823 Bacteria 39526
266 Ga0501044_0006757 3300049823 Bacteria 12645
267 nmdc:mga0k408_96666_c1 3300050493 Bacteria 1739
268 nmdc:mga07m45_375422_c1 3300050496 Bacteria 826
269 nmdc:mga07m45_599720_c1 3300050496 Bacteria 636
270 Ga0500610_0005178 3300053079 Bacteria 5310
271 Ga0500647_0062159 3300053091 Bacteria 1797
272 Ga0500651_0081476 3300053093 Bacteria 2004
273 Ga0500641_0013346 3300053096 Bacteria 3017
274 Ga0500641_0122662 3300053096 Bacteria 1120
275 Ga0500556_0126607 3300053104 Bacteria 999
276 Ga0500562_024339 3300053108 Bacteria 1583
277 Ga0500595_001071 3300053119 Bacteria 15187
278 Ga0500595_001233 3300053119 Bacteria 14110
279 Ga0500608_298052 3300053122 Bacteria 600
280 Ga0500642_0001699 3300053130 Bacteria 6350
281 Ga0500652_130492 3300053131 Bacteria 1049
282 Ga0500658_0001088 3300053134 Bacteria 11124
283 Ga0500559_0005175 3300053136 Bacteria 6023
284 Ga0500559_0097064 3300053136 Bacteria 1354
285 Ga0500568_0009480 3300053139 Bacteria 4617
286 Ga0500568_0125027 3300053139 Bacteria 957
287 Ga0500585_195176 3300053144 Bacteria 678
288 Ga0500604_0000013 3300053151 Bacteria 92467
289 Ga0500616_0000161 3300053153 Bacteria 111424
290 Ga0500616_0035942 3300053153 Bacteria 2691
291 Ga0500636_0103885 3300053177 Bacteria 1612
292 Ga0500636_0223263 3300053177 Bacteria 980
293 Ga0500645_000003 3300053730 Bacteria 305887
294 Ga0500645_000924 3300053730 Bacteria 16899
295 Ga0500645_012970 3300053730 Bacteria 2684
296 Ga0500609_015674 3300053731 Bacteria 1027
297 Ga0500596_015630 3300053735 Bacteria 1139
298 Ga0500661_014092 3300055283 Bacteria 1440
299 Ga0500661_019135 3300055283 Bacteria 1219
300 Ga0501082_0695992 3300060353 Bacteria 889

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0113383 Ga0501080_0113383_10_477 149
2 3300009177 Ga0105248_10508848 Ga0105248_105088482 176
3 3300046524 Ga0495648_0161505 Ga0495648_0161505_470_1030 176
4 3300046689 Ga0495613_0318948 Ga0495613_0318948_91_627 176
5 3300003762 Ga0055542_1000012 Ga0055542_100001282 177
6 3300003763 Ga0055529_1000004 Ga0055529_1000004225 177
7 3300025226 Ga0209674_103598 Ga0209674_1035982 177
8 3300025254 Ga0209148_1000008 Ga0209148_1000008715 177
9 3300025272 Ga0209455_1000002 Ga0209455_1000002709 177
10 3300031456 Ga0307513_10066538 Ga0307513_100665384 177
11 3300046524 Ga0495648_0000387 Ga0495648_0000387_8875_9450 177
12 3300047323 Ga0495683_0006599 Ga0495683_0006599_1156_1731 177
13 3300053144 Ga0500585_195176 Ga0500585_195176_72_665 177
14 3300003911 JGI25405J52794_10014963 JGI25405J52794_100149632 178
15 3300005937 Ga0081455_10001022 Ga0081455_1000102228 178
16 3300046665 Ga0495661_0039618 Ga0495661_0039618_2181_2774 178
17 3300005563 Ga0068855_100201849 Ga0068855_1002018493 179
18 3300005578 Ga0068854_100548149 Ga0068854_1005481491 179
19 3300009093 Ga0105240_10030710 Ga0105240_100307104 179
20 3300025911 Ga0207654_10868813 Ga0207654_108688131 179
21 3300025913 Ga0207695_10017382 Ga0207695_100173824 179
22 3300025949 Ga0207667_10012901 Ga0207667_100129014 179
23 3300031691 Ga0316579_10000170 Ga0316579_100001709 179
24 3300031691 Ga0316579_10099972 Ga0316579_100999721 179
25 3300031728 Ga0316578_10005815 Ga0316578_100058154 179
26 3300031728 Ga0316578_10092207 Ga0316578_100922072 179
27 3300032133 Ga0316583_10003049 Ga0316583_100030494 179
28 3300032133 Ga0316583_10003698 Ga0316583_100036982 179
29 3300032137 Ga0316585_10042353 Ga0316585_100423532 179
30 3300032139 Ga0316580_10074867 Ga0316580_100748672 179
31 3300036647 Ga0316582_0002560 Ga0316582_0002560_5058_5603 179
32 3300036647 Ga0316582_0006811 Ga0316582_0006811_4429_4974 179
33 3300036647 Ga0316582_0009651 Ga0316582_0009651_1158_1703 179
34 3300036712 Ga0316584_0016575 Ga0316584_0016575_390_935 179
35 3300036712 Ga0316584_0213664 Ga0316584_0213664_313_858 179
36 3300036712 Ga0316584_0249854 Ga0316584_0249854_45_590 179
37 3300037588 Ga0316581_0001359 Ga0316581_0001359_1125_1670 179
38 3300037588 Ga0316581_0007543 Ga0316581_0007543_1273_1818 179
39 3300046475 Ga0495639_0132536 Ga0495639_0132536_433_1026 179
40 3300046492 Ga0495585_0064889 Ga0495585_0064889_236_829 179
41 3300053091 Ga0500647_0062159 Ga0500647_0062159_31_624 179
42 3300053119 Ga0500595_001233 Ga0500595_001233_8024_8617 179
43 3300048929 Ga0496126_0208529 Ga0496126_0208529_929_1498 180
44 3300005937 Ga0081455_10000552 Ga0081455_1000055217 181
45 3300006028 Ga0070717_10401627 Ga0070717_104016272 181
46 3300009174 Ga0105241_11297432 Ga0105241_112974322 181
47 3300014325 Ga0163163_10807486 Ga0163163_108074861 181
48 3300020070 Ga0206356_11749622 Ga0206356_117496222 181
49 3300020076 Ga0206355_1181064 Ga0206355_11810641 181
50 3300020080 Ga0206350_10943281 Ga0206350_109432813 181
51 3300020082 Ga0206353_11854900 Ga0206353_118549001 181
52 3300022467 Ga0224712_10250646 Ga0224712_102506461 181
53 3300025253 Ga0209677_103628 Ga0209677_1036284 181
54 3300031691 Ga0316579_10013865 Ga0316579_100138653 181
55 3300031712 Ga0265342_10303359 Ga0265342_103033591 181
56 3300036712 Ga0316584_0062974 Ga0316584_0062974_105_659 181
57 3300037853 Ga0436364_0498149 Ga0436364_0498149_336_899 181
58 3300044712 Ga0453684_0430232 Ga0453684_0430232_124_681 181
59 3300049569 Ga0501032_0045784 Ga0501032_0045784_1113_1676 181
60 3300049571 Ga0501034_0004238 Ga0501034_0004238_1212_1787 181
61 3300049571 Ga0501034_0029928 Ga0501034_0029928_3951_4514 181
62 3300049573 Ga0501037_0072069 Ga0501037_0072069_809_1372 181
63 3300049581 Ga0501047_0030117 Ga0501047_0030117_4654_5217 181
64 3300049674 Ga0501242_017006 Ga0501242_017006_323_871 181
65 3300049823 Ga0501044_0000733 Ga0501044_0000733_29794_30357 181
66 3300049823 Ga0501044_0006757 Ga0501044_0006757_1496_2053 181
67 3300053139 Ga0500568_0009480 Ga0500568_0009480_3884_4438 181
68 3300053151 Ga0500604_0000013 Ga0500604_0000013_78818_79372 181
69 3300053153 Ga0500616_0000161 Ga0500616_0000161_21949_22503 181
70 3300060353 Ga0501082_0695992 Ga0501082_0695992_53_616 181
71 3300001915 JGI24741J21665_1007064 JGI24741J21665_10070642 182
72 3300001979 JGI24740J21852_10023388 JGI24740J21852_100233882 182
73 3300001990 JGI24737J22298_10002107 JGI24737J22298_100021074 182
74 3300001990 JGI24737J22298_10008118 JGI24737J22298_100081185 182
75 3300003214 JGI25165J46597_1000010 JGI25165J46597_1000010156 182
76 3300003215 JGI25153J46596_10000034 JGI25153J46596_10000034163 182
77 3300003759 Ga0055525_1000139 Ga0055525_100013929 182
78 3300003771 Ga0055526_1005294 Ga0055526_10052949 182
79 3300003771 Ga0055526_1027335 Ga0055526_10273352 182
80 3300003773 Ga0055537_1003446 Ga0055537_10034466 182
81 3300003781 Ga0055536_1019152 Ga0055536_10191523 182
82 3300003791 Ga0055530_10002624 Ga0055530_100026246 182
83 3300003792 Ga0055540_1001490 Ga0055540_100149011 182
84 3300003794 Ga0055531_10003511 Ga0055531_100035116 182
85 3300005262 Ga0065165_1109146 Ga0065165_11091461 182
86 3300005327 Ga0070658_10035480 Ga0070658_100354807 182
87 3300005334 Ga0068869_100218754 Ga0068869_1002187542 182
88 3300005334 Ga0068869_100565647 Ga0068869_1005656472 182
89 3300005344 Ga0070661_100071212 Ga0070661_1000712122 182
90 3300005353 Ga0070669_100148496 Ga0070669_1001484963 182
91 3300005354 Ga0070675_100090297 Ga0070675_1000902974 182
92 3300005366 Ga0070659_100496898 Ga0070659_1004968982 182
93 3300005456 Ga0070678_100001426 Ga0070678_1000014263 182
94 3300005457 Ga0070662_100345763 Ga0070662_1003457632 182
95 3300005535 Ga0070684_100425105 Ga0070684_1004251052 182
96 3300005548 Ga0070665_100000317 Ga0070665_10000031739 182
97 3300005548 Ga0070665_100197876 Ga0070665_1001978762 182
98 3300005548 Ga0070665_100356774 Ga0070665_1003567742 182
99 3300005577 Ga0068857_100183682 Ga0068857_1001836822 182
100 3300005578 Ga0068854_100095881 Ga0068854_1000958813 182
101 3300005578 Ga0068854_100375325 Ga0068854_1003753252 182
102 3300005616 Ga0068852_100262277 Ga0068852_1002622773 182
103 3300005834 Ga0068851_10188887 Ga0068851_101888872 182
104 3300005841 Ga0068863_100006311 Ga0068863_1000063119 182
105 3300005841 Ga0068863_100119426 Ga0068863_1001194262 182
106 3300005842 Ga0068858_100000274 Ga0068858_10000027438 182
107 3300005843 Ga0068860_100011180 Ga0068860_1000111807 182
108 3300006195 Ga0075366_10023802 Ga0075366_100238023 182
109 3300006195 Ga0075366_10302160 Ga0075366_103021602 182
110 3300006237 Ga0097621_101039670 Ga0097621_1010396701 182
111 3300006353 Ga0075370_10033030 Ga0075370_100330302 182
112 3300006931 Ga0097620_100018294 Ga0097620_1000182947 182
113 3300009093 Ga0105240_10841411 Ga0105240_108414111 182
114 3300009098 Ga0105245_10001591 Ga0105245_1000159110 182
115 3300009101 Ga0105247_10029277 Ga0105247_100292775 182
116 3300009148 Ga0105243_10001132 Ga0105243_100011322 182
117 3300009148 Ga0105243_10402728 Ga0105243_104027283 182
118 3300009174 Ga0105241_10027632 Ga0105241_100276324 182
119 3300009551 Ga0105238_10003777 Ga0105238_100037774 182
120 3300009553 Ga0105249_10000015 Ga0105249_10000015266 182
121 3300010375 Ga0105239_10668793 Ga0105239_106687932 182
122 3300012475 Ga0157317_1002740 Ga0157317_10027402 182
123 3300013100 Ga0157373_10049492 Ga0157373_100494922 182
124 3300013102 Ga0157371_10000452 Ga0157371_1000045231 182
125 3300013102 Ga0157371_10819308 Ga0157371_108193081 182
126 3300013296 Ga0157374_10843651 Ga0157374_108436512 182
127 3300013297 Ga0157378_10060790 Ga0157378_100607902 182
128 3300013306 Ga0163162_10095969 Ga0163162_100959694 182
129 3300013306 Ga0163162_12195557 Ga0163162_121955571 182
130 3300013307 Ga0157372_10418203 Ga0157372_104182033 182
131 3300014326 Ga0157380_10269301 Ga0157380_102693012 182
132 3300017792 Ga0163161_10143140 Ga0163161_101431404 182
133 3300025226 Ga0209674_112787 Ga0209674_1127871 182
134 3300025230 Ga0209563_100070 Ga0209563_100070180 182
135 3300025233 Ga0209437_109989 Ga0209437_1099892 182
136 3300025246 Ga0209646_1003232 Ga0209646_10032322 182
137 3300025261 Ga0209233_1000044 Ga0209233_1000044327 182
138 3300025263 Ga0209565_1000052 Ga0209565_1000052165 182
139 3300025272 Ga0209455_1028980 Ga0209455_10289801 182
140 3300025292 Ga0209676_1004959 Ga0209676_10049597 182
141 3300025295 Ga0209564_1000783 Ga0209564_100078342 182
142 3300025295 Ga0209564_1006593 Ga0209564_10065936 182
143 3300025297 Ga0209758_1000007 Ga0209758_1000007633 182
144 3300025297 Ga0209758_1011965 Ga0209758_10119656 182
145 3300025298 Ga0209050_1000001 Ga0209050_1000001407 182
146 3300025298 Ga0209050_1001214 Ga0209050_100121414 182
147 3300025298 Ga0209050_1035261 Ga0209050_10352613 182
148 3300025303 Ga0209051_1000297 Ga0209051_100029727 182
149 3300025304 Ga0209257_1001308 Ga0209257_100130816 182
150 3300025900 Ga0207710_10017344 Ga0207710_100173444 182
151 3300025901 Ga0207688_10071226 Ga0207688_100712264 182
152 3300025904 Ga0207647_10008921 Ga0207647_100089219 182
153 3300025904 Ga0207647_10038580 Ga0207647_100385806 182
154 3300025909 Ga0207705_10000512 Ga0207705_1000051229 182
155 3300025911 Ga0207654_10000500 Ga0207654_1000050010 182
156 3300025913 Ga0207695_10611866 Ga0207695_106118661 182
157 3300025919 Ga0207657_10029324 Ga0207657_100293243 182
158 3300025920 Ga0207649_10001188 Ga0207649_100011887 182
159 3300025924 Ga0207694_10030395 Ga0207694_100303954 182
160 3300025924 Ga0207694_10941180 Ga0207694_109411802 182
161 3300025925 Ga0207650_10473765 Ga0207650_104737652 182
162 3300025926 Ga0207659_10092631 Ga0207659_100926313 182
163 3300025927 Ga0207687_10001688 Ga0207687_1000168813 182
164 3300025932 Ga0207690_10000666 Ga0207690_1000066614 182
165 3300025933 Ga0207706_10755951 Ga0207706_107559512 182
166 3300025935 Ga0207709_10000005 Ga0207709_10000005377 182
167 3300025935 Ga0207709_10030137 Ga0207709_100301374 182
168 3300025937 Ga0207669_10000170 Ga0207669_100001708 182
169 3300025937 Ga0207669_10382926 Ga0207669_103829263 182
170 3300025942 Ga0207689_10170471 Ga0207689_101704713 182
171 3300025944 Ga0207661_10289509 Ga0207661_102895092 182
172 3300025949 Ga0207667_10000001 Ga0207667_10000001929 182
173 3300025949 Ga0207667_10485380 Ga0207667_104853802 182
174 3300025961 Ga0207712_10000023 Ga0207712_1000002319 182
175 3300025972 Ga0207668_10266276 Ga0207668_102662761 182
176 3300025981 Ga0207640_10002121 Ga0207640_100021217 182
177 3300025986 Ga0207658_10247304 Ga0207658_102473042 182
178 3300026035 Ga0207703_10001826 Ga0207703_100018262 182
179 3300026041 Ga0207639_10003983 Ga0207639_100039834 182
180 3300026078 Ga0207702_10003993 Ga0207702_1000399311 182
181 3300026088 Ga0207641_10004733 Ga0207641_100047339 182
182 3300026088 Ga0207641_10147784 Ga0207641_101477842 182
183 3300026116 Ga0207674_10183841 Ga0207674_101838412 182
184 3300026116 Ga0207674_10271775 Ga0207674_102717752 182
185 3300026121 Ga0207683_10021168 Ga0207683_100211683 182
186 3300026142 Ga0207698_10311000 Ga0207698_103110002 182
187 3300028379 Ga0268266_10000002 Ga0268266_10000002494 182
188 3300028379 Ga0268266_10000388 Ga0268266_1000038839 182
189 3300028379 Ga0268266_10823044 Ga0268266_108230442 182
190 3300028381 Ga0268264_10000990 Ga0268264_100009908 182
191 3300028786 Ga0307517_10092445 Ga0307517_100924453 182
192 3300031456 Ga0307513_10030657 Ga0307513_100306577 182
193 3300031507 Ga0307509_10016195 Ga0307509_100161958 182
194 3300031507 Ga0307509_10265489 Ga0307509_102654892 182
195 3300031616 Ga0307508_10000011 Ga0307508_1000001167 182
196 3300033180 Ga0307510_10031059 Ga0307510_100310594 182
197 3300037312 Ga0395899_0074500 Ga0395899_0074500_712_1293 182
198 3300041443 Ga0451789_0535598 Ga0451789_0535598_38_595 182
199 3300041456 Ga0451795_0562533 Ga0451795_0562533_314_895 182
200 3300041512 Ga0451853_2476269 Ga0451853_2476269_258_839 182
201 3300042005 Ga0439448_0080365 Ga0439448_0080365_389_970 182
202 3300046460 Ga0495638_0000741 Ga0495638_0000741_23172_23723 182
203 3300046471 Ga0495650_0000364 Ga0495650_0000364_63059_63640 182
204 3300046491 Ga0495584_0021302 Ga0495584_0021302_423_1004 182
205 3300046491 Ga0495584_0126571 Ga0495584_0126571_131_712 182
206 3300046492 Ga0495585_0012292 Ga0495585_0012292_2663_3214 182
207 3300046492 Ga0495585_0317621 Ga0495585_0317621_106_687 182
208 3300046500 Ga0495596_0012944 Ga0495596_0012944_2139_2720 182
209 3300046506 Ga0495583_0000311 Ga0495583_0000311_25573_26154 182
210 3300046506 Ga0495583_0008509 Ga0495583_0008509_5176_5757 182
211 3300046506 Ga0495583_0018405 Ga0495583_0018405_2632_3213 182
212 3300046507 Ga0495606_0001040 Ga0495606_0001040_856_1437 182
213 3300046507 Ga0495606_0100990 Ga0495606_0100990_283_876 182
214 3300046520 Ga0495637_0033787 Ga0495637_0033787_67_648 182
215 3300046520 Ga0495637_0087106 Ga0495637_0087106_145_726 182
216 3300046522 Ga0495643_0002504 Ga0495643_0002504_3417_3998 182
217 3300046522 Ga0495643_0069584 Ga0495643_0069584_1108_1689 182
218 3300046522 Ga0495643_0150976 Ga0495643_0150976_114_707 182
219 3300046522 Ga0495643_0325696 Ga0495643_0325696_84_665 182
220 3300046525 Ga0495663_0000779 Ga0495663_0000779_274_855 182
221 3300046525 Ga0495663_0041390 Ga0495663_0041390_374_925 182
222 3300046526 Ga0495666_0058419 Ga0495666_0058419_456_1040 182
223 3300046528 Ga0495642_0015173 Ga0495642_0015173_2154_2747 182
224 3300046528 Ga0495642_0022743 Ga0495642_0022743_121_678 182
225 3300046529 Ga0495652_0221747 Ga0495652_0221747_738_1289 182
226 3300046542 Ga0495597_0030318 Ga0495597_0030318_393_974 182
227 3300046558 Ga0495633_0000538 Ga0495633_0000538_16286_16867 182
228 3300046558 Ga0495633_0015533 Ga0495633_0015533_2735_3316 182
229 3300046616 Ga0495668_0000468 Ga0495668_0000468_23196_23777 182
230 3300046616 Ga0495668_0024051 Ga0495668_0024051_278_859 182
231 3300046648 Ga0495611_0007586 Ga0495611_0007586_392_973 182
232 3300046660 Ga0495625_0000094 Ga0495625_0000094_23154_23705 182
233 3300046660 Ga0495625_0002092 Ga0495625_0002092_21436_22017 182
234 3300046660 Ga0495625_0009614 Ga0495625_0009614_6905_7486 182
235 3300046660 Ga0495625_0022650 Ga0495625_0022650_504_1055 182
236 3300046660 Ga0495625_0199048 Ga0495625_0199048_669_1250 182
237 3300046684 Ga0495669_0000118 Ga0495669_0000118_26995_27576 182
238 3300046691 Ga0495670_0000016 Ga0495670_0000016_24811_25362 182
239 3300046691 Ga0495670_0002812 Ga0495670_0002812_2392_2943 182
240 3300046691 Ga0495670_0104567 Ga0495670_0104567_144_695 182
241 3300046691 Ga0495670_0134104 Ga0495670_0134104_40_591 182
242 3300046694 Ga0495649_0056953 Ga0495649_0056953_1085_1666 182
243 3300046809 Ga0495600_0000858 Ga0495600_0000858_15539_16120 182
244 3300046810 Ga0495660_0031843 Ga0495660_0031843_245_826 182
245 3300047323 Ga0495683_0083976 Ga0495683_0083976_738_1319 182
246 3300047443 Ga0495687_000499 Ga0495687_000499_29850_30431 182
247 3300047445 Ga0495677_0001980 Ga0495677_0001980_7284_7877 182
248 3300047470 Ga0495681_0201417 Ga0495681_0201417_49_600 182
249 3300047472 Ga0495686_0013024 Ga0495686_0013024_5046_5597 182
250 3300047472 Ga0495686_0048711 Ga0495686_0048711_744_1295 182
251 3300048904 Ga0496101_0377883 Ga0496101_0377883_509_1084 182
252 3300048905 Ga0496102_0000022 Ga0496102_0000022_15978_16553 182
253 3300048906 Ga0496103_0000075 Ga0496103_0000075_16222_16797 182
254 3300048907 Ga0496104_0008397 Ga0496104_0008397_7088_7663 182
255 3300048908 Ga0496105_0013090 Ga0496105_0013090_3704_4279 182
256 3300048912 Ga0496109_0399266 Ga0496109_0399266_653_1234 182
257 3300048913 Ga0496110_0004080 Ga0496110_0004080_10203_10778 182
258 3300048914 Ga0496111_0015353 Ga0496111_0015353_2638_3213 182
259 3300048917 Ga0496114_0011288 Ga0496114_0011288_2040_2615 182
260 3300048918 Ga0496115_0000384 Ga0496115_0000384_10764_11339 182
261 3300048919 Ga0496116_0004132 Ga0496116_0004132_10770_11345 182
262 3300048920 Ga0496117_0000439 Ga0496117_0000439_60759_61334 182
263 3300048921 Ga0496118_0000039 Ga0496118_0000039_106877_107452 182
264 3300048922 Ga0496119_0009148 Ga0496119_0009148_4169_4744 182
265 3300048923 Ga0496120_0021297 Ga0496120_0021297_2115_2690 182
266 3300048924 Ga0496121_0000269 Ga0496121_0000269_10768_11343 182
267 3300048924 Ga0496121_0116075 Ga0496121_0116075_1408_1959 182
268 3300048925 Ga0496122_0009622 Ga0496122_0009622_4549_5130 182
269 3300048926 Ga0496123_0071563 Ga0496123_0071563_1160_1741 182
270 3300048926 Ga0496123_0159762 Ga0496123_0159762_342_890 182
271 3300048927 Ga0496124_0000076 Ga0496124_0000076_198916_199491 182
272 3300048928 Ga0496125_0031798 Ga0496125_0031798_1901_2482 182
273 3300048929 Ga0496126_0001584 Ga0496126_0001584_23367_23942 182
274 3300050493 nmdc:mga0k408_96666_c1 nmdc:mga0k408_96666_c1_933_1514 182
275 3300050496 nmdc:mga07m45_375422_c1 nmdc:mga07m45_375422_c1_229_780 182
276 3300050496 nmdc:mga07m45_599720_c1 nmdc:mga07m45_599720_c1_40_588 182
277 3300053079 Ga0500610_0005178 Ga0500610_0005178_4275_4856 182
278 3300053093 Ga0500651_0081476 Ga0500651_0081476_1043_1594 182
279 3300053096 Ga0500641_0013346 Ga0500641_0013346_533_1084 182
280 3300053096 Ga0500641_0122662 Ga0500641_0122662_302_853 182
281 3300053104 Ga0500556_0126607 Ga0500556_0126607_256_819 182
282 3300053108 Ga0500562_024339 Ga0500562_024339_837_1388 182
283 3300053119 Ga0500595_001071 Ga0500595_001071_1561_2109 182
284 3300053122 Ga0500608_298052 Ga0500608_298052_30_581 182
285 3300053130 Ga0500642_0001699 Ga0500642_0001699_1990_2571 182
286 3300053131 Ga0500652_130492 Ga0500652_130492_28_579 182
287 3300053134 Ga0500658_0001088 Ga0500658_0001088_2013_2564 182
288 3300053136 Ga0500559_0005175 Ga0500559_0005175_3254_3805 182
289 3300053136 Ga0500559_0097064 Ga0500559_0097064_482_1033 182
290 3300053139 Ga0500568_0125027 Ga0500568_0125027_390_941 182
291 3300053153 Ga0500616_0035942 Ga0500616_0035942_709_1260 182
292 3300053177 Ga0500636_0103885 Ga0500636_0103885_136_717 182
293 3300053177 Ga0500636_0223263 Ga0500636_0223263_362_913 182
294 3300053730 Ga0500645_000003 Ga0500645_000003_20960_21541 182
295 3300053730 Ga0500645_000924 Ga0500645_000924_13632_14195 182
296 3300053730 Ga0500645_012970 Ga0500645_012970_1565_2221 182
297 3300053731 Ga0500609_015674 Ga0500609_015674_402_983 182
298 3300053735 Ga0500596_015630 Ga0500596_015630_514_1095 182
299 3300055283 Ga0500661_014092 Ga0500661_014092_492_1043 182
300 3300055283 Ga0500661_019135 Ga0500661_019135_475_1056 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

39

131

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2htd-assembly1.cif.gz_A crystal structure of a putative pyridoxamine 5'-phosphate oxidase (ldb0262) from lactobacillus delbrueckii subsp. at 1.60 a resolution 0.8399 5 127
3amf-assembly1.cif.gz_B e13r mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8112 8 130
3vy2-assembly1.cif.gz_B n33d mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.81 8 130
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.8075 8 130
3a6q-assembly1.cif.gz_B e13t mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8064 8 130
ID Description Score Start End Superfamily
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8024 8 127 2.30.110.10
1wliA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7995 8 130 2.30.110.10
1wliA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7818 8 130 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7657 8 127 2.30.110.10
af_Q57730_15_149_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7298 8 127 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7W5KBI7-F1-model_v4 Putative pyridoxine 5'-phosphate oxidase superfamily flavin-nucleotide-binding protein 0.9756 1 182
AF-A0A0B8ZV90-F1-model_v4 Pyridoxamine 5'-phosphate oxidase-like FMN-binding protein 0.9724 1 178
AF-A0A2N0H6X8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9713 1 179
AF-A0A7W5KBI7-F1-model_v4 Putative pyridoxine 5'-phosphate oxidase superfamily flavin-nucleotide-binding protein 0.9703 1 182
AF-A0A7V9YQK6-F1-model_v4 deleted 0.9674 1 182

Feature Viewer

pLDDT pTM Quality
91.17 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map