F395366

General Info

Members Datasets Scaffolds Average Seq Length
300 180 600 118

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_12621871|Ga0163162_126218712
Length 132
Sequence LFEIDSQVSRDLSIPLDMTSVRIAALLCFLAVALGAFGAHSLKQILETHGMLDVWNKAVLYHFIHALALLVLALFGAANRSTWWLLFAGIFIFSGSLYVMALTNIRWLGAITPIGGLCFLAGWAWLAIAPRS

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
129 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
130 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
146 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
149 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
150 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
151 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.33
Rhizosphere 93.67
Stem 0
Stem Tuber 0
Unclassified 29.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_12621871 3300013306 Unclassified 580
2 CNXas_1000040 3300000545 Bacteria 26878
3 JGI25404J52841_10007012 3300003659 Unclassified 2371
4 JGI25405J52794_10000232 3300003911 Bacteria 7350
5 JGI25405J52794_10006702 3300003911 Bacteria 2109
6 Ga0065703_1019140 3300005272 Unclassified 3820
7 Ga0065714_10141875 3300005288 Bacteria 1165
8 Ga0065704_10014697 3300005289 Bacteria 1894
9 Ga0065704_10065631 3300005289 Unclassified 530
10 Ga0065704_10179016 3300005289 Bacteria 1247
11 Ga0065704_10829814 3300005289 Bacteria 514
12 Ga0065712_10492543 3300005290 Unclassified 655
13 Ga0065715_10001925 3300005293 Bacteria 9082
14 Ga0065715_10053314 3300005293 Bacteria 1103
15 Ga0065715_10213529 3300005293 Bacteria 1271
16 Ga0065707_10011050 3300005295 Bacteria 1991
17 Ga0070676_10001331 3300005328 Bacteria 12414
18 Ga0068869_100082553 3300005334 Unclassified 2402
19 Ga0070666_10121178 3300005335 Bacteria 1814
20 Ga0068868_100295118 3300005338 Bacteria 1375
21 Ga0070660_100073519 3300005339 Unclassified 2673
22 Ga0070689_100043390 3300005340 Unclassified 3456
23 Ga0070687_100006577 3300005343 Bacteria 4774
24 Ga0070687_100172139 3300005343 Bacteria 1290
25 Ga0070661_101110355 3300005344 Bacteria 659
26 Ga0070668_100015646 3300005347 Bacteria 5672
27 Ga0070669_100001053 3300005353 Bacteria 20176
28 Ga0070675_100000362 3300005354 Bacteria 30738
29 Ga0070675_100088755 3300005354 Bacteria 2588
30 Ga0070675_100324155 3300005354 Unclassified 1361
31 Ga0070671_100828664 3300005355 Bacteria 806
32 Ga0070671_101411587 3300005355 Bacteria 615
33 Ga0070688_100149950 3300005365 Bacteria 1593
34 Ga0070667_100003731 3300005367 Bacteria 12934
35 Ga0070667_100929255 3300005367 Unclassified 810
36 Ga0070703_10442695 3300005406 Unclassified 574
37 Ga0070714_100048395 3300005435 Bacteria 3616
38 Ga0070714_100068702 3300005435 Bacteria 3058
39 Ga0070714_100608088 3300005435 Unclassified 1050
40 Ga0070713_100133531 3300005436 Bacteria 2191
41 Ga0070711_100337242 3300005439 Bacteria 1209
42 Ga0070711_100373138 3300005439 Bacteria 1152
43 Ga0070711_100668624 3300005439 Bacteria 872
44 Ga0070711_101837757 3300005439 Unclassified 532
45 Ga0070705_100202885 3300005440 Bacteria 1361
46 Ga0070705_101176063 3300005440 Bacteria 631
47 Ga0070708_100008099 3300005445 Bacteria 8427
48 Ga0070708_100032144 3300005445 Unclassified 4549
49 Ga0070708_100042178 3300005445 Bacteria 4004
50 Ga0070708_100131703 3300005445 Bacteria 2315
51 Ga0070708_100753848 3300005445 Bacteria 915
52 Ga0070708_100865090 3300005445 Bacteria 849
53 Ga0070708_101561106 3300005445 Unclassified 615
54 Ga0070663_100104523 3300005455 Unclassified 2118
55 Ga0070662_100000681 3300005457 Bacteria 20752
56 Ga0070706_100000012 3300005467 Bacteria 195040
57 Ga0070706_100004668 3300005467 Bacteria 13137
58 Ga0070706_100032903 3300005467 Bacteria 4783
59 Ga0070706_100125951 3300005467 Unclassified 2389
60 Ga0070706_100391893 3300005467 Bacteria 1293
61 Ga0070706_100584644 3300005467 Bacteria 1038
62 Ga0070707_100002266 3300005468 Bacteria 18369
63 Ga0070707_100036044 3300005468 Bacteria 4719
64 Ga0070707_100091508 3300005468 Bacteria 2945
65 Ga0070707_100125799 3300005468 Bacteria 2491
66 Ga0070707_100273976 3300005468 Bacteria 1641
67 Ga0070707_100290085 3300005468 Bacteria 1590
68 Ga0070698_100004688 3300005471 Bacteria 15021
69 Ga0070698_100014459 3300005471 Bacteria 8337
70 Ga0070698_100476639 3300005471 Bacteria 1185
71 Ga0070698_102118814 3300005471 Bacteria 516
72 Ga0070699_100018337 3300005518 Bacteria 6013
73 Ga0070699_101369653 3300005518 Unclassified 649
74 Ga0070699_101505196 3300005518 Unclassified 617
75 Ga0070684_101408983 3300005535 Unclassified 656
76 Ga0070697_100001381 3300005536 Bacteria 18360
77 Ga0070697_100068383 3300005536 Bacteria 2908
78 Ga0070697_100106476 3300005536 Bacteria 2333
79 Ga0070697_100290754 3300005536 Bacteria 1403
80 Ga0070697_100311260 3300005536 Bacteria 1355
81 Ga0070697_101769594 3300005536 Unclassified 553
82 Ga0068853_100924083 3300005539 Bacteria 838
83 Ga0070672_100981637 3300005543 Bacteria 748
84 Ga0070672_101039230 3300005543 Bacteria 727
85 Ga0070695_101544296 3300005545 Unclassified 553
86 Ga0070693_100275382 3300005547 Bacteria 1125
87 Ga0070665_100241806 3300005548 Bacteria 1806
88 Ga0068854_101346098 3300005578 Unclassified 644
89 Ga0070702_100334162 3300005615 Bacteria 1061
90 Ga0068852_100317802 3300005616 Unclassified 1511
91 Ga0068864_100780521 3300005618 Unclassified 938
92 Ga0068864_100871992 3300005618 Bacteria 888
93 Ga0068861_100030096 3300005719 Bacteria 3977
94 Ga0068861_102038197 3300005719 Bacteria 573
95 Ga0068863_100863198 3300005841 Bacteria 904
96 Ga0068858_100290453 3300005842 Unclassified 1558
97 Ga0068860_101663763 3300005843 Unclassified 660
98 Ga0081455_10000382 3300005937 Bacteria 58627
99 Ga0081455_10007811 3300005937 Bacteria 11203
100 Ga0081455_10018715 3300005937 Bacteria 6576
101 Ga0081455_10019089 3300005937 Bacteria 6499
102 Ga0081455_10041711 3300005937 Bacteria 4033
103 Ga0081455_10226446 3300005937 Bacteria 1383
104 Ga0081455_10309211 3300005937 Unclassified 1130
105 Ga0081540_1000018 3300005983 Bacteria 164931
106 Ga0081540_1020633 3300005983 Bacteria 3954
107 Ga0081539_10002356 3300005985 Bacteria 27128
108 Ga0070717_10011260 3300006028 Bacteria 6786
109 Ga0070717_10184464 3300006028 Bacteria 1820
110 Ga0070717_10218954 3300006028 Bacteria 1673
111 Ga0070717_10418738 3300006028 Bacteria 1205
112 Ga0070717_10775755 3300006028 Unclassified 872
113 Ga0070717_11828782 3300006028 Unclassified 549
114 Ga0070715_10278214 3300006163 Bacteria 886
115 Ga0070716_100294581 3300006173 Bacteria 1126
116 Ga0070716_100484363 3300006173 Unclassified 909
117 Ga0070712_100031812 3300006175 Bacteria 3557
118 Ga0070712_100246277 3300006175 Bacteria 1426
119 Ga0070712_100390334 3300006175 Bacteria 1148
120 Ga0070712_100791489 3300006175 Bacteria 813
121 Ga0075428_100569959 3300006844 Bacteria 1210
122 Ga0075433_10376775 3300006852 Bacteria 1253
123 Ga0075434_102528668 3300006871 Unclassified 514
124 Ga0068865_100150656 3300006881 Unclassified 1764
125 Ga0075436_100160649 3300006914 Unclassified 1584
126 Ga0075436_100225877 3300006914 Bacteria 1329
127 Ga0075435_100262091 3300007076 Bacteria 1473
128 Ga0075435_101449530 3300007076 Unclassified 602
129 Ga0099794_10411556 3300007265 Unclassified 707
130 Ga0111539_10202291 3300009094 Bacteria 2316
131 Ga0105245_10015213 3300009098 Bacteria 6704
132 Ga0105245_11053182 3300009098 Unclassified 859
133 Ga0105247_10079832 3300009101 Bacteria 2059
134 Ga0114129_10111304 3300009147 Bacteria 3778
135 Ga0114129_10185661 3300009147 Bacteria 2826
136 Ga0105243_10051420 3300009148 Bacteria 3259
137 Ga0105248_11771363 3300009177 Bacteria 700
138 Ga0105237_10145145 3300009545 Unclassified 2368
139 Ga0105249_10020979 3300009553 Bacteria 5845
140 Ga0105249_10460415 3300009553 Unclassified 1312
141 Ga0105239_10971009 3300010375 Unclassified 976
142 Ga0157374_10028056 3300013296 Bacteria 5084
143 Ga0157374_10074366 3300013296 Bacteria 3208
144 Ga0157374_10574808 3300013296 Unclassified 1136
145 Ga0157378_10007272 3300013297 Bacteria 9669
146 Ga0157378_10030172 3300013297 Bacteria 4790
147 Ga0157378_10200571 3300013297 Unclassified 1887
148 Ga0163162_10001659 3300013306 Bacteria 20860
149 Ga0157372_10133644 3300013307 Unclassified 2856
150 Ga0157375_10049946 3300013308 Bacteria 4101
151 Ga0157375_10073862 3300013308 Bacteria 3430
152 Ga0157375_10196638 3300013308 Unclassified 2171
153 Ga0163163_10112170 3300014325 Bacteria 2756
154 Ga0157377_10430375 3300014745 Unclassified 906
155 Ga0157379_10425563 3300014968 Bacteria 1223
156 Ga0157379_10622597 3300014968 Bacteria 1009
157 Ga0157376_10027063 3300014969 Bacteria 4540
158 Ga0163161_10963946 3300017792 Unclassified 726
159 Ga0207673_1002715 3300025290 Unclassified 2036
160 Ga0207697_10000084 3300025315 Bacteria 41551
161 Ga0207697_10222650 3300025315 Bacteria 832
162 Ga0207692_10190588 3300025898 Unclassified 1200
163 Ga0207710_10034848 3300025900 Bacteria 2213
164 Ga0207647_10178501 3300025904 Unclassified 1234
165 Ga0207699_10532717 3300025906 Bacteria 850
166 Ga0207645_10000107 3300025907 Bacteria 61800
167 Ga0207684_10000028 3300025910 Bacteria 306450
168 Ga0207684_10006256 3300025910 Bacteria 10870
169 Ga0207684_10007366 3300025910 Bacteria 9923
170 Ga0207684_10010301 3300025910 Bacteria 8232
171 Ga0207684_10124908 3300025910 Bacteria 2207
172 Ga0207684_10506210 3300025910 Bacteria 1035
173 Ga0207671_11210286 3300025914 Unclassified 591
174 Ga0207693_10009752 3300025915 Bacteria 7818
175 Ga0207693_10019750 3300025915 Bacteria 5357
176 Ga0207693_10040651 3300025915 Bacteria 3662
177 Ga0207693_10051312 3300025915 Bacteria 3237
178 Ga0207693_10236451 3300025915 Bacteria 1434
179 Ga0207693_10383827 3300025915 Bacteria 1099
180 Ga0207663_10818894 3300025916 Bacteria 742
181 Ga0207662_10000513 3300025918 Bacteria 17267
182 Ga0207662_10072266 3300025918 Bacteria 2090
183 Ga0207657_10312941 3300025919 Unclassified 1243
184 Ga0207649_10620006 3300025920 Bacteria 833
185 Ga0207646_10003807 3300025922 Bacteria 16773
186 Ga0207646_10009246 3300025922 Bacteria 9760
187 Ga0207646_10060112 3300025922 Bacteria 3394
188 Ga0207646_10747113 3300025922 Bacteria 873
189 Ga0207650_10457640 3300025925 Unclassified 1063
190 Ga0207659_10005324 3300025926 Bacteria 7797
191 Ga0207659_10165367 3300025926 Bacteria 1741
192 Ga0207659_10387763 3300025926 Bacteria 1166
193 Ga0207687_10806595 3300025927 Bacteria 801
194 Ga0207664_10032438 3300025929 Bacteria 4002
195 Ga0207664_10591207 3300025929 Bacteria 997
196 Ga0207706_10000823 3300025933 Bacteria 32168
197 Ga0207686_10074604 3300025934 Bacteria 2192
198 Ga0207709_10281150 3300025935 Bacteria 1229
199 Ga0207670_10087029 3300025936 Unclassified 2200
200 Ga0207665_10213896 3300025939 Unclassified 1410
201 Ga0207665_10449283 3300025939 Bacteria 989
202 Ga0207665_10526675 3300025939 Bacteria 916
203 Ga0207691_10083221 3300025940 Bacteria 2873
204 Ga0207691_10431938 3300025940 Bacteria 1122
205 Ga0207689_10030764 3300025942 Bacteria 4473
206 Ga0207689_10389490 3300025942 Bacteria 1161
207 Ga0207712_10009860 3300025961 Bacteria 6055
208 Ga0207668_10015248 3300025972 Bacteria 4770
209 Ga0207658_10017608 3300025986 Bacteria 4926
210 Ga0207639_10366923 3300026041 Unclassified 1290
211 Ga0207678_10006881 3300026067 Bacteria 10085
212 Ga0207708_10592160 3300026075 Unclassified 939
213 Ga0207676_11004030 3300026095 Bacteria 822
214 Ga0207675_100171498 3300026118 Unclassified 2074
215 Ga0207698_10481960 3300026142 Unclassified 1203
216 Ga0210002_1012500 3300027617 Bacteria 1320
217 Ga0209998_10029020 3300027717 Unclassified 1218
218 Ga0209974_10026597 3300027876 Bacteria 1915
219 Ga0268266_10040134 3300028379 Bacteria 3989
220 Ga0268266_10290922 3300028379 Unclassified 1521
221 Ga0268265_10226943 3300028380 Unclassified 1638
222 Ga0268264_11103489 3300028381 Unclassified 802
223 Ga0307513_10007605 3300031456 Bacteria 14006
224 Ga0307513_10030234 3300031456 Bacteria 6155
225 Ga0316579_10006967 3300031691 Bacteria 4643
226 Ga0316576_10007878 3300031727 Bacteria 6739
227 Ga0316576_10485881 3300031727 Unclassified 909
228 Ga0316578_10000004 3300031728 Bacteria 48576
229 Ga0316577_10093147 3300031733 Bacteria 1687
230 Ga0316577_10357109 3300031733 Bacteria 829
231 Ga0316580_10013254 3300032139 Bacteria 2512
232 Ga0373955_0018448 3300035172 Bacteria 3470
233 Ga0316574_0046295 3300035398 Bacteria 2697
234 Ga0316574_0168054 3300035398 Bacteria 1412
235 Ga0373947_0046737 3300035725 Bacteria 2593
236 Ga0373947_0200051 3300035725 Bacteria 1307
237 Ga0373947_0499882 3300035725 Bacteria 826
238 Ga0373937_0444171 3300036401 Bacteria 1231
239 Ga0316582_0030121 3300036647 Bacteria 3303
240 Ga0316584_0000213 3300036712 Bacteria 28730
241 Ga0316584_0174047 3300036712 Bacteria 1595
242 Ga0373925_0805245 3300037068 Unclassified 775
243 Ga0395899_0339053 3300037312 Bacteria 1008
244 Ga0395900_0006499 3300037418 Bacteria 12186
245 Ga0395900_0159682 3300037418 Unclassified 2300
246 Ga0395900_0447873 3300037418 Unclassified 1248
247 Ga0395898_0005809 3300037466 Bacteria 13274
248 Ga0395898_0462300 3300037466 Unclassified 1208
249 Ga0395898_0896739 3300037466 Bacteria 825
250 Ga0395905_0053313 3300037471 Bacteria 3785
251 Ga0395905_0610424 3300037471 Unclassified 993
252 Ga0395901_0001494 3300038443 Bacteria 24317
253 Ga0395901_0655917 3300038443 Bacteria 1052
254 Ga0395901_0855090 3300038443 Unclassified 895
255 Ga0395901_1832334 3300038443 Bacteria 555
256 Ga0436365_0818555 3300039437 Bacteria 639
257 Ga0436363_0876345 3300039450 Unclassified 792
258 Ga0451804_1069828 3300041463 Unclassified 853
259 Ga0451835_0703610 3300041492 Unclassified 959
260 Ga0451853_3556386 3300041512 Unclassified 581
261 Ga0439451_009889 3300042009 Unclassified 1925
262 Ga0439454_009764 3300042011 Bacteria 1252
263 Ga0439460_0085468 3300042461 Bacteria 996
264 Ga0439440_0166802 3300042993 Bacteria 638
265 Ga0495651_0030885 3300046462 Unclassified 4178
266 Ga0495653_0494632 3300046463 Unclassified 763
267 Ga0495580_0545952 3300046472 Unclassified 770
268 Ga0495664_0166897 3300046477 Unclassified 1336
269 Ga0495664_0183110 3300046477 Bacteria 1270
270 Ga0495608_0151884 3300046511 Bacteria 1476
271 Ga0495630_0903200 3300046517 Bacteria 673
272 Ga0495645_0744089 3300046543 Unclassified 592
273 Ga0495625_0103272 3300046660 Bacteria 1955
274 Ga0495599_0365890 3300046678 Bacteria 863
275 Ga0495646_0221544 3300046680 Bacteria 1023
276 Ga0495647_0378942 3300046681 Unclassified 647
277 Ga0495669_0074930 3300046684 Bacteria 1548
278 Ga0495613_0270619 3300046689 Bacteria 1182
279 Ga0495675_0064453 3300047444 Bacteria 2318
280 Ga0495602_0268492 3300048088 Bacteria 1262
281 Ga0496104_0239360 3300048907 Bacteria 1727
282 Ga0496107_0538143 3300048910 Bacteria 866
283 Ga0496108_0065783 3300048911 Bacteria 3056
284 Ga0496109_0012103 3300048912 Bacteria 7437
285 Ga0496109_0948451 3300048912 Unclassified 798
286 Ga0496110_0049643 3300048913 Bacteria 3682
287 Ga0496110_1593263 3300048913 Unclassified 563
288 Ga0496111_0168569 3300048914 Unclassified 1627
289 Ga0496112_0330068 3300048915 Unclassified 1469
290 Ga0496112_0339061 3300048915 Bacteria 1447
291 Ga0496113_0027730 3300048916 Bacteria 4064
292 Ga0496115_0869028 3300048918 Unclassified 697
293 nmdc:mga05p37_166220_c1 3300050507 Bacteria 2692
294 nmdc:mga05p37_25875_c1 3300050507 Bacteria 7134
295 nmdc:mga05p37_514588_c1 3300050507 Bacteria 1370
296 nmdc:mga0n895_1421060_c1 3300050512 Unclassified 662
297 nmdc:mga0rr50_1324161_c1 3300050513 Unclassified 610
298 nmdc:mga08x19_228578_c1 3300050514 Unclassified 1280
299 nmdc:mga08x19_52717_c1 3300050514 Bacteria 1913
300 Ga0495601_0050053 3300053077 Bacteria 2635
301 Ga0163162_12621871
302 CNXas_1000040
303 JGI25404J52841_10007012
304 JGI25405J52794_10000232
305 JGI25405J52794_10006702
306 Ga0065703_1019140
307 Ga0065714_10141875
308 Ga0065704_10014697
309 Ga0065704_10065631
310 Ga0065704_10179016
311 Ga0065704_10829814
312 Ga0065712_10492543
313 Ga0065715_10001925
314 Ga0065715_10053314
315 Ga0065715_10213529
316 Ga0065707_10011050
317 Ga0070676_10001331
318 Ga0068869_100082553
319 Ga0070666_10121178
320 Ga0068868_100295118
321 Ga0070660_100073519
322 Ga0070689_100043390
323 Ga0070687_100006577
324 Ga0070687_100172139
325 Ga0070661_101110355
326 Ga0070668_100015646
327 Ga0070669_100001053
328 Ga0070675_100000362
329 Ga0070675_100088755
330 Ga0070675_100324155
331 Ga0070671_100828664
332 Ga0070671_101411587
333 Ga0070688_100149950
334 Ga0070667_100003731
335 Ga0070667_100929255
336 Ga0070703_10442695
337 Ga0070714_100048395
338 Ga0070714_100068702
339 Ga0070714_100608088
340 Ga0070713_100133531
341 Ga0070711_100337242
342 Ga0070711_100373138
343 Ga0070711_100668624
344 Ga0070711_101837757
345 Ga0070705_100202885
346 Ga0070705_101176063
347 Ga0070708_100008099
348 Ga0070708_100032144
349 Ga0070708_100042178
350 Ga0070708_100131703
351 Ga0070708_100753848
352 Ga0070708_100865090
353 Ga0070708_101561106
354 Ga0070663_100104523
355 Ga0070662_100000681
356 Ga0070706_100000012
357 Ga0070706_100004668
358 Ga0070706_100032903
359 Ga0070706_100125951
360 Ga0070706_100391893
361 Ga0070706_100584644
362 Ga0070707_100002266
363 Ga0070707_100036044
364 Ga0070707_100091508
365 Ga0070707_100125799
366 Ga0070707_100273976
367 Ga0070707_100290085
368 Ga0070698_100004688
369 Ga0070698_100014459
370 Ga0070698_100476639
371 Ga0070698_102118814
372 Ga0070699_100018337
373 Ga0070699_101369653
374 Ga0070699_101505196
375 Ga0070684_101408983
376 Ga0070697_100001381
377 Ga0070697_100068383
378 Ga0070697_100106476
379 Ga0070697_100290754
380 Ga0070697_100311260
381 Ga0070697_101769594
382 Ga0068853_100924083
383 Ga0070672_100981637
384 Ga0070672_101039230
385 Ga0070695_101544296
386 Ga0070693_100275382
387 Ga0070665_100241806
388 Ga0068854_101346098
389 Ga0070702_100334162
390 Ga0068852_100317802
391 Ga0068864_100780521
392 Ga0068864_100871992
393 Ga0068861_100030096
394 Ga0068861_102038197
395 Ga0068863_100863198
396 Ga0068858_100290453
397 Ga0068860_101663763
398 Ga0081455_10000382
399 Ga0081455_10007811
400 Ga0081455_10018715
401 Ga0081455_10019089
402 Ga0081455_10041711
403 Ga0081455_10226446
404 Ga0081455_10309211
405 Ga0081540_1000018
406 Ga0081540_1020633
407 Ga0081539_10002356
408 Ga0070717_10011260
409 Ga0070717_10184464
410 Ga0070717_10218954
411 Ga0070717_10418738
412 Ga0070717_10775755
413 Ga0070717_11828782
414 Ga0070715_10278214
415 Ga0070716_100294581
416 Ga0070716_100484363
417 Ga0070712_100031812
418 Ga0070712_100246277
419 Ga0070712_100390334
420 Ga0070712_100791489
421 Ga0075428_100569959
422 Ga0075433_10376775
423 Ga0075434_102528668
424 Ga0068865_100150656
425 Ga0075436_100160649
426 Ga0075436_100225877
427 Ga0075435_100262091
428 Ga0075435_101449530
429 Ga0099794_10411556
430 Ga0111539_10202291
431 Ga0105245_10015213
432 Ga0105245_11053182
433 Ga0105247_10079832
434 Ga0114129_10111304
435 Ga0114129_10185661
436 Ga0105243_10051420
437 Ga0105248_11771363
438 Ga0105237_10145145
439 Ga0105249_10020979
440 Ga0105249_10460415
441 Ga0105239_10971009
442 Ga0157374_10028056
443 Ga0157374_10074366
444 Ga0157374_10574808
445 Ga0157378_10007272
446 Ga0157378_10030172
447 Ga0157378_10200571
448 Ga0163162_10001659
449 Ga0157372_10133644
450 Ga0157375_10049946
451 Ga0157375_10073862
452 Ga0157375_10196638
453 Ga0163163_10112170
454 Ga0157377_10430375
455 Ga0157379_10425563
456 Ga0157379_10622597
457 Ga0157376_10027063
458 Ga0163161_10963946
459 Ga0207673_1002715
460 Ga0207697_10000084
461 Ga0207697_10222650
462 Ga0207692_10190588
463 Ga0207710_10034848
464 Ga0207647_10178501
465 Ga0207699_10532717
466 Ga0207645_10000107
467 Ga0207684_10000028
468 Ga0207684_10006256
469 Ga0207684_10007366
470 Ga0207684_10010301
471 Ga0207684_10124908
472 Ga0207684_10506210
473 Ga0207671_11210286
474 Ga0207693_10009752
475 Ga0207693_10019750
476 Ga0207693_10040651
477 Ga0207693_10051312
478 Ga0207693_10236451
479 Ga0207693_10383827
480 Ga0207663_10818894
481 Ga0207662_10000513
482 Ga0207662_10072266
483 Ga0207657_10312941
484 Ga0207649_10620006
485 Ga0207646_10003807
486 Ga0207646_10009246
487 Ga0207646_10060112
488 Ga0207646_10747113
489 Ga0207650_10457640
490 Ga0207659_10005324
491 Ga0207659_10165367
492 Ga0207659_10387763
493 Ga0207687_10806595
494 Ga0207664_10032438
495 Ga0207664_10591207
496 Ga0207706_10000823
497 Ga0207686_10074604
498 Ga0207709_10281150
499 Ga0207670_10087029
500 Ga0207665_10213896
501 Ga0207665_10449283
502 Ga0207665_10526675
503 Ga0207691_10083221
504 Ga0207691_10431938
505 Ga0207689_10030764
506 Ga0207689_10389490
507 Ga0207712_10009860
508 Ga0207668_10015248
509 Ga0207658_10017608
510 Ga0207639_10366923
511 Ga0207678_10006881
512 Ga0207708_10592160
513 Ga0207676_11004030
514 Ga0207675_100171498
515 Ga0207698_10481960
516 Ga0210002_1012500
517 Ga0209998_10029020
518 Ga0209974_10026597
519 Ga0268266_10040134
520 Ga0268266_10290922
521 Ga0268265_10226943
522 Ga0268264_11103489
523 Ga0307513_10007605
524 Ga0307513_10030234
525 Ga0316579_10006967
526 Ga0316576_10007878
527 Ga0316576_10485881
528 Ga0316578_10000004
529 Ga0316577_10093147
530 Ga0316577_10357109
531 Ga0316580_10013254
532 Ga0373955_0018448
533 Ga0316574_0046295
534 Ga0316574_0168054
535 Ga0373947_0046737
536 Ga0373947_0200051
537 Ga0373947_0499882
538 Ga0373937_0444171
539 Ga0316582_0030121
540 Ga0316584_0000213
541 Ga0316584_0174047
542 Ga0373925_0805245
543 Ga0395899_0339053
544 Ga0395900_0006499
545 Ga0395900_0159682
546 Ga0395900_0447873
547 Ga0395898_0005809
548 Ga0395898_0462300
549 Ga0395898_0896739
550 Ga0395905_0053313
551 Ga0395905_0610424
552 Ga0395901_0001494
553 Ga0395901_0655917
554 Ga0395901_0855090
555 Ga0395901_1832334
556 Ga0436365_0818555
557 Ga0436363_0876345
558 Ga0451804_1069828
559 Ga0451835_0703610
560 Ga0451853_3556386
561 Ga0439451_009889
562 Ga0439454_009764
563 Ga0439460_0085468
564 Ga0439440_0166802
565 Ga0495651_0030885
566 Ga0495653_0494632
567 Ga0495580_0545952
568 Ga0495664_0166897
569 Ga0495664_0183110
570 Ga0495608_0151884
571 Ga0495630_0903200
572 Ga0495645_0744089
573 Ga0495625_0103272
574 Ga0495599_0365890
575 Ga0495646_0221544
576 Ga0495647_0378942
577 Ga0495669_0074930
578 Ga0495613_0270619
579 Ga0495675_0064453
580 Ga0495602_0268492
581 Ga0496104_0239360
582 Ga0496107_0538143
583 Ga0496108_0065783
584 Ga0496109_0012103
585 Ga0496109_0948451
586 Ga0496110_0049643
587 Ga0496110_1593263
588 Ga0496111_0168569
589 Ga0496112_0330068
590 Ga0496112_0339061
591 Ga0496113_0027730
592 Ga0496115_0869028
593 nmdc:mga05p37_166220_c1
594 nmdc:mga05p37_25875_c1
595 nmdc:mga05p37_514588_c1
596 nmdc:mga0n895_1421060_c1
597 nmdc:mga0rr50_1324161_c1
598 nmdc:mga08x19_228578_c1
599 nmdc:mga08x19_52717_c1
600 Ga0495601_0050053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04241

DUF423

Protein of unknown function (DUF423)

34

116

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f68-assembly1.cif.gz_A e. coli cytochrome bo3 ubiquinol oxidase monomer 0.746 39 113
8f68-assembly1.cif.gz_A e. coli cytochrome bo3 ubiquinol oxidase monomer 0.4991 39 113
6wm4-assembly1.cif.gz_2 human v-atpase in state 3 with sidk and adp 0.4772 2 113
7u8p-assembly1.cif.gz_k structure of porcine kidney v-atpase with sidk, rotary state 1 0.4715 2 113
6wm4-assembly1.cif.gz_2 human v-atpase in state 3 with sidk and adp 0.4564 2 113
ID Description Score Start End Superfamily
af_F1LYI7_22_101_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8269 36 100 1.20.120.550
af_Q9U2Z9_62_144_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8054 20 100 1.20.120.550
af_Q9VDT4_85_169_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7997 20 100 1.20.120.550
af_Q9U2Z9_62_144_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7796 20 100 1.20.120.550
af_Q9VDT4_85_169_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.758 20 100 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A2V6CXT4-F1-model_v4 DUF423 domain-containing protein 0.9819 38 115 GO:0005886
AF-A0A645D533-F1-model_v4 DUF423 domain-containing protein 0.9775 1 116 GO:0005886
AF-A0A2V5UFL2-F1-model_v4 DUF423 domain-containing protein 0.9743 4 92 GO:0005886
AF-A0A7W1U5T9-F1-model_v4 DUF423 domain-containing protein 0.9737 4 117 GO:0005886
AF-A0A2V6E6B2-F1-model_v4 DUF423 domain-containing protein 0.9664 16 118 GO:0005886

Map