F395502

General Info

Members Datasets Scaffolds Average Seq Length
300 214 600 172

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0254223|Ga0466965_0254223_62_655
Length 197
Sequence VDQDLRWTGTGRLDWVARAPTWETDRMSDPSPAPTPVLEVWCELQCPDCRSALDDLRALRARYGDRLELRLRHFPLEKHKHAFAAAQAAEEALEQGRGWDYVEAVLGRVEELDRAGEPFLVEVARELGLDAEEFDTALIDGRHILIVDADQAEGKAIGVTGTPTYVIGGERLDGGKSQAGLRERIEQVADRLLAEGT

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
13 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
14 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
15 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
16 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
19 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
20 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
21 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
22 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
23 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
24 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
25 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
26 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
27 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
28 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
29 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
30 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
31 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
32 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
33 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
34 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
35 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
36 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
37 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
38 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
39 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
40 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
41 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
42 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
43 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
44 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
45 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
46 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
47 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
48 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
49 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
50 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
51 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
52 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
53 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
54 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
55 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
56 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
57 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
58 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
59 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
64 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
75 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
81 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
86 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
87 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
90 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
91 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
92 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
93 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
117 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
146 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
147 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
148 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
149 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
150 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
151 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
152 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
153 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
156 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
157 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
158 2643221548 Streptomyces sp. Root55 Isolate Unclassified
159 2643221578 Streptomyces sp. Root63 Isolate Unclassified
160 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
161 2643221670 Streptomyces sp. Root431 Isolate Unclassified
162 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
163 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
164 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
165 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
166 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
167 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
168 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
169 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
170 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
171 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
172 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
173 2808606448 Streptomyces sp. 193411 Isolate Unclassified
174 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
175 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
176 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
177 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
178 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
179 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
180 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
181 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
182 2867475112 Streptomyces sp. TM32 Isolate Unclassified
183 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
184 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
185 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
186 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
187 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
188 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
189 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
190 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
191 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
192 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
193 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
194 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
195 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
196 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
197 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
198 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
199 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
200 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
201 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
202 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
203 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
204 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
205 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
206 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
207 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
208 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
209 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
210 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
211 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
212 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
213 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
214 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.67
Metatranscriptomes 0.33
Isolates 20

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0.67
Rhizoplane 2.33
Rhizosphere 73.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0254223 3300044683 Bacteria 943
2 JGI24739J22299_10066695 3300001989 Bacteria 1127
3 rootH1_10011569 3300003316 Bacteria 4165
4 rootH2_10049036 3300003320 Bacteria 2721
5 rootL2_10000887 3300003322 Bacteria 6619
6 Ga0006562J51391_1127145 3300003578 Bacteria 1190
7 Ga0068853_100024882 3300005539 Bacteria 5023
8 Ga0068854_100707312 3300005578 Bacteria 870
9 Ga0075363_100024278 3300006048 Bacteria 3080
10 Ga0105250_10280136 3300009092 Bacteria 717
11 Ga0105246_10479249 3300011119 Bacteria 1052
12 Ga0105246_10570959 3300011119 Bacteria 973
13 Ga0157375_11294854 3300013308 Bacteria 857
14 Ga0183367_1010 3300015688 Bacteria 416164
15 Ga0209758_1016191 3300025297 Bacteria 3802
16 Ga0207426_1003435 3300025302 Bacteria 8612
17 Ga0207647_10051531 3300025904 Bacteria 2544
18 Ga0207639_10009832 3300026041 Bacteria 6609
19 Ga0307517_10014987 3300028786 Bacteria 10343
20 Ga0307515_10039805 3300028794 Bacteria 7459
21 Ga0268256_1035608 3300030500 Bacteria 1156
22 Ga0307511_10002263 3300030521 Bacteria 20131
23 Ga0307511_10125236 3300030521 Bacteria 1571
24 Ga0307512_10078340 3300030522 Bacteria 2395
25 Ga0316180_1041784 3300030736 Bacteria 1170
26 Ga0307513_10169270 3300031456 Bacteria 2064
27 Ga0307513_10274180 3300031456 Bacteria 1468
28 Ga0307509_10030969 3300031507 Bacteria 5912
29 Ga0307509_10042451 3300031507 Bacteria 4928
30 Ga0307509_10525688 3300031507 Bacteria 864
31 Ga0307508_10006070 3300031616 Bacteria 11403
32 Ga0307514_10004636 3300031649 Bacteria 12603
33 Ga0307514_10069482 3300031649 Bacteria 2649
34 Ga0307514_10190529 3300031649 Bacteria 1306
35 Ga0307516_10031580 3300031730 Bacteria 5339
36 Ga0307516_10346792 3300031730 Bacteria 1151
37 Ga0307516_10377535 3300031730 Bacteria 1079
38 Ga0307413_10036434 3300031824 Bacteria 2832
39 Ga0307518_10034690 3300031838 Bacteria 3663
40 Ga0307518_10150130 3300031838 Bacteria 1613
41 Ga0307416_100020469 3300032002 Bacteria 4723
42 Ga0307411_10315051 3300032005 Bacteria 1261
43 Ga0307411_10439696 3300032005 Bacteria 1088
44 Ga0307510_10023606 3300033180 Bacteria 7125
45 Ga0307510_10059555 3300033180 Bacteria 3941
46 Ga0307510_10068182 3300033180 Bacteria 3572
47 Ga0307510_10089290 3300033180 Bacteria 2935
48 Ga0395900_1106610 3300037418 Bacteria 709
49 Ga0395898_0003733 3300037466 Bacteria 16895
50 Ga0395898_0402005 3300037466 Bacteria 1306
51 Ga0395905_0068015 3300037471 Bacteria 3337
52 Ga0395901_0102717 3300038443 Bacteria 3000
53 Ga0439436_0000578 3300041404 Bacteria 9700
54 Ga0451787_441775 3300041441 Bacteria 931
55 Ga0451800_1670221 3300041459 Bacteria 858
56 Ga0451837_1040057 3300041494 Bacteria 1588
57 Ga0451841_0837507 3300041498 Bacteria 876
58 Ga0451853_0094916 3300041512 Bacteria 1650
59 Ga0451853_1241271 3300041512 Bacteria 5998
60 Ga0439433_0001246 3300041999 Bacteria 5248
61 Ga0439433_0009613 3300041999 Bacteria 2110
62 Ga0439448_0036222 3300042005 Bacteria 1582
63 Ga0439449_0041463 3300042007 Bacteria 1711
64 Ga0439449_0108758 3300042007 Bacteria 1026
65 Ga0439449_0125812 3300042007 Bacteria 952
66 Ga0439457_002430 3300042014 Bacteria 5329
67 Ga0439457_003499 3300042014 Bacteria 4265
68 Ga0439462_0006659 3300042015 Bacteria 2878
69 Ga0439462_0036536 3300042015 Bacteria 1307
70 Ga0450890_003240 3300042127 Bacteria 2173
71 Ga0450894_001270 3300042131 Bacteria 3699
72 Ga0450896_006161 3300042133 Bacteria 1642
73 Ga0450898_000686 3300042134 Bacteria 4086
74 Ga0450899_000340 3300042135 Bacteria 5140
75 Ga0450903_001107 3300042138 Bacteria 5116
76 Ga0450906_001746 3300042145 Bacteria 4753
77 Ga0439458_0005541 3300042157 Bacteria 2838
78 Ga0450908_002617 3300042184 Bacteria 3530
79 Ga0466969_0027691 3300044656 Bacteria 2901
80 Ga0466969_0179659 3300044656 Bacteria 968
81 Ga0466972_0008376 3300044658 Bacteria 5181
82 Ga0466972_0058983 3300044658 Bacteria 1842
83 Ga0466965_0052694 3300044683 Bacteria 2021
84 Ga0466965_0295680 3300044683 Bacteria 877
85 Ga0466966_0002952 3300044684 Bacteria 11187
86 Ga0466966_0011353 3300044684 Bacteria 5907
87 Ga0466966_0126187 3300044684 Bacteria 1569
88 Ga0466966_0156473 3300044684 Bacteria 1388
89 Ga0466961_0000223 3300044693 Bacteria 38608
90 Ga0466961_0114969 3300044693 Bacteria 1691
91 Ga0466963_0002808 3300044694 Bacteria 9816
92 Ga0466964_0009791 3300044706 Bacteria 3611
93 Ga0466964_0034086 3300044706 Bacteria 2031
94 Ga0466964_0398319 3300044706 Bacteria 718
95 Ga0466971_0004939 3300044719 Bacteria 5769
96 Ga0466968_0084798 3300044735 Bacteria 1397
97 Ga0466970_0002506 3300044765 Bacteria 8853
98 Ga0466970_0024038 3300044765 Bacteria 3186
99 Ga0466957_0002550 3300044842 Bacteria 9799
100 Ga0466960_0009428 3300044901 Bacteria 4024
101 Ga0466959_0007800 3300045049 Bacteria 7531
102 Ga0466959_0251362 3300045049 Bacteria 1219
103 Ga0466958_0043496 3300045836 Bacteria 2705
104 Ga0466958_0129183 3300045836 Bacteria 1586
105 Ga0466967_0014792 3300045976 Bacteria 6096
106 Ga0466967_0015368 3300045976 Bacteria 5997
107 Ga0466967_0041324 3300045976 Bacteria 3975
108 Ga0466967_0464109 3300045976 Bacteria 1239
109 Ga0495603_0001242 3300046455 Bacteria 14884
110 Ga0495603_0006755 3300046455 Bacteria 6884
111 Ga0495603_0009014 3300046455 Bacteria 6035
112 Ga0495603_0012306 3300046455 Bacteria 5178
113 Ga0495629_0000657 3300046459 Bacteria 27953
114 Ga0495629_0001387 3300046459 Bacteria 19110
115 Ga0495629_0023583 3300046459 Bacteria 4383
116 Ga0495638_0023441 3300046460 Bacteria 4036
117 Ga0495641_0427966 3300046461 Bacteria 601
118 Ga0495651_0255216 3300046462 Bacteria 1195
119 Ga0495662_0198698 3300046476 Bacteria 988
120 Ga0495585_0200409 3300046492 Bacteria 1016
121 Ga0495594_0003720 3300046499 Bacteria 7827
122 Ga0495594_0132762 3300046499 Bacteria 1410
123 Ga0495594_0736942 3300046499 Bacteria 556
124 Ga0495607_0017006 3300046501 Bacteria 4681
125 Ga0495616_0009177 3300046513 Bacteria 5803
126 Ga0495620_0073506 3300046515 Bacteria 1394
127 Ga0495628_0018736 3300046516 Bacteria 5729
128 Ga0495630_0254651 3300046517 Bacteria 1341
129 Ga0495637_0039977 3300046520 Bacteria 2021
130 Ga0495648_0049949 3300046524 Bacteria 2560
131 Ga0495666_0013485 3300046526 Bacteria 4075
132 Ga0495652_0306426 3300046529 Bacteria 1152
133 Ga0495654_0033098 3300046530 Bacteria 2617
134 Ga0495609_0009304 3300046538 Bacteria 4761
135 Ga0495622_0041575 3300046557 Bacteria 2137
136 Ga0495622_0090360 3300046557 Bacteria 1407
137 Ga0495633_0038660 3300046558 Bacteria 2278
138 Ga0495633_0391689 3300046558 Bacteria 628
139 Ga0495656_0432607 3300046615 Bacteria 691
140 Ga0495668_0009901 3300046616 Bacteria 5813
141 Ga0495611_0030061 3300046648 Bacteria 2386
142 Ga0495625_0033876 3300046660 Bacteria 3772
143 Ga0495625_0233774 3300046660 Bacteria 1199
144 Ga0495635_0029848 3300046663 Bacteria 3792
145 Ga0495588_0006976 3300046674 Bacteria 5121
146 Ga0495657_0019451 3300046675 Bacteria 4898
147 Ga0495623_0129791 3300046679 Bacteria 1510
148 Ga0495658_0462853 3300046683 Bacteria 810
149 Ga0495613_0013206 3300046689 Bacteria 6137
150 Ga0495613_0092515 3300046689 Bacteria 2189
151 Ga0495613_0245620 3300046689 Bacteria 1250
152 Ga0495613_0271110 3300046689 Bacteria 1180
153 Ga0495624_0039405 3300046690 Bacteria 3029
154 Ga0495670_0094756 3300046691 Bacteria 1531
155 Ga0495671_0011205 3300046692 Bacteria 4945
156 Ga0495589_0041842 3300046794 Bacteria 2284
157 Ga0495589_0142280 3300046794 Bacteria 1148
158 Ga0495600_0488776 3300046809 Bacteria 757
159 Ga0495600_0742061 3300046809 Bacteria 588
160 Ga0495660_0092658 3300046810 Bacteria 1567
161 Ga0495581_0021938 3300047315 Bacteria 3701
162 Ga0495636_0004601 3300047318 Bacteria 5408
163 Ga0495636_0005668 3300047318 Bacteria 4894
164 Ga0495636_0033586 3300047318 Bacteria 2109
165 Ga0495636_0216272 3300047318 Bacteria 879
166 Ga0495676_0010759 3300047321 Bacteria 8281
167 Ga0495676_0018210 3300047321 Bacteria 6195
168 Ga0495676_0109605 3300047321 Bacteria 2028
169 Ga0495680_0036137 3300047322 Bacteria 3970
170 Ga0495683_0074124 3300047323 Bacteria 1668
171 Ga0495683_0199140 3300047323 Bacteria 904
172 Ga0495687_005741 3300047443 Bacteria 7801
173 Ga0495687_010976 3300047443 Bacteria 4911
174 Ga0495687_050955 3300047443 Bacteria 1760
175 Ga0495675_0038484 3300047444 Bacteria 3045
176 Ga0495685_003548 3300047447 Bacteria 4985
177 Ga0495685_022008 3300047447 Bacteria 2194
178 Ga0495685_032869 3300047447 Bacteria 1782
179 Ga0495681_0006716 3300047470 Bacteria 7510
180 Ga0495681_0053835 3300047470 Bacteria 1882
181 Ga0495686_0081957 3300047472 Bacteria 1969
182 Ga0495686_0122476 3300047472 Bacteria 1548
183 Ga0495593_0218482 3300047673 Bacteria 956
184 Ga0495614_0003158 3300048089 Bacteria 7351
185 Ga0495614_0003522 3300048089 Bacteria 7011
186 Ga0496100_1284129 3300048903 Bacteria 578
187 Ga0496102_0807976 3300048905 Bacteria 860
188 Ga0496106_0141729 3300048909 Bacteria 1891
189 Ga0496113_0280976 3300048916 Bacteria 1331
190 Ga0495682_0071257 3300049460 Bacteria 1251
191 Ga0501031_0231829 3300049568 Bacteria 1201
192 Ga0501031_0679910 3300049568 Bacteria 661
193 Ga0501032_0013667 3300049569 Bacteria 5767
194 Ga0501033_0678135 3300049570 Bacteria 702
195 Ga0501034_0026007 3300049571 Bacteria 5962
196 Ga0501034_0037237 3300049571 Bacteria 4925
197 Ga0501034_0105570 3300049571 Bacteria 2809
198 Ga0501034_0206132 3300049571 Bacteria 1922
199 Ga0501036_0008873 3300049572 Bacteria 8256
200 Ga0501036_0235347 3300049572 Bacteria 1536
201 Ga0501036_0301840 3300049572 Bacteria 1339
202 Ga0501036_0326690 3300049572 Bacteria 1281
203 Ga0501037_0069259 3300049573 Bacteria 2568
204 Ga0501037_0159394 3300049573 Bacteria 1609
205 Ga0501038_0001319 3300049574 Bacteria 22562
206 Ga0501038_0030813 3300049574 Bacteria 4742
207 Ga0501038_0151779 3300049574 Bacteria 1888
208 Ga0501039_0165571 3300049575 Bacteria 1738
209 Ga0501042_0232088 3300049578 Bacteria 1331
210 Ga0501043_0119347 3300049579 Bacteria 2068
211 Ga0501046_0053313 3300049580 Bacteria 3186
212 Ga0501047_0050274 3300049581 Bacteria 4025
213 Ga0501047_0066970 3300049581 Bacteria 3461
214 Ga0501047_0105555 3300049581 Bacteria 2697
215 Ga0501048_0014290 3300049582 Bacteria 5879
216 Ga0501069_0217075 3300049585 Bacteria 1111
217 Ga0501070_0008734 3300049586 Bacteria 8566
218 Ga0501073_0152263 3300049589 Bacteria 1603
219 Ga0501080_0056474 3300049742 Bacteria 3656
220 Ga0501035_0044253 3300049822 Bacteria 4009
221 Ga0501035_0049228 3300049822 Bacteria 3777
222 Ga0501035_0061326 3300049822 Bacteria 3347
223 Ga0501035_0111451 3300049822 Bacteria 2398
224 Ga0501044_0002675 3300049823 Bacteria 20281
225 Ga0501044_0033653 3300049823 Bacteria 5383
226 Ga0501044_0062247 3300049823 Bacteria 3814
227 Ga0501044_0063063 3300049823 Bacteria 3787
228 Ga0501044_1123928 3300049823 Bacteria 655
229 nmdc:mga03n38_11874_c1 3300050490 Bacteria 3259
230 nmdc:mga03n38_120963_c1 3300050490 Bacteria 1286
231 Ga0495655_0135926 3300053083 Bacteria 761
232 Ga0500644_0060763 3300053088 Bacteria 1330
233 Ga0500566_0020676 3300053094 Bacteria 3870
234 Ga0500650_0176666 3300053098 Bacteria 980
235 Ga0500553_119230 3300053101 Bacteria 1091
236 Ga0500560_006133 3300053107 Bacteria 2723
237 Ga0500600_0087507 3300053149 Bacteria 1670
238 Ga0500634_0251053 3300053161 Bacteria 735
239 Ga0466962_0000512 3300061719 Bacteria 16909
240 Ga0466962_0029431 3300061719 Bacteria 2629
241 2547406575 2547132111 Bacteria 8013147
242 2585300434 2582581312 Bacteria 7308206
243 2585317057 2582581314 Bacteria 11452267
244 2643760172 2643221548 Bacteria 8053412
245 2643904524 2643221578 Bacteria 9213798
246 2643946514 2643221587 Bacteria 7586415
247 2644389137 2643221670 Bacteria 6497041
248 2644406208 2643221673 Bacteria 9196637
249 2644434318 2643221677 Bacteria 7584031
250 2644460132 2643221682 Bacteria 6743283
251 2768645772 2767802112 Bacteria 6465194
252 2784586788 2784132148 Bacteria 8627943
253 2785345693 2784746763 Bacteria 9783172
254 2785367197 2784746768 Bacteria 10036182
255 2786668244 2786546132 Bacteria 10419719
256 2793978035 2791355406 Bacteria 11364898
257 2804843770 2802429296 Bacteria 7227771
258 2808918436 2808606375 Bacteria 9466072
259 2809230354 2808606448 Bacteria 8656184
260 2812360268 2811994879 Bacteria 9313447
261 2819696410 2818991463 Bacteria 7948711
262 2852637760 2852635781 Bacteria 8251373
263 2862289617 2862281513 Bacteria 9621493
264 2862290441 2862290372 Bacteria 7471434
265 2862390947 2862382967 Bacteria 10317375
266 2862510454 2862507626 Bacteria 9425308
267 2863406931 2863404153 Bacteria 9672205
268 2867480385 2867475112 Bacteria 6909112
269 2873157647 2873151551 Bacteria 8625867
270 2877683350 2877676314 Bacteria 9512378
271 2912722363 2912715099 Bacteria 9460473
272 2918502558 2918501144 Bacteria 8668083
273 2935394746 2935390628 Bacteria 7043367
274 2946051986 2946045630 Bacteria 8527308
275 2946065622 2946064051 Bacteria 8957905
276 2946073972 2946072368 Bacteria 8999607
277 2947231790 2947224130 Bacteria 9938529
278 2954674528 2954673503 Bacteria 9685905
279 2954689604 2954682443 Bacteria 9862841
280 2954699387 2954691527 Bacteria 10720516
281 2954702832 2954701450 Bacteria 10834262
282 2966604352 2966598605 Bacteria 7676064
283 2990059534 2990059506 Bacteria 9321252
284 2997605636 2997600082 Bacteria 9896405
285 3006327964 3006321560 Bacteria 8247479
286 3006393496 3006393351 Bacteria 6615579
287 3006430641 3006425503 Bacteria 6491253
288 3006495190 3006493962 Bacteria 8825450
289 8008561356 8008558824 Bacteria 10610750
290 8008580715 8008574985 Bacteria 7815457
291 8023628550 8023623736 Bacteria 8593882
292 8025414778 8025413630 Bacteria 7014048
293 8033686142 8033684223 Bacteria 6906479
294 8047894888 8047893842 Bacteria 11723082
295 8048130444 8048127548 Bacteria 11053136
296 8048364162 8048356638 Bacteria 11044339
297 8048371906 8048369669 Bacteria 11666822
298 8048380840 8048379754 Bacteria 11877923
299 8048413603 8048406513 Bacteria 8936924
300 8054166875 8054160619 Bacteria 7783213
301 Ga0466965_0254223
302 JGI24739J22299_10066695
303 rootH1_10011569
304 rootH2_10049036
305 rootL2_10000887
306 Ga0006562J51391_1127145
307 Ga0068853_100024882
308 Ga0068854_100707312
309 Ga0075363_100024278
310 Ga0105250_10280136
311 Ga0105246_10479249
312 Ga0105246_10570959
313 Ga0157375_11294854
314 Ga0183367_1010
315 Ga0209758_1016191
316 Ga0207426_1003435
317 Ga0207647_10051531
318 Ga0207639_10009832
319 Ga0307517_10014987
320 Ga0307515_10039805
321 Ga0268256_1035608
322 Ga0307511_10002263
323 Ga0307511_10125236
324 Ga0307512_10078340
325 Ga0316180_1041784
326 Ga0307513_10169270
327 Ga0307513_10274180
328 Ga0307509_10030969
329 Ga0307509_10042451
330 Ga0307509_10525688
331 Ga0307508_10006070
332 Ga0307514_10004636
333 Ga0307514_10069482
334 Ga0307514_10190529
335 Ga0307516_10031580
336 Ga0307516_10346792
337 Ga0307516_10377535
338 Ga0307413_10036434
339 Ga0307518_10034690
340 Ga0307518_10150130
341 Ga0307416_100020469
342 Ga0307411_10315051
343 Ga0307411_10439696
344 Ga0307510_10023606
345 Ga0307510_10059555
346 Ga0307510_10068182
347 Ga0307510_10089290
348 Ga0395900_1106610
349 Ga0395898_0003733
350 Ga0395898_0402005
351 Ga0395905_0068015
352 Ga0395901_0102717
353 Ga0439436_0000578
354 Ga0451787_441775
355 Ga0451800_1670221
356 Ga0451837_1040057
357 Ga0451841_0837507
358 Ga0451853_0094916
359 Ga0451853_1241271
360 Ga0439433_0001246
361 Ga0439433_0009613
362 Ga0439448_0036222
363 Ga0439449_0041463
364 Ga0439449_0108758
365 Ga0439449_0125812
366 Ga0439457_002430
367 Ga0439457_003499
368 Ga0439462_0006659
369 Ga0439462_0036536
370 Ga0450890_003240
371 Ga0450894_001270
372 Ga0450896_006161
373 Ga0450898_000686
374 Ga0450899_000340
375 Ga0450903_001107
376 Ga0450906_001746
377 Ga0439458_0005541
378 Ga0450908_002617
379 Ga0466969_0027691
380 Ga0466969_0179659
381 Ga0466972_0008376
382 Ga0466972_0058983
383 Ga0466965_0052694
384 Ga0466965_0295680
385 Ga0466966_0002952
386 Ga0466966_0011353
387 Ga0466966_0126187
388 Ga0466966_0156473
389 Ga0466961_0000223
390 Ga0466961_0114969
391 Ga0466963_0002808
392 Ga0466964_0009791
393 Ga0466964_0034086
394 Ga0466964_0398319
395 Ga0466971_0004939
396 Ga0466968_0084798
397 Ga0466970_0002506
398 Ga0466970_0024038
399 Ga0466957_0002550
400 Ga0466960_0009428
401 Ga0466959_0007800
402 Ga0466959_0251362
403 Ga0466958_0043496
404 Ga0466958_0129183
405 Ga0466967_0014792
406 Ga0466967_0015368
407 Ga0466967_0041324
408 Ga0466967_0464109
409 Ga0495603_0001242
410 Ga0495603_0006755
411 Ga0495603_0009014
412 Ga0495603_0012306
413 Ga0495629_0000657
414 Ga0495629_0001387
415 Ga0495629_0023583
416 Ga0495638_0023441
417 Ga0495641_0427966
418 Ga0495651_0255216
419 Ga0495662_0198698
420 Ga0495585_0200409
421 Ga0495594_0003720
422 Ga0495594_0132762
423 Ga0495594_0736942
424 Ga0495607_0017006
425 Ga0495616_0009177
426 Ga0495620_0073506
427 Ga0495628_0018736
428 Ga0495630_0254651
429 Ga0495637_0039977
430 Ga0495648_0049949
431 Ga0495666_0013485
432 Ga0495652_0306426
433 Ga0495654_0033098
434 Ga0495609_0009304
435 Ga0495622_0041575
436 Ga0495622_0090360
437 Ga0495633_0038660
438 Ga0495633_0391689
439 Ga0495656_0432607
440 Ga0495668_0009901
441 Ga0495611_0030061
442 Ga0495625_0033876
443 Ga0495625_0233774
444 Ga0495635_0029848
445 Ga0495588_0006976
446 Ga0495657_0019451
447 Ga0495623_0129791
448 Ga0495658_0462853
449 Ga0495613_0013206
450 Ga0495613_0092515
451 Ga0495613_0245620
452 Ga0495613_0271110
453 Ga0495624_0039405
454 Ga0495670_0094756
455 Ga0495671_0011205
456 Ga0495589_0041842
457 Ga0495589_0142280
458 Ga0495600_0488776
459 Ga0495600_0742061
460 Ga0495660_0092658
461 Ga0495581_0021938
462 Ga0495636_0004601
463 Ga0495636_0005668
464 Ga0495636_0033586
465 Ga0495636_0216272
466 Ga0495676_0010759
467 Ga0495676_0018210
468 Ga0495676_0109605
469 Ga0495680_0036137
470 Ga0495683_0074124
471 Ga0495683_0199140
472 Ga0495687_005741
473 Ga0495687_010976
474 Ga0495687_050955
475 Ga0495675_0038484
476 Ga0495685_003548
477 Ga0495685_022008
478 Ga0495685_032869
479 Ga0495681_0006716
480 Ga0495681_0053835
481 Ga0495686_0081957
482 Ga0495686_0122476
483 Ga0495593_0218482
484 Ga0495614_0003158
485 Ga0495614_0003522
486 Ga0496100_1284129
487 Ga0496102_0807976
488 Ga0496106_0141729
489 Ga0496113_0280976
490 Ga0495682_0071257
491 Ga0501031_0231829
492 Ga0501031_0679910
493 Ga0501032_0013667
494 Ga0501033_0678135
495 Ga0501034_0026007
496 Ga0501034_0037237
497 Ga0501034_0105570
498 Ga0501034_0206132
499 Ga0501036_0008873
500 Ga0501036_0235347
501 Ga0501036_0301840
502 Ga0501036_0326690
503 Ga0501037_0069259
504 Ga0501037_0159394
505 Ga0501038_0001319
506 Ga0501038_0030813
507 Ga0501038_0151779
508 Ga0501039_0165571
509 Ga0501042_0232088
510 Ga0501043_0119347
511 Ga0501046_0053313
512 Ga0501047_0050274
513 Ga0501047_0066970
514 Ga0501047_0105555
515 Ga0501048_0014290
516 Ga0501069_0217075
517 Ga0501070_0008734
518 Ga0501073_0152263
519 Ga0501080_0056474
520 Ga0501035_0044253
521 Ga0501035_0049228
522 Ga0501035_0061326
523 Ga0501035_0111451
524 Ga0501044_0002675
525 Ga0501044_0033653
526 Ga0501044_0062247
527 Ga0501044_0063063
528 Ga0501044_1123928
529 nmdc:mga03n38_11874_c1
530 nmdc:mga03n38_120963_c1
531 Ga0495655_0135926
532 Ga0500644_0060763
533 Ga0500566_0020676
534 Ga0500650_0176666
535 Ga0500553_119230
536 Ga0500560_006133
537 Ga0500600_0087507
538 Ga0500634_0251053
539 Ga0466962_0000512
540 Ga0466962_0029431
541 2547406575
542 2585300434
543 2585317057
544 2643760172
545 2643904524
546 2643946514
547 2644389137
548 2644406208
549 2644434318
550 2644460132
551 2768645772
552 2784586788
553 2785345693
554 2785367197
555 2786668244
556 2793978035
557 2804843770
558 2808918436
559 2809230354
560 2812360268
561 2819696410
562 2852637760
563 2862289617
564 2862290441
565 2862390947
566 2862510454
567 2863406931
568 2867480385
569 2873157647
570 2877683350
571 2912722363
572 2918502558
573 2935394746
574 2946051986
575 2946065622
576 2946073972
577 2947231790
578 2954674528
579 2954689604
580 2954699387
581 2954702832
582 2966604352
583 2990059534
584 2997605636
585 3006327964
586 3006393496
587 3006430641
588 3006495190
589 8008561356
590 8008580715
591 8023628550
592 8025414778
593 8033686142
594 8047894888
595 8048130444
596 8048364162
597 8048371906
598 8048380840
599 8048413603
600 8054166875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13462

Thioredoxin_4

Thioredoxin

31

187

0.93

PF01323

DSBA

DSBA-like thioredoxin domain

37

186

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rgv-assembly1.cif.gz_A structure of caulobacter crescentus suppressor of copper sensitivity protein c 0.8712 12 170
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.871 12 168
5nyl-assembly2.cif.gz_B crystal structure of an atypical poplar thioredoxin-like2.1 active site mutant 0.8611 11 47
4xvw-assembly4.cif.gz_L crystal structure of proteus mirabilis scsc in a compact conformation 0.8528 13 170
4wxt-assembly1.cif.gz_A x-ray crystal structure of thioredoxin from mycobacterium avium 0.8516 11 47
ID Description Score Start End Superfamily
3ul3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9414 11 47 3.40.30.10
af_Q8IIR6_171_285_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.886 10 47 3.40.30.10
af_Q8K2W3_103_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8815 12 47 3.40.30.10
af_C6T172_46_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8657 11 161 3.40.30.10
af_I1L0J8_69_181_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8624 11 47 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W9UYS3-F1-model_v4 Protein-disulfide isomerase 1 11 171 GO:0016491
GO:0016853
AF-A0A1U9NUP8-F1-model_v4 Disulfide bond formation protein DsbA 0.9994 11 170 GO:0016491
AF-A0A1D7VXA9-F1-model_v4 Disulfide bond formation protein DsbA 0.9989 13 171 GO:0016491
AF-A0A1I6QW80-F1-model_v4 DsbA family protein (Thioredoxin) 0.9913 11 166 GO:0016491
AF-A0A6G2RSB6-F1-model_v4 Thioredoxin domain-containing protein 0.9826 1 173

Map