F395527

General Info

Members Datasets Scaffolds Average Seq Length
300 241 298 81

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0112925|Ga0495580_0112925_236_520
Length 94
Sequence LPILEYRNLYDCGVKTTLDIDDQLLSEAKALAAHQRTSLTRLIEEGLHLRLRAKPVAGRRARISLPLLKGRGGLVAGVDPRSNKALLEALGDDA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
3 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
154 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
155 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
156 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
157 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
158 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
159 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
160 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
161 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
162 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
167 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
228 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
229 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
230 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
231 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
232 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
235 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
236 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
237 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
238 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
241 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.33
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.33
Nodule 0.67
Rhizoplane 7
Rhizosphere 76.33
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_14436640 2162886012 Bacteria 2814
2 JGI24750J21931_1076585 3300002070 Bacteria 552
3 JGI25151J46595_10000421 3300003187 Bacteria 42570
4 rootL2_10114507 3300003322 Bacteria 1321
5 rootL2_10137677 3300003322 Bacteria 5744
6 Ga0055540_1030082 3300003792 Bacteria 1264
7 Ga0065165_1004455 3300005262 Bacteria 8677
8 Ga0065715_10098661 3300005293 Bacteria 3515
9 Ga0065707_10000604 3300005295 Bacteria 25275
10 Ga0070683_100210933 3300005329 Bacteria 1845
11 Ga0070690_100015705 3300005330 Bacteria 4523
12 Ga0070670_100335594 3300005331 Unclassified 1326
13 Ga0070670_101053291 3300005331 Unclassified 741
14 Ga0070677_10027144 3300005333 Unclassified 2153
15 Ga0068869_100034070 3300005334 Bacteria 3600
16 Ga0070666_10001063 3300005335 Bacteria 16783
17 Ga0068868_100001056 3300005338 Bacteria 18852
18 Ga0070689_100000852 3300005340 Bacteria 18937
19 Ga0070687_100207839 3300005343 Bacteria 1190
20 Ga0070668_100082940 3300005347 Bacteria 2515
21 Ga0070669_100088540 3300005353 Bacteria 2317
22 Ga0070669_100158050 3300005353 Unclassified 1759
23 Ga0070675_100000138 3300005354 Bacteria 44003
24 Ga0070671_100000521 3300005355 Bacteria 27041
25 Ga0070674_100075188 3300005356 Bacteria 2398
26 Ga0070673_100002197 3300005364 Bacteria 11794
27 Ga0070673_100953188 3300005364 Bacteria 797
28 Ga0070673_101505774 3300005364 Bacteria 635
29 Ga0070659_100837761 3300005366 Unclassified 801
30 Ga0070667_100000766 3300005367 Bacteria 30566
31 Ga0070700_100128286 3300005441 Unclassified 1708
32 Ga0070678_100000841 3300005456 Bacteria 15595
33 Ga0070678_100088581 3300005456 Bacteria 2367
34 Ga0070678_102180979 3300005456 Unclassified 525
35 Ga0070662_100094932 3300005457 Bacteria 2246
36 Ga0070662_100113798 3300005457 Unclassified 2065
37 Ga0068867_100005150 3300005459 Bacteria 9238
38 Ga0068867_100107366 3300005459 Bacteria 2139
39 Ga0068867_102033039 3300005459 Unclassified 543
40 Ga0070685_10004655 3300005466 Bacteria 6944
41 Ga0070706_100013999 3300005467 Bacteria 7411
42 Ga0070707_100592486 3300005468 Bacteria 1071
43 Ga0068853_101157290 3300005539 Bacteria 746
44 Ga0068853_101232876 3300005539 Unclassified 722
45 Ga0070672_100132539 3300005543 Bacteria 2049
46 Ga0070672_100211595 3300005543 Unclassified 1624
47 Ga0070686_100021524 3300005544 Bacteria 3835
48 Ga0070665_100206904 3300005548 Bacteria 1963
49 Ga0070664_100119842 3300005564 Bacteria 2303
50 Ga0070664_100205399 3300005564 Bacteria 1759
51 Ga0068856_100005927 3300005614 Bacteria 12027
52 Ga0070702_100073303 3300005615 Unclassified 2028
53 Ga0068852_100011254 3300005616 Bacteria 6725
54 Ga0068852_102682392 3300005616 Unclassified 517
55 Ga0068859_100000133 3300005617 Bacteria 70133
56 Ga0068864_100000237 3300005618 Bacteria 49297
57 Ga0068864_100418179 3300005618 Unclassified 1277
58 Ga0068866_10402923 3300005718 Unclassified 883
59 Ga0068861_100019217 3300005719 Bacteria 4881
60 Ga0068851_10022943 3300005834 Bacteria 3046
61 Ga0068863_100004164 3300005841 Bacteria 14285
62 Ga0068858_100000395 3300005842 Bacteria 45718
63 Ga0068860_100683684 3300005843 Unclassified 1035
64 Ga0068860_101305827 3300005843 Unclassified 746
65 Ga0068862_100057928 3300005844 Bacteria 3323
66 Ga0075366_10031474 3300006195 Bacteria 3122
67 Ga0075366_10077613 3300006195 Unclassified 1982
68 Ga0075366_10192992 3300006195 Unclassified 1238
69 Ga0097621_100772900 3300006237 Bacteria 888
70 Ga0068871_100032123 3300006358 Bacteria 4144
71 Ga0068865_100034901 3300006881 Bacteria 3378
72 Ga0097620_100000133 3300006931 Bacteria 70133
73 Ga0079104_1000034 3300006946 Bacteria 199368
74 Ga0105245_10430471 3300009098 Bacteria 1324
75 Ga0105247_10743007 3300009101 Unclassified 743
76 Ga0105243_10000956 3300009148 Bacteria 27006
77 Ga0105243_10219875 3300009148 Bacteria 1678
78 Ga0105248_10002604 3300009177 Bacteria 20066
79 Ga0105237_10050760 3300009545 Bacteria 4168
80 Ga0105238_10173591 3300009551 Bacteria 2132
81 Ga0105249_10131238 3300009553 Bacteria 2392
82 Ga0105239_10172718 3300010375 Bacteria 2417
83 Ga0105246_12108190 3300011119 Unclassified 546
84 Ga0157374_10050267 3300013296 Bacteria 3874
85 Ga0157378_10026675 3300013297 Bacteria 5092
86 Ga0157378_13093077 3300013297 Unclassified 516
87 Ga0163162_10011227 3300013306 Bacteria 8733
88 Ga0163162_10079301 3300013306 Bacteria 3349
89 Ga0163162_13186443 3300013306 Unclassified 526
90 Ga0157375_10002707 3300013308 Bacteria 15331
91 Ga0157375_10126559 3300013308 Bacteria 2670
92 Ga0163163_10013479 3300014325 Bacteria 7488
93 Ga0157380_10111942 3300014326 Bacteria 2296
94 Ga0157380_10194915 3300014326 Bacteria 1792
95 Ga0182008_10003565 3300014497 Bacteria 9336
96 Ga0157377_10033281 3300014745 Unclassified 2813
97 Ga0157379_10001071 3300014968 Bacteria 22316
98 Ga0157376_10003991 3300014969 Bacteria 10199
99 Ga0182006_1016562 3300015261 Bacteria 3143
100 Ga0182007_10000225 3300015262 Bacteria 37944
101 Ga0182005_1075783 3300015265 Bacteria 926
102 Ga0163161_10023340 3300017792 Bacteria 4364
103 Ga0163161_10078886 3300017792 Bacteria 2420
104 Ga0207425_1030874 3300025245 Bacteria 1071
105 Ga0209026_1014346 3300025250 Bacteria 1325
106 Ga0209129_1036046 3300025258 Bacteria 802
107 Ga0207666_1037088 3300025271 Bacteria 758
108 Ga0209673_1006274 3300025273 Bacteria 5786
109 Ga0209025_1000344 3300025294 Bacteria 101567
110 Ga0209050_1000325 3300025298 Bacteria 95686
111 Ga0209051_1004451 3300025303 Bacteria 8622
112 Ga0209051_1040942 3300025303 Bacteria 1654
113 Ga0209257_1062574 3300025304 Bacteria 1006
114 Ga0207697_10023735 3300025315 Bacteria 2511
115 Ga0207656_10028296 3300025321 Bacteria 2299
116 Ga0207642_10252867 3300025899 Bacteria 1001
117 Ga0207642_10253389 3300025899 Bacteria 1000
118 Ga0207710_10603411 3300025900 Bacteria 573
119 Ga0207680_10001124 3300025903 Bacteria 12633
120 Ga0207705_10309040 3300025909 Bacteria 1213
121 Ga0207684_10015803 3300025910 Bacteria 6491
122 Ga0207671_10277948 3300025914 Bacteria 1320
123 Ga0207662_10161932 3300025918 Bacteria 1430
124 Ga0207649_10102016 3300025920 Bacteria 1901
125 Ga0207646_10098654 3300025922 Bacteria 2618
126 Ga0207681_10032971 3300025923 Bacteria 3394
127 Ga0207681_10211027 3300025923 Bacteria 1496
128 Ga0207694_10338097 3300025924 Bacteria 1245
129 Ga0207650_10063320 3300025925 Bacteria 2765
130 Ga0207659_10000102 3300025926 Bacteria 50407
131 Ga0207687_10162697 3300025927 Bacteria 1714
132 Ga0207644_10000539 3300025931 Bacteria 24590
133 Ga0207686_11715280 3300025934 Bacteria 519
134 Ga0207709_10000019 3300025935 Bacteria 402225
135 Ga0207709_10421207 3300025935 Unclassified 1026
136 Ga0207670_10031018 3300025936 Bacteria 3419
137 Ga0207704_10030740 3300025938 Bacteria 3015
138 Ga0207691_10060865 3300025940 Bacteria 3430
139 Ga0207691_10203128 3300025940 Bacteria 1724
140 Ga0207711_10023220 3300025941 Bacteria 5190
141 Ga0207679_10244270 3300025945 Bacteria 1523
142 Ga0207679_10498709 3300025945 Bacteria 1086
143 Ga0207679_11752476 3300025945 Unclassified 568
144 Ga0207651_10008984 3300025960 Bacteria 5432
145 Ga0207651_10958702 3300025960 Bacteria 763
146 Ga0207712_10104101 3300025961 Bacteria 2116
147 Ga0207668_10084305 3300025972 Bacteria 2315
148 Ga0207668_11096357 3300025972 Unclassified 714
149 Ga0207658_10000720 3300025986 Bacteria 28611
150 Ga0207677_10014814 3300026023 Bacteria 4567
151 Ga0207703_10000787 3300026035 Bacteria 31183
152 Ga0207639_11188039 3300026041 Bacteria 716
153 Ga0207708_10045560 3300026075 Bacteria 3342
154 Ga0207708_10736047 3300026075 Unclassified 845
155 Ga0207702_10044950 3300026078 Bacteria 3714
156 Ga0207641_10006610 3300026088 Bacteria 9735
157 Ga0207648_10025812 3300026089 Bacteria 5228
158 Ga0207648_10318297 3300026089 Unclassified 1398
159 Ga0207676_10000485 3300026095 Bacteria 33413
160 Ga0207676_10140469 3300026095 Bacteria 2067
161 Ga0207675_100178964 3300026118 Bacteria 2030
162 Ga0207683_10002119 3300026121 Bacteria 17431
163 Ga0207683_10118176 3300026121 Bacteria 2378
164 Ga0207698_10008137 3300026142 Bacteria 6610
165 Ga0207698_10325363 3300026142 Unclassified 1442
166 Ga0207698_12008209 3300026142 Bacteria 592
167 Ga0209281_1000005 3300027111 Bacteria 1242284
168 Ga0268266_12044456 3300028379 Bacteria 546
169 Ga0268265_10248629 3300028380 Bacteria 1573
170 Ga0268264_11119752 3300028381 Unclassified 796
171 Ga0307515_10058464 3300028794 Bacteria 5552
172 Ga0265327_10028472 3300031251 Bacteria 3196
173 Ga0307513_10208795 3300031456 Bacteria 1786
174 Ga0307408_101113910 3300031548 Bacteria 733
175 Ga0316579_10492837 3300031691 Unclassified 593
176 Ga0307516_10619514 3300031730 Bacteria 737
177 Ga0307405_11306011 3300031731 Unclassified 631
178 Ga0307416_102315329 3300032002 Unclassified 637
179 Ga0316593_10051609 3300032168 Bacteria 1391
180 Ga0373938_0037579 3300034957 Unclassified 1064
181 Ga0373934_0277620 3300035086 Bacteria 694
182 Ga0373957_0290580 3300035120 Unclassified 692
183 Ga0373943_0908477 3300035170 Bacteria 526
184 Ga0373955_1045065 3300035172 Bacteria 503
185 Ga0373931_0036044 3300035691 Bacteria 2576
186 Ga0373935_1315478 3300035692 Bacteria 540
187 Ga0373933_0198546 3300035724 Bacteria 1283
188 Ga0373937_0328177 3300036401 Bacteria 1448
189 Ga0395905_0001365 3300037471 Bacteria 29683
190 Ga0395905_0001819 3300037471 Bacteria 24677
191 Ga0395905_0110687 3300037471 Bacteria 2579
192 Ga0436363_1704993 3300039450 Bacteria 1151
193 Ga0439436_0135480 3300041404 Bacteria 691
194 Ga0439438_127474 3300041405 Unclassified 611
195 Ga0439453_0068698 3300041408 Bacteria 746
196 Ga0451787_579018 3300041441 Bacteria 700
197 Ga0451789_0981262 3300041443 Bacteria 1308
198 Ga0451791_1259803 3300041451 Bacteria 675
199 Ga0451791_1290720 3300041451 Bacteria 788
200 Ga0451793_0389077 3300041452 Bacteria 1484
201 Ga0451793_0997016 3300041452 Bacteria 1448
202 Ga0451797_0334072 3300041453 Bacteria 547
203 Ga0451797_1406370 3300041453 Bacteria 671
204 Ga0451795_0665518 3300041456 Bacteria 3709
205 Ga0451798_0394170 3300041458 Bacteria 1070
206 Ga0451807_0320534 3300041486 Bacteria 1379
207 Ga0451843_1316599 3300041509 Unclassified 541
208 Ga0451853_3568444 3300041512 Bacteria 2190
209 Ga0450919_038895 3300042121 Bacteria 551
210 Ga0450895_020468 3300042132 Unclassified 612
211 Ga0439446_0068189 3300042156 Bacteria 1085
212 Ga0439446_0238071 3300042156 Bacteria 624
213 Ga0451577_0005267 3300042876 Bacteria 13296
214 Ga0451577_0020130 3300042876 Bacteria 6126
215 Ga0451577_0046017 3300042876 Bacteria 3905
216 Ga0453683_0063339 3300044673 Bacteria 2312
217 Ga0453684_0014179 3300044712 Bacteria 12802
218 Ga0453684_0022546 3300044712 Bacteria 9335
219 Ga0453684_0121584 3300044712 Bacteria 3151
220 Ga0453684_0950327 3300044712 Bacteria 917
221 Ga0466960_0173802 3300044901 Bacteria 1164
222 Ga0466960_0483955 3300044901 Bacteria 723
223 Ga0451576_0011985 3300045051 Bacteria 9790
224 Ga0495603_0542255 3300046455 Unclassified 666
225 Ga0495590_0008778 3300046457 Bacteria 3845
226 Ga0495629_0336359 3300046459 Unclassified 1031
227 Ga0495629_0752554 3300046459 Bacteria 645
228 Ga0495638_0310103 3300046460 Bacteria 847
229 Ga0495580_0112925 3300046472 Bacteria 1887
230 Ga0495639_0025143 3300046475 Bacteria 2625
231 Ga0495639_0220062 3300046475 Unclassified 933
232 Ga0495664_0578681 3300046477 Bacteria 668
233 Ga0495618_0605196 3300046514 Archaea 652
234 Ga0495628_0419978 3300046516 Unclassified 975
235 Ga0495630_0117929 3300046517 Bacteria 2013
236 Ga0495642_0099472 3300046528 Bacteria 1237
237 Ga0495652_0195883 3300046529 Bacteria 1538
238 Ga0495586_0174693 3300046535 Bacteria 1214
239 Ga0495587_0240158 3300046536 Bacteria 1020
240 Ga0495598_0105893 3300046537 Unclassified 936
241 Ga0495621_0035069 3300046539 Bacteria 1736
242 Ga0495622_0253504 3300046557 Bacteria 774
243 Ga0495625_0233643 3300046660 Bacteria 1200
244 Ga0495635_0477505 3300046663 Archaea 822
245 Ga0495588_0502803 3300046674 Bacteria 635
246 Ga0495657_0299607 3300046675 Bacteria 959
247 Ga0495599_0060225 3300046678 Bacteria 2374
248 Ga0495647_0380448 3300046681 Bacteria 646
249 Ga0495658_0200304 3300046683 Bacteria 1244
250 Ga0495624_0279209 3300046690 Bacteria 1009
251 Ga0495670_0507596 3300046691 Bacteria 655
252 Ga0495660_0068718 3300046810 Bacteria 1885
253 Ga0495581_0051970 3300047315 Bacteria 2367
254 Ga0495604_0466630 3300047317 Bacteria 823
255 Ga0495636_0107174 3300047318 Bacteria 1227
256 Ga0495672_0002981 3300047320 Bacteria 14893
257 Ga0495685_099940 3300047447 Bacteria 958
258 Ga0495673_0358105 3300047469 Unclassified 514
259 Ga0495684_0274277 3300047471 Bacteria 1219
260 Ga0495614_0227477 3300048089 Unclassified 849
261 Ga0496102_0674230 3300048905 Unclassified 957
262 Ga0496105_0134059 3300048908 Bacteria 2041
263 Ga0496108_0074052 3300048911 Bacteria 2875
264 Ga0496108_0136912 3300048911 Bacteria 2108
265 Ga0496109_0026403 3300048912 Bacteria 5179
266 Ga0496109_0201710 3300048912 Bacteria 1870
267 Ga0496110_1624980 3300048913 Bacteria 556
268 Ga0496114_0201072 3300048917 Bacteria 1745
269 Ga0496114_0239540 3300048917 Bacteria 1595
270 Ga0496114_0547910 3300048917 Unclassified 1022
271 Ga0496126_0369113 3300048929 Unclassified 1171
272 Ga0501067_0417796 3300049583 Unclassified 748
273 Ga0501274_040937 3300049771 Unclassified 556
274 nmdc:mga0k408_38883_c1 3300050493 Bacteria 2732
275 nmdc:mga0k408_391685_c1 3300050493 Unclassified 827
276 Ga0495601_0074008 3300053077 Bacteria 2179
277 Ga0495595_0100872 3300053084 Bacteria 1393
278 Ga0500578_0339551 3300053086 Bacteria 881
279 Ga0500643_083620 3300053087 Unclassified 875
280 Ga0500644_0010098 3300053088 Bacteria 2547
281 Ga0500646_0013198 3300053090 Bacteria 2138
282 Ga0500583_0094485 3300053092 Bacteria 1458
283 Ga0500651_0047727 3300053093 Bacteria 2691
284 Ga0500650_0011456 3300053098 Bacteria 3652
285 Ga0500569_052262 3300053109 Bacteria 1236
286 Ga0500592_079850 3300053116 Unclassified 543
287 Ga0500607_148266 3300053121 Bacteria 1092
288 Ga0500623_113229 3300053127 Bacteria 1208
289 Ga0500628_001638 3300053129 Bacteria 3794
290 Ga0500642_0075880 3300053130 Bacteria 1536
291 Ga0500652_000226 3300053131 Bacteria 21494
292 Ga0500577_0017168 3300053142 Bacteria 2299
293 Ga0500579_097654 3300053143 Bacteria 1548
294 Ga0500600_0011702 3300053149 Bacteria 5325
295 Ga0500604_0010443 3300053151 Bacteria 2485
296 Ga0500622_0000447 3300053156 Bacteria 39298
297 Ga0500570_137227 3300053724 Bacteria 910
298 Ga0500625_111663 3300053729 Bacteria 1120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053149 Ga0500600_0011702 Ga0500600_0011702_1513_1752 68
2 iso_pu_bacteria 2904541872 2904545737 75
3 iso_pu_bacteria 2929160207 2929168400 75
4 3300031731 Ga0307405_11306011 Ga0307405_113060112 77
5 3300031691 Ga0316579_10492837 Ga0316579_104928371 78
6 3300032168 Ga0316593_10051609 Ga0316593_100516093 78
7 3300041405 Ga0439438_127474 Ga0439438_127474_41_277 78
8 3300041408 Ga0439453_0068698 Ga0439453_0068698_352_588 78
9 3300042132 Ga0450895_020468 Ga0450895_020468_359_595 78
10 3300042876 Ga0451577_0046017 Ga0451577_0046017_1033_1305 78
11 3300003187 JGI25151J46595_10000421 JGI25151J46595_100004218 79
12 3300005364 Ga0070673_100953188 Ga0070673_1009531882 79
13 3300005456 Ga0070678_100088581 Ga0070678_1000885813 79
14 3300005456 Ga0070678_102180979 Ga0070678_1021809792 79
15 3300005459 Ga0068867_102033039 Ga0068867_1020330392 79
16 3300005467 Ga0070706_100013999 Ga0070706_1000139994 79
17 3300005468 Ga0070707_100592486 Ga0070707_1005924862 79
18 3300005539 Ga0068853_101232876 Ga0068853_1012328761 79
19 3300005618 Ga0068864_100418179 Ga0068864_1004181792 79
20 3300006195 Ga0075366_10031474 Ga0075366_100314745 79
21 3300006195 Ga0075366_10192992 Ga0075366_101929922 79
22 3300006237 Ga0097621_100772900 Ga0097621_1007729002 79
23 3300006946 Ga0079104_1000034 Ga0079104_1000034192 79
24 3300009148 Ga0105243_10000956 Ga0105243_1000095613 79
25 3300009551 Ga0105238_10173591 Ga0105238_101735913 79
26 3300011119 Ga0105246_12108190 Ga0105246_121081901 79
27 3300013306 Ga0163162_13186443 Ga0163162_131864432 79
28 3300014497 Ga0182008_10003565 Ga0182008_100035655 79
29 3300015261 Ga0182006_1016562 Ga0182006_10165622 79
30 3300015262 Ga0182007_10000225 Ga0182007_100002257 79
31 3300015265 Ga0182005_1075783 Ga0182005_10757832 79
32 3300025245 Ga0207425_1030874 Ga0207425_10308741 79
33 3300025258 Ga0209129_1036046 Ga0209129_10360462 79
34 3300025294 Ga0209025_1000344 Ga0209025_100034459 79
35 3300025910 Ga0207684_10015803 Ga0207684_100158034 79
36 3300025922 Ga0207646_10098654 Ga0207646_100986541 79
37 3300025924 Ga0207694_10338097 Ga0207694_103380972 79
38 3300025935 Ga0207709_10000019 Ga0207709_1000001961 79
39 3300025960 Ga0207651_10958702 Ga0207651_109587021 79
40 3300025972 Ga0207668_11096357 Ga0207668_110963571 79
41 3300026095 Ga0207676_10140469 Ga0207676_101404692 79
42 3300026121 Ga0207683_10118176 Ga0207683_101181762 79
43 3300027111 Ga0209281_1000005 Ga0209281_1000005190 79
44 3300031548 Ga0307408_101113910 Ga0307408_1011139102 79
45 3300032002 Ga0307416_102315329 Ga0307416_1023153292 79
46 3300034957 Ga0373938_0037579 Ga0373938_0037579_298_543 79
47 3300041404 Ga0439436_0135480 Ga0439436_0135480_174_413 79
48 3300041453 Ga0451797_0334072 Ga0451797_0334072_12_251 79
49 3300041509 Ga0451843_1316599 Ga0451843_1316599_136_375 79
50 3300042121 Ga0450919_038895 Ga0450919_038895_193_441 79
51 3300046459 Ga0495629_0752554 Ga0495629_0752554_261_500 79
52 3300046475 Ga0495639_0220062 Ga0495639_0220062_469_708 79
53 3300046514 Ga0495618_0605196 Ga0495618_0605196_86_325 79
54 3300046517 Ga0495630_0117929 Ga0495630_0117929_832_1071 79
55 3300046528 Ga0495642_0099472 Ga0495642_0099472_454_693 79
56 3300046536 Ga0495587_0240158 Ga0495587_0240158_11_250 79
57 3300046557 Ga0495622_0253504 Ga0495622_0253504_260_499 79
58 3300046663 Ga0495635_0477505 Ga0495635_0477505_226_465 79
59 3300046674 Ga0495588_0502803 Ga0495588_0502803_346_585 79
60 3300046675 Ga0495657_0299607 Ga0495657_0299607_18_293 79
61 3300046678 Ga0495599_0060225 Ga0495599_0060225_1999_2238 79
62 3300046690 Ga0495624_0279209 Ga0495624_0279209_81_320 79
63 3300047315 Ga0495581_0051970 Ga0495581_0051970_1050_1289 79
64 3300047317 Ga0495604_0466630 Ga0495604_0466630_429_668 79
65 3300047320 Ga0495672_0002981 Ga0495672_0002981_5096_5335 79
66 3300047447 Ga0495685_099940 Ga0495685_099940_580_819 79
67 3300047469 Ga0495673_0358105 Ga0495673_0358105_238_477 79
68 3300048905 Ga0496102_0674230 Ga0496102_0674230_176_415 79
69 3300048911 Ga0496108_0136912 Ga0496108_0136912_52_291 79
70 3300048912 Ga0496109_0201710 Ga0496109_0201710_981_1220 79
71 3300048913 Ga0496110_1624980 Ga0496110_1624980_125_364 79
72 3300048917 Ga0496114_0201072 Ga0496114_0201072_488_727 79
73 3300048929 Ga0496126_0369113 Ga0496126_0369113_746_985 79
74 3300049583 Ga0501067_0417796 Ga0501067_0417796_167_406 79
75 3300049771 Ga0501274_040937 Ga0501274_040937_60_299 79
76 3300050493 nmdc:mga0k408_38883_c1 nmdc:mga0k408_38883_c1_996_1235 79
77 3300003322 rootL2_10137677 rootL2_101376776 80
78 3300037471 Ga0395905_0001819 Ga0395905_0001819_3749_4000 80
79 3300037471 Ga0395905_0110687 Ga0395905_0110687_1272_1526 80
80 3300046457 Ga0495590_0008778 Ga0495590_0008778_2616_2867 80
81 3300046810 Ga0495660_0068718 Ga0495660_0068718_284_535 80
82 2162886012 MBSR1b_contig_14436640 MBSR1b_0094.00000460 81
83 3300002070 JGI24750J21931_1076585 JGI24750J21931_10765852 81
84 3300003322 rootL2_10114507 rootL2_101145072 81
85 3300003792 Ga0055540_1030082 Ga0055540_10300822 81
86 3300005262 Ga0065165_1004455 Ga0065165_10044553 81
87 3300005293 Ga0065715_10098661 Ga0065715_100986615 81
88 3300005295 Ga0065707_10000604 Ga0065707_100006042 81
89 3300005329 Ga0070683_100210933 Ga0070683_1002109334 81
90 3300005330 Ga0070690_100015705 Ga0070690_1000157053 81
91 3300005331 Ga0070670_100335594 Ga0070670_1003355941 81
92 3300005331 Ga0070670_101053291 Ga0070670_1010532911 81
93 3300005333 Ga0070677_10027144 Ga0070677_100271442 81
94 3300005334 Ga0068869_100034070 Ga0068869_1000340703 81
95 3300005335 Ga0070666_10001063 Ga0070666_100010634 81
96 3300005338 Ga0068868_100001056 Ga0068868_10000105614 81
97 3300005340 Ga0070689_100000852 Ga0070689_1000008523 81
98 3300005343 Ga0070687_100207839 Ga0070687_1002078392 81
99 3300005347 Ga0070668_100082940 Ga0070668_1000829402 81
100 3300005353 Ga0070669_100088540 Ga0070669_1000885404 81
101 3300005353 Ga0070669_100158050 Ga0070669_1001580503 81
102 3300005354 Ga0070675_100000138 Ga0070675_1000001384 81
103 3300005355 Ga0070671_100000521 Ga0070671_1000005213 81
104 3300005356 Ga0070674_100075188 Ga0070674_1000751883 81
105 3300005364 Ga0070673_100002197 Ga0070673_1000021975 81
106 3300005364 Ga0070673_101505774 Ga0070673_1015057742 81
107 3300005366 Ga0070659_100837761 Ga0070659_1008377612 81
108 3300005367 Ga0070667_100000766 Ga0070667_10000076615 81
109 3300005441 Ga0070700_100128286 Ga0070700_1001282863 81
110 3300005456 Ga0070678_100000841 Ga0070678_1000008413 81
111 3300005457 Ga0070662_100094932 Ga0070662_1000949323 81
112 3300005457 Ga0070662_100113798 Ga0070662_1001137983 81
113 3300005459 Ga0068867_100005150 Ga0068867_1000051509 81
114 3300005459 Ga0068867_100107366 Ga0068867_1001073663 81
115 3300005466 Ga0070685_10004655 Ga0070685_100046553 81
116 3300005539 Ga0068853_101157290 Ga0068853_1011572902 81
117 3300005543 Ga0070672_100132539 Ga0070672_1001325392 81
118 3300005543 Ga0070672_100211595 Ga0070672_1002115953 81
119 3300005544 Ga0070686_100021524 Ga0070686_1000215243 81
120 3300005548 Ga0070665_100206904 Ga0070665_1002069043 81
121 3300005564 Ga0070664_100119842 Ga0070664_1001198423 81
122 3300005564 Ga0070664_100205399 Ga0070664_1002053993 81
123 3300005614 Ga0068856_100005927 Ga0068856_10000592713 81
124 3300005615 Ga0070702_100073303 Ga0070702_1000733033 81
125 3300005616 Ga0068852_100011254 Ga0068852_1000112546 81
126 3300005616 Ga0068852_102682392 Ga0068852_1026823922 81
127 3300005617 Ga0068859_100000133 Ga0068859_10000013315 81
128 3300005618 Ga0068864_100000237 Ga0068864_10000023728 81
129 3300005718 Ga0068866_10402923 Ga0068866_104029232 81
130 3300005719 Ga0068861_100019217 Ga0068861_1000192173 81
131 3300005834 Ga0068851_10022943 Ga0068851_100229432 81
132 3300005841 Ga0068863_100004164 Ga0068863_1000041643 81
133 3300005842 Ga0068858_100000395 Ga0068858_10000039515 81
134 3300005843 Ga0068860_100683684 Ga0068860_1006836842 81
135 3300005843 Ga0068860_101305827 Ga0068860_1013058271 81
136 3300005844 Ga0068862_100057928 Ga0068862_1000579283 81
137 3300006195 Ga0075366_10077613 Ga0075366_100776132 81
138 3300006358 Ga0068871_100032123 Ga0068871_1000321233 81
139 3300006881 Ga0068865_100034901 Ga0068865_1000349013 81
140 3300006931 Ga0097620_100000133 Ga0097620_10000013315 81
141 3300009098 Ga0105245_10430471 Ga0105245_104304712 81
142 3300009101 Ga0105247_10743007 Ga0105247_107430072 81
143 3300009148 Ga0105243_10219875 Ga0105243_102198753 81
144 3300009177 Ga0105248_10002604 Ga0105248_100026045 81
145 3300009545 Ga0105237_10050760 Ga0105237_100507607 81
146 3300009553 Ga0105249_10131238 Ga0105249_101312384 81
147 3300010375 Ga0105239_10172718 Ga0105239_101727183 81
148 3300013296 Ga0157374_10050267 Ga0157374_100502673 81
149 3300013297 Ga0157378_10026675 Ga0157378_100266755 81
150 3300013297 Ga0157378_13093077 Ga0157378_130930771 81
151 3300013306 Ga0163162_10011227 Ga0163162_100112273 81
152 3300013306 Ga0163162_10079301 Ga0163162_100793014 81
153 3300013308 Ga0157375_10002707 Ga0157375_100027073 81
154 3300013308 Ga0157375_10126559 Ga0157375_101265594 81
155 3300014325 Ga0163163_10013479 Ga0163163_100134794 81
156 3300014326 Ga0157380_10111942 Ga0157380_101119424 81
157 3300014326 Ga0157380_10194915 Ga0157380_101949152 81
158 3300014745 Ga0157377_10033281 Ga0157377_100332813 81
159 3300014968 Ga0157379_10001071 Ga0157379_100010714 81
160 3300014969 Ga0157376_10003991 Ga0157376_100039913 81
161 3300017792 Ga0163161_10023340 Ga0163161_100233404 81
162 3300017792 Ga0163161_10078886 Ga0163161_100788863 81
163 3300025250 Ga0209026_1014346 Ga0209026_10143462 81
164 3300025271 Ga0207666_1037088 Ga0207666_10370881 81
165 3300025273 Ga0209673_1006274 Ga0209673_10062745 81
166 3300025298 Ga0209050_1000325 Ga0209050_100032586 81
167 3300025303 Ga0209051_1004451 Ga0209051_100445111 81
168 3300025303 Ga0209051_1040942 Ga0209051_10409423 81
169 3300025304 Ga0209257_1062574 Ga0209257_10625742 81
170 3300025315 Ga0207697_10023735 Ga0207697_100237353 81
171 3300025321 Ga0207656_10028296 Ga0207656_100282963 81
172 3300025899 Ga0207642_10252867 Ga0207642_102528672 81
173 3300025899 Ga0207642_10253389 Ga0207642_102533891 81
174 3300025900 Ga0207710_10603411 Ga0207710_106034111 81
175 3300025903 Ga0207680_10001124 Ga0207680_100011243 81
176 3300025909 Ga0207705_10309040 Ga0207705_103090402 81
177 3300025914 Ga0207671_10277948 Ga0207671_102779481 81
178 3300025918 Ga0207662_10161932 Ga0207662_101619321 81
179 3300025920 Ga0207649_10102016 Ga0207649_101020162 81
180 3300025923 Ga0207681_10032971 Ga0207681_100329713 81
181 3300025923 Ga0207681_10211027 Ga0207681_102110273 81
182 3300025925 Ga0207650_10063320 Ga0207650_100633203 81
183 3300025926 Ga0207659_10000102 Ga0207659_100001029 81
184 3300025927 Ga0207687_10162697 Ga0207687_101626972 81
185 3300025931 Ga0207644_10000539 Ga0207644_100005393 81
186 3300025934 Ga0207686_11715280 Ga0207686_117152801 81
187 3300025935 Ga0207709_10421207 Ga0207709_104212073 81
188 3300025936 Ga0207670_10031018 Ga0207670_100310183 81
189 3300025938 Ga0207704_10030740 Ga0207704_100307404 81
190 3300025940 Ga0207691_10060865 Ga0207691_100608653 81
191 3300025940 Ga0207691_10203128 Ga0207691_102031282 81
192 3300025941 Ga0207711_10023220 Ga0207711_100232205 81
193 3300025945 Ga0207679_10244270 Ga0207679_102442703 81
194 3300025945 Ga0207679_10498709 Ga0207679_104987092 81
195 3300025945 Ga0207679_11752476 Ga0207679_117524762 81
196 3300025960 Ga0207651_10008984 Ga0207651_100089843 81
197 3300025961 Ga0207712_10104101 Ga0207712_101041014 81
198 3300025972 Ga0207668_10084305 Ga0207668_100843052 81
199 3300025986 Ga0207658_10000720 Ga0207658_100007209 81
200 3300026023 Ga0207677_10014814 Ga0207677_100148143 81
201 3300026035 Ga0207703_10000787 Ga0207703_1000078712 81
202 3300026041 Ga0207639_11188039 Ga0207639_111880392 81
203 3300026075 Ga0207708_10045560 Ga0207708_100455603 81
204 3300026075 Ga0207708_10736047 Ga0207708_107360472 81
205 3300026078 Ga0207702_10044950 Ga0207702_100449503 81
206 3300026088 Ga0207641_10006610 Ga0207641_100066104 81
207 3300026089 Ga0207648_10025812 Ga0207648_100258124 81
208 3300026089 Ga0207648_10318297 Ga0207648_103182972 81
209 3300026095 Ga0207676_10000485 Ga0207676_1000048516 81
210 3300026118 Ga0207675_100178964 Ga0207675_1001789642 81
211 3300026121 Ga0207683_10002119 Ga0207683_100021193 81
212 3300026142 Ga0207698_10008137 Ga0207698_100081371 81
213 3300026142 Ga0207698_10325363 Ga0207698_103253633 81
214 3300026142 Ga0207698_12008209 Ga0207698_120082091 81
215 3300028379 Ga0268266_12044456 Ga0268266_120444561 81
216 3300028380 Ga0268265_10248629 Ga0268265_102486293 81
217 3300028381 Ga0268264_11119752 Ga0268264_111197522 81
218 3300028794 Ga0307515_10058464 Ga0307515_100584642 81
219 3300031251 Ga0265327_10028472 Ga0265327_100284722 81
220 3300031456 Ga0307513_10208795 Ga0307513_102087953 81
221 3300031730 Ga0307516_10619514 Ga0307516_106195142 81
222 3300035086 Ga0373934_0277620 Ga0373934_0277620_233_478 81
223 3300035120 Ga0373957_0290580 Ga0373957_0290580_109_354 81
224 3300035170 Ga0373943_0908477 Ga0373943_0908477_153_398 81
225 3300035172 Ga0373955_1045065 Ga0373955_1045065_75_320 81
226 3300035691 Ga0373931_0036044 Ga0373931_0036044_1415_1660 81
227 3300035692 Ga0373935_1315478 Ga0373935_1315478_256_501 81
228 3300035724 Ga0373933_0198546 Ga0373933_0198546_961_1206 81
229 3300036401 Ga0373937_0328177 Ga0373937_0328177_152_397 81
230 3300037471 Ga0395905_0001365 Ga0395905_0001365_10482_10727 81
231 3300039450 Ga0436363_1704993 Ga0436363_1704993_571_825 81
232 3300041441 Ga0451787_579018 Ga0451787_579018_268_513 81
233 3300041443 Ga0451789_0981262 Ga0451789_0981262_321_566 81
234 3300041451 Ga0451791_1259803 Ga0451791_1259803_65_310 81
235 3300041451 Ga0451791_1290720 Ga0451791_1290720_366_611 81
236 3300041452 Ga0451793_0389077 Ga0451793_0389077_906_1151 81
237 3300041452 Ga0451793_0997016 Ga0451793_0997016_1156_1401 81
238 3300041453 Ga0451797_1406370 Ga0451797_1406370_125_370 81
239 3300041456 Ga0451795_0665518 Ga0451795_0665518_974_1219 81
240 3300041458 Ga0451798_0394170 Ga0451798_0394170_265_510 81
241 3300041486 Ga0451807_0320534 Ga0451807_0320534_512_757 81
242 3300041512 Ga0451853_3568444 Ga0451853_3568444_124_369 81
243 3300042156 Ga0439446_0068189 Ga0439446_0068189_723_974 81
244 3300042156 Ga0439446_0238071 Ga0439446_0238071_286_531 81
245 3300042876 Ga0451577_0005267 Ga0451577_0005267_7068_7313 81
246 3300042876 Ga0451577_0020130 Ga0451577_0020130_4037_4282 81
247 3300044673 Ga0453683_0063339 Ga0453683_0063339_1021_1266 81
248 3300044712 Ga0453684_0014179 Ga0453684_0014179_5986_6231 81
249 3300044712 Ga0453684_0022546 Ga0453684_0022546_4352_4597 81
250 3300044712 Ga0453684_0121584 Ga0453684_0121584_455_700 81
251 3300044712 Ga0453684_0950327 Ga0453684_0950327_60_305 81
252 3300044901 Ga0466960_0173802 Ga0466960_0173802_417_662 81
253 3300044901 Ga0466960_0483955 Ga0466960_0483955_309_554 81
254 3300045051 Ga0451576_0011985 Ga0451576_0011985_2661_2906 81
255 3300046455 Ga0495603_0542255 Ga0495603_0542255_28_273 81
256 3300046459 Ga0495629_0336359 Ga0495629_0336359_589_834 81
257 3300046460 Ga0495638_0310103 Ga0495638_0310103_328_573 81
258 3300046472 Ga0495580_0112925 Ga0495580_0112925_236_520 81
259 3300046475 Ga0495639_0025143 Ga0495639_0025143_528_773 81
260 3300046477 Ga0495664_0578681 Ga0495664_0578681_114_359 81
261 3300046516 Ga0495628_0419978 Ga0495628_0419978_57_302 81
262 3300046529 Ga0495652_0195883 Ga0495652_0195883_265_510 81
263 3300046535 Ga0495586_0174693 Ga0495586_0174693_637_882 81
264 3300046537 Ga0495598_0105893 Ga0495598_0105893_186_431 81
265 3300046539 Ga0495621_0035069 Ga0495621_0035069_1023_1268 81
266 3300046660 Ga0495625_0233643 Ga0495625_0233643_375_620 81
267 3300046681 Ga0495647_0380448 Ga0495647_0380448_122_367 81
268 3300046683 Ga0495658_0200304 Ga0495658_0200304_905_1150 81
269 3300046691 Ga0495670_0507596 Ga0495670_0507596_256_501 81
270 3300047318 Ga0495636_0107174 Ga0495636_0107174_308_553 81
271 3300047471 Ga0495684_0274277 Ga0495684_0274277_951_1196 81
272 3300048089 Ga0495614_0227477 Ga0495614_0227477_26_271 81
273 3300048908 Ga0496105_0134059 Ga0496105_0134059_618_863 81
274 3300048911 Ga0496108_0074052 Ga0496108_0074052_758_1003 81
275 3300048912 Ga0496109_0026403 Ga0496109_0026403_502_747 81
276 3300048917 Ga0496114_0239540 Ga0496114_0239540_1115_1360 81
277 3300048917 Ga0496114_0547910 Ga0496114_0547910_98_343 81
278 3300050493 nmdc:mga0k408_391685_c1 nmdc:mga0k408_391685_c1_568_813 81
279 3300053077 Ga0495601_0074008 Ga0495601_0074008_1721_1966 81
280 3300053084 Ga0495595_0100872 Ga0495595_0100872_688_933 81
281 3300053086 Ga0500578_0339551 Ga0500578_0339551_400_645 81
282 3300053087 Ga0500643_083620 Ga0500643_083620_565_810 81
283 3300053088 Ga0500644_0010098 Ga0500644_0010098_440_685 81
284 3300053090 Ga0500646_0013198 Ga0500646_0013198_1117_1362 81
285 3300053092 Ga0500583_0094485 Ga0500583_0094485_131_376 81
286 3300053093 Ga0500651_0047727 Ga0500651_0047727_749_994 81
287 3300053098 Ga0500650_0011456 Ga0500650_0011456_1380_1625 81
288 3300053109 Ga0500569_052262 Ga0500569_052262_516_761 81
289 3300053116 Ga0500592_079850 Ga0500592_079850_253_498 81
290 3300053121 Ga0500607_148266 Ga0500607_148266_182_427 81
291 3300053127 Ga0500623_113229 Ga0500623_113229_236_481 81
292 3300053129 Ga0500628_001638 Ga0500628_001638_2491_2736 81
293 3300053130 Ga0500642_0075880 Ga0500642_0075880_1167_1412 81
294 3300053131 Ga0500652_000226 Ga0500652_000226_13262_13507 81
295 3300053142 Ga0500577_0017168 Ga0500577_0017168_1819_2064 81
296 3300053143 Ga0500579_097654 Ga0500579_097654_265_510 81
297 3300053151 Ga0500604_0010443 Ga0500604_0010443_1303_1548 81
298 3300053156 Ga0500622_0000447 Ga0500622_0000447_25818_26063 81
299 3300053724 Ga0500570_137227 Ga0500570_137227_485_730 81
300 3300053729 Ga0500625_111663 Ga0500625_111663_246_491 81

Feature Viewer

pLDDT pTM Quality
76.78 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map