F395365

General Info

Members Datasets Scaffolds Average Seq Length
300 152 296 251

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10522575|Ga0163162_105225752
Length 294
Sequence MNAGVRISPRCIAIVPVRAAPSVAAMVKAKRVTEALLAGANPGGYIRTVISPFAYPVMTGVAVVSGFVDSIAGMMPALFFAGAAPLQALGTNKLQSVFGTGVALRNYWRSGLVEWRPNRLTVALVFVGAVAGALVVQLVQTRLLALIIPVLLVASALYILFSPRMSDEDAHHRVTPKGYAPIGSAIGFYDGFFGPGTGTFFSTSLVALRGFGLTKATALTKLFNFSSNVASVLLFAFGGHMLWLLGLCMAVGAMAGGWLGSHSALKFGARLIRPLLVTISLALTAKLLWSYFAG

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
3 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
4 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
112 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
115 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
147 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
148 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
151 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
152 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.67
Nodule 0
Rhizoplane 5.33
Rhizosphere 89.33
Stem 0
Stem Tuber 0.33
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1011815 3300001976 Bacteria 1142
2 JGI24749J21850_1000174 3300002076 Bacteria 10184
3 JGI24751J29686_10000407 3300002459 Bacteria 13729
4 Ga0065712_10074716 3300005290 Bacteria 4027
5 Ga0065715_10246626 3300005293 Bacteria 1181
6 Ga0065707_10119299 3300005295 Bacteria 2163
7 Ga0070658_10094443 3300005327 Bacteria 2467
8 Ga0070658_10309208 3300005327 Bacteria 1348
9 Ga0070658_10505575 3300005327 Bacteria 1044
10 Ga0070676_10258986 3300005328 Bacteria 1164
11 Ga0070670_100000178 3300005331 Bacteria 57676
12 Ga0070670_100048516 3300005331 Bacteria 3654
13 Ga0070677_10041899 3300005333 Bacteria 1810
14 Ga0070666_10138425 3300005335 Bacteria 1695
15 Ga0070660_100259556 3300005339 Bacteria 1418
16 Ga0070668_100105208 3300005347 Bacteria 2241
17 Ga0070668_100147180 3300005347 Bacteria 1902
18 Ga0070669_100000119 3300005353 Bacteria 73001
19 Ga0070671_100021593 3300005355 Bacteria 5258
20 Ga0070659_100018890 3300005366 Bacteria 5207
21 Ga0070659_100082056 3300005366 Bacteria 2576
22 Ga0070659_100129529 3300005366 Bacteria 2048
23 Ga0070659_100248163 3300005366 Bacteria 1475
24 Ga0070659_100700524 3300005366 Bacteria 876
25 Ga0070667_100000407 3300005367 Bacteria 46001
26 Ga0070667_100003547 3300005367 Bacteria 13297
27 Ga0070667_100011149 3300005367 Bacteria 7434
28 Ga0070663_100388518 3300005455 Unclassified 1138
29 Ga0070663_100428363 3300005455 Bacteria 1086
30 Ga0070663_100439983 3300005455 Bacteria 1073
31 Ga0070662_100118198 3300005457 Bacteria 2029
32 Ga0070662_100553602 3300005457 Bacteria 964
33 Ga0068867_100076513 3300005459 Bacteria 2513
34 Ga0068853_100000256 3300005539 Bacteria 37353
35 Ga0068853_100382831 3300005539 Bacteria 1314
36 Ga0070665_100006682 3300005548 Bacteria 11728
37 Ga0068855_100311462 3300005563 Bacteria 1741
38 Ga0070664_100102657 3300005564 Bacteria 2488
39 Ga0070664_100144683 3300005564 Bacteria 2096
40 Ga0070664_100314517 3300005564 Bacteria 1418
41 Ga0070664_100371067 3300005564 Bacteria 1304
42 Ga0070664_100435059 3300005564 Bacteria 1203
43 Ga0068857_100018142 3300005577 Bacteria 6172
44 Ga0068857_100026691 3300005577 Bacteria 5091
45 Ga0068854_100001958 3300005578 Bacteria 12586
46 Ga0068854_100057595 3300005578 Bacteria 2803
47 Ga0068854_100478001 3300005578 Bacteria 1046
48 Ga0068856_100019423 3300005614 Bacteria 6595
49 Ga0068856_100232843 3300005614 Bacteria 1857
50 Ga0068852_100018142 3300005616 Bacteria 5539
51 Ga0068852_100095507 3300005616 Bacteria 2670
52 Ga0068859_100004554 3300005617 Bacteria 14138
53 Ga0068859_100097135 3300005617 Bacteria 2999
54 Ga0068859_100277994 3300005617 Bacteria 1767
55 Ga0068864_100000183 3300005618 Bacteria 57684
56 Ga0068864_100107181 3300005618 Bacteria 2485
57 Ga0068861_100026368 3300005719 Bacteria 4224
58 Ga0068861_100256250 3300005719 Bacteria 1496
59 Ga0068851_10060927 3300005834 Bacteria 1933
60 Ga0068863_100004752 3300005841 Bacteria 13382
61 Ga0068863_100067693 3300005841 Bacteria 3378
62 Ga0068858_100008058 3300005842 Bacteria 10148
63 Ga0068860_100419621 3300005843 Bacteria 1326
64 Ga0068862_100000011 3300005844 Bacteria 270105
65 Ga0068862_100165943 3300005844 Bacteria 1974
66 Ga0068862_100329127 3300005844 Bacteria 1412
67 Ga0097621_100216705 3300006237 Bacteria 1667
68 Ga0097621_100310054 3300006237 Bacteria 1396
69 Ga0068871_100103745 3300006358 Bacteria 2384
70 Ga0068871_100181702 3300006358 Bacteria 1808
71 Ga0068865_100155838 3300006881 Bacteria 1737
72 Ga0097620_100004554 3300006931 Bacteria 14138
73 Ga0097620_100097132 3300006931 Bacteria 2999
74 Ga0097620_100277972 3300006931 Bacteria 1767
75 Ga0105240_10030389 3300009093 Bacteria 7021
76 Ga0105243_10305194 3300009148 Bacteria 1444
77 Ga0105248_10000998 3300009177 Bacteria 31278
78 Ga0105248_10009537 3300009177 Bacteria 10682
79 Ga0105248_10200070 3300009177 Bacteria 2251
80 Ga0105237_10027692 3300009545 Bacteria 5779
81 Ga0105249_10077424 3300009553 Bacteria 3084
82 Ga0157373_10013050 3300013100 Bacteria 6097
83 Ga0157373_10030300 3300013100 Bacteria 3893
84 Ga0157373_10224480 3300013100 Bacteria 1326
85 Ga0157370_10465426 3300013104 Bacteria 1162
86 Ga0157369_10004559 3300013105 Bacteria 16291
87 Ga0157369_10013693 3300013105 Bacteria 9169
88 Ga0163162_10522575 3300013306 Bacteria 1316
89 Ga0157375_10006174 3300013308 Bacteria 10442
90 Ga0163163_10026070 3300014325 Bacteria 5582
91 Ga0163163_10300684 3300014325 Bacteria 1657
92 Ga0157380_10000087 3300014326 Bacteria 50956
93 Ga0157379_10002519 3300014968 Bacteria 15338
94 Ga0163161_10012814 3300017792 Bacteria 5825
95 Ga0209147_101202 3300025229 Bacteria 10415
96 Ga0209257_1023570 3300025304 Bacteria 2159
97 Ga0207656_10205606 3300025321 Bacteria 952
98 Ga0207680_10026049 3300025903 Bacteria 3235
99 Ga0207647_10052552 3300025904 Bacteria 2515
100 Ga0207645_10100868 3300025907 Bacteria 1862
101 Ga0207705_10083907 3300025909 Bacteria 2325
102 Ga0207705_10269340 3300025909 Bacteria 1302
103 Ga0207695_10003916 3300025913 Bacteria 20603
104 Ga0207660_10060769 3300025917 Bacteria 2718
105 Ga0207657_10213049 3300025919 Bacteria 1550
106 Ga0207681_10000001 3300025923 Bacteria 1105841
107 Ga0207650_10000050 3300025925 Bacteria 169589
108 Ga0207650_10095001 3300025925 Bacteria 2285
109 Ga0207644_10194660 3300025931 Bacteria 1596
110 Ga0207690_10153111 3300025932 Bacteria 1711
111 Ga0207690_10249744 3300025932 Bacteria 1370
112 Ga0207706_10009419 3300025933 Bacteria 8966
113 Ga0207706_10052246 3300025933 Bacteria 3608
114 Ga0207706_10316015 3300025933 Bacteria 1360
115 Ga0207706_10429640 3300025933 Bacteria 1144
116 Ga0207704_10192864 3300025938 Bacteria 1484
117 Ga0207711_10000662 3300025941 Bacteria 34294
118 Ga0207711_10012153 3300025941 Bacteria 7158
119 Ga0207679_10036247 3300025945 Bacteria 3496
120 Ga0207667_10149498 3300025949 Bacteria 2404
121 Ga0207667_10673835 3300025949 Bacteria 1038
122 Ga0207668_10145103 3300025972 Bacteria 1830
123 Ga0207668_10190704 3300025972 Bacteria 1624
124 Ga0207640_10006808 3300025981 Bacteria 6286
125 Ga0207658_10002571 3300025986 Bacteria 13185
126 Ga0207658_10002819 3300025986 Bacteria 12480
127 Ga0207658_10069179 3300025986 Bacteria 2667
128 Ga0207703_10291068 3300026035 Bacteria 1486
129 Ga0207639_10224021 3300026041 Bacteria 1626
130 Ga0207639_10405062 3300026041 Bacteria 1230
131 Ga0207678_10192328 3300026067 Bacteria 1744
132 Ga0207678_10241618 3300026067 Bacteria 1546
133 Ga0207678_10262850 3300026067 Bacteria 1479
134 Ga0207678_10307407 3300026067 Bacteria 1363
135 Ga0207702_10007017 3300026078 Bacteria 9635
136 Ga0207702_10460330 3300026078 Bacteria 1235
137 Ga0207641_10008329 3300026088 Bacteria 8570
138 Ga0207641_10013669 3300026088 Bacteria 6660
139 Ga0207648_10178065 3300026089 Bacteria 1881
140 Ga0207676_10000004 3300026095 Bacteria 725417
141 Ga0207676_10007277 3300026095 Bacteria 7843
142 Ga0207674_10000344 3300026116 Bacteria 59855
143 Ga0207674_10015947 3300026116 Bacteria 8232
144 Ga0207674_10175536 3300026116 Bacteria 2095
145 Ga0207674_10343258 3300026116 Bacteria 1444
146 Ga0207675_100001128 3300026118 Bacteria 26498
147 Ga0207675_100197149 3300026118 Bacteria 1933
148 Ga0207698_10235000 3300026142 Bacteria 1666
149 Ga0268266_10066641 3300028379 Bacteria 3114
150 Ga0268266_10222774 3300028379 Bacteria 1735
151 Ga0268265_10000002 3300028380 Bacteria 1035381
152 Ga0268265_10224201 3300028380 Bacteria 1647
153 Ga0268265_10314786 3300028380 Bacteria 1415
154 Ga0268264_10174351 3300028381 Bacteria 1948
155 Ga0268264_10344882 3300028381 Bacteria 1416
156 Ga0307408_100018443 3300031548 Bacteria 4684
157 Ga0307408_100041171 3300031548 Bacteria 3274
158 Ga0307408_100086600 3300031548 Bacteria 2355
159 Ga0307408_100245919 3300031548 Bacteria 1473
160 Ga0307408_100366522 3300031548 Bacteria 1227
161 Ga0307405_10010855 3300031731 Bacteria 4744
162 Ga0307405_10015885 3300031731 Bacteria 4090
163 Ga0307405_10071840 3300031731 Bacteria 2228
164 Ga0307405_10089357 3300031731 Bacteria 2035
165 Ga0307405_10143723 3300031731 Bacteria 1667
166 Ga0307405_10243956 3300031731 Bacteria 1332
167 Ga0307405_10287906 3300031731 Bacteria 1240
168 Ga0307413_10011815 3300031824 Bacteria 4314
169 Ga0307413_10019215 3300031824 Bacteria 3605
170 Ga0307413_10049492 3300031824 Bacteria 2519
171 Ga0307413_10049873 3300031824 Bacteria 2511
172 Ga0307413_10084996 3300031824 Bacteria 2041
173 Ga0307413_10104401 3300031824 Bacteria 1881
174 Ga0307413_10204889 3300031824 Bacteria 1427
175 Ga0307413_10225655 3300031824 Bacteria 1371
176 Ga0307410_10000437 3300031852 Bacteria 16691
177 Ga0307410_10002245 3300031852 Bacteria 9229
178 Ga0307410_10018602 3300031852 Bacteria 4202
179 Ga0307410_10020245 3300031852 Bacteria 4065
180 Ga0307410_10054988 3300031852 Bacteria 2700
181 Ga0307410_10120075 3300031852 Bacteria 1916
182 Ga0307410_10261591 3300031852 Bacteria 1349
183 Ga0307410_10373307 3300031852 Bacteria 1145
184 Ga0307406_10067694 3300031901 Bacteria 2329
185 Ga0307406_10189145 3300031901 Bacteria 1505
186 Ga0307407_10012018 3300031903 Bacteria 4147
187 Ga0307407_10028272 3300031903 Bacteria 2996
188 Ga0307407_10029650 3300031903 Bacteria 2942
189 Ga0307407_10140292 3300031903 Bacteria 1558
190 Ga0307407_10143031 3300031903 Bacteria 1545
191 Ga0307407_10163881 3300031903 Bacteria 1457
192 Ga0307407_10404195 3300031903 Bacteria 980
193 Ga0307412_10001106 3300031911 Bacteria 15449
194 Ga0307412_10018501 3300031911 Bacteria 4194
195 Ga0307412_10040412 3300031911 Bacteria 3017
196 Ga0307412_10050961 3300031911 Bacteria 2734
197 Ga0307412_10063893 3300031911 Bacteria 2485
198 Ga0307412_10114275 3300031911 Bacteria 1933
199 Ga0307412_10251421 3300031911 Bacteria 1372
200 Ga0307409_100015346 3300031995 Bacteria 5025
201 Ga0307409_100055120 3300031995 Bacteria 3067
202 Ga0307409_100063979 3300031995 Bacteria 2887
203 Ga0307409_100095690 3300031995 Bacteria 2447
204 Ga0307409_100109364 3300031995 Bacteria 2314
205 Ga0307409_100582048 3300031995 Bacteria 1103
206 Ga0307409_101072994 3300031995 Bacteria 826
207 Ga0307416_100010650 3300032002 Bacteria 6088
208 Ga0307416_100030732 3300032002 Bacteria 4034
209 Ga0307416_100099552 3300032002 Bacteria 2525
210 Ga0307416_100347621 3300032002 Bacteria 1499
211 Ga0307416_100902880 3300032002 Bacteria 983
212 Ga0307414_10001211 3300032004 Bacteria 13294
213 Ga0307414_10002592 3300032004 Bacteria 9512
214 Ga0307414_10032445 3300032004 Bacteria 3438
215 Ga0307414_10063949 3300032004 Bacteria 2617
216 Ga0307414_10162999 3300032004 Bacteria 1773
217 Ga0307414_10206928 3300032004 Bacteria 1601
218 Ga0307414_10278865 3300032004 Bacteria 1403
219 Ga0307414_10330877 3300032004 Bacteria 1300
220 Ga0307411_10005121 3300032005 Bacteria 6400
221 Ga0307411_10011401 3300032005 Bacteria 4797
222 Ga0307411_10028131 3300032005 Bacteria 3413
223 Ga0307411_10040932 3300032005 Bacteria 2943
224 Ga0307411_10067242 3300032005 Bacteria 2411
225 Ga0307411_10083066 3300032005 Bacteria 2211
226 Ga0307411_10209942 3300032005 Bacteria 1502
227 Ga0307411_10244259 3300032005 Bacteria 1407
228 Ga0307411_10453387 3300032005 Bacteria 1073
229 Ga0307411_10487561 3300032005 Bacteria 1039
230 Ga0307411_10565276 3300032005 Bacteria 972
231 Ga0307415_100011669 3300032126 Bacteria 5041
232 Ga0307415_100013186 3300032126 Bacteria 4816
233 Ga0307415_100039067 3300032126 Bacteria 3133
234 Ga0307415_100049466 3300032126 Bacteria 2843
235 Ga0307415_100161638 3300032126 Bacteria 1736
236 Ga0307415_100614121 3300032126 Bacteria 969
237 Ga0307415_100784808 3300032126 Bacteria 868
238 Ga0395899_0080132 3300037312 Bacteria 2377
239 Ga0395900_0060757 3300037418 Bacteria 3888
240 Ga0395898_0048231 3300037466 Bacteria 4178
241 Ga0395905_0000259 3300037471 Bacteria 79396
242 Ga0395905_0021418 3300037471 Bacteria 6114
243 Ga0395905_0307074 3300037471 Bacteria 1475
244 Ga0395901_0144063 3300038443 Bacteria 2505
245 Ga0439437_001354 3300042000 Bacteria 2576
246 Ga0439432_046889 3300042006 Bacteria 1356
247 Ga0439449_0077673 3300042007 Bacteria 1224
248 Ga0439462_0039731 3300042015 Bacteria 1255
249 Ga0450912_000518 3300042116 Bacteria 1947
250 Ga0466965_0086748 3300044683 Bacteria 1588
251 Ga0466967_0467585 3300045976 Bacteria 1234
252 Ga0495627_000124 3300046453 Bacteria 93651
253 Ga0495650_0000647 3300046471 Bacteria 45905
254 Ga0495610_0000022 3300046512 Bacteria 317107
255 Ga0495620_0044133 3300046515 Bacteria 1938
256 Ga0495631_0114600 3300046518 Bacteria 1159
257 Ga0495632_0001275 3300046519 Bacteria 21330
258 Ga0495654_0049394 3300046530 Bacteria 2061
259 Ga0495668_0006675 3300046616 Bacteria 7512
260 Ga0495625_0041342 3300046660 Bacteria 3356
261 Ga0495669_0000306 3300046684 Bacteria 27112
262 Ga0495669_0001174 3300046684 Bacteria 10882
263 Ga0495669_0007410 3300046684 Bacteria 4601
264 Ga0495669_0078435 3300046684 Bacteria 1513
265 Ga0495673_0038257 3300047469 Bacteria 2184
266 Ga0495681_0000187 3300047470 Bacteria 52995
267 Ga0496102_0303664 3300048905 Bacteria 1504
268 Ga0496103_0135190 3300048906 Bacteria 1575
269 Ga0496107_0032870 3300048910 Bacteria 3709
270 Ga0496107_0039564 3300048910 Bacteria 3383
271 Ga0496107_0074795 3300048910 Bacteria 2465
272 Ga0496108_0109887 3300048911 Bacteria 2357
273 Ga0496108_0121181 3300048911 Bacteria 2243
274 Ga0496109_0020963 3300048912 Bacteria 5776
275 Ga0496109_0111869 3300048912 Bacteria 2539
276 Ga0496109_0892787 3300048912 Bacteria 827
277 Ga0496110_0144090 3300048913 Bacteria 2154
278 Ga0496110_0214962 3300048913 Bacteria 1748
279 Ga0496110_0422376 3300048913 Bacteria 1215
280 Ga0496111_0003669 3300048914 Bacteria 9535
281 Ga0496112_0002414 3300048915 Bacteria 15049
282 Ga0496114_0010963 3300048917 Bacteria 7227
283 Ga0496122_0000083 3300048925 Bacteria 208744
284 Ga0496123_0000097 3300048926 Bacteria 173894
285 Ga0496125_0127995 3300048928 Bacteria 1795
286 Ga0501223_006563 3300049663 Bacteria 2402
287 Ga0501257_000073 3300049686 Bacteria 25203
288 Ga0500643_084813 3300053087 Bacteria 867
289 Ga0500644_0050278 3300053088 Bacteria 1426
290 Ga0500556_0000088 3300053104 Bacteria 86055
291 Ga0500608_003015 3300053122 Bacteria 6230
292 Ga0500642_0000001 3300053130 Bacteria 1468402
293 Ga0500568_0092618 3300053139 Bacteria 1139
294 Ga0500624_000173 3300053157 Bacteria 25864
295 Ga0500636_0007644 3300053177 Bacteria 6252
296 Ga0500645_006168 3300053730 Bacteria 4308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053139 Ga0500568_0092618 Ga0500568_0092618_18_686 204
2 3300046453 Ga0495627_000124 Ga0495627_000124_42229_43005 231
3 3300046471 Ga0495650_0000647 Ga0495650_0000647_4906_5682 231
4 3300046512 Ga0495610_0000022 Ga0495610_0000022_266198_266974 231
5 3300046515 Ga0495620_0044133 Ga0495620_0044133_571_1347 231
6 3300046518 Ga0495631_0114600 Ga0495631_0114600_231_1007 231
7 3300046519 Ga0495632_0001275 Ga0495632_0001275_17415_18191 231
8 3300046530 Ga0495654_0049394 Ga0495654_0049394_1194_1970 231
9 3300047470 Ga0495681_0000187 Ga0495681_0000187_42198_42974 231
10 3300031548 Ga0307408_100245919 Ga0307408_1002459192 235
11 3300053730 Ga0500645_006168 Ga0500645_006168_3174_3935 235
12 3300025229 Ga0209147_101202 Ga0209147_10120212 237
13 3300047469 Ga0495673_0038257 Ga0495673_0038257_24_803 237
14 3300048912 Ga0496109_0892787 Ga0496109_0892787_22_750 237
15 3300005331 Ga0070670_100048516 Ga0070670_1000485163 242
16 3300005564 Ga0070664_100144683 Ga0070664_1001446832 242
17 3300025925 Ga0207650_10095001 Ga0207650_100950012 242
18 3300048925 Ga0496122_0000083 Ga0496122_0000083_147097_147828 243
19 3300048926 Ga0496123_0000097 Ga0496123_0000097_61290_62021 243
20 3300005617 Ga0068859_100277994 Ga0068859_1002779942 244
21 3300006931 Ga0097620_100277972 Ga0097620_1002779722 244
22 3300031911 Ga0307412_10001106 Ga0307412_100011065 245
23 3300032004 Ga0307414_10206928 Ga0307414_102069282 245
24 iso_pu_bacteria 2882806704 2882808689 245
25 3300005367 Ga0070667_100003547 Ga0070667_10000354710 246
26 3300009177 Ga0105248_10009537 Ga0105248_100095377 246
27 3300013306 Ga0163162_10522575 Ga0163162_105225752 246
28 3300025941 Ga0207711_10012153 Ga0207711_100121535 246
29 3300025986 Ga0207658_10002571 Ga0207658_100025716 246
30 3300028381 Ga0268264_10344882 Ga0268264_103448821 246
31 3300037418 Ga0395900_0060757 Ga0395900_0060757_2219_2974 246
32 3300037471 Ga0395905_0000259 Ga0395905_0000259_33657_34412 246
33 3300046616 Ga0495668_0006675 Ga0495668_0006675_1878_2633 246
34 3300046684 Ga0495669_0001174 Ga0495669_0001174_2115_2870 246
35 3300048913 Ga0496110_0214962 Ga0496110_0214962_849_1673 246
36 3300053088 Ga0500644_0050278 Ga0500644_0050278_647_1387 246
37 3300053122 Ga0500608_003015 Ga0500608_003015_4620_5381 246
38 iso_pu_bacteria 2885427238 2885428655 246
39 iso_pu_bacteria 2896429255 2896429869 246
40 3300049663 Ga0501223_006563 Ga0501223_006563_1429_2202 249
41 3300049686 Ga0501257_000073 Ga0501257_000073_6389_7162 249
42 3300053087 Ga0500643_084813 Ga0500643_084813_16_789 249
43 3300002076 JGI24749J21850_1000174 JGI24749J21850_10001742 250
44 3300002459 JGI24751J29686_10000407 JGI24751J29686_1000040711 250
45 3300005295 Ga0065707_10119299 Ga0065707_101192994 250
46 3300005331 Ga0070670_100000178 Ga0070670_10000017816 250
47 3300005347 Ga0070668_100147180 Ga0070668_1001471802 250
48 3300005353 Ga0070669_100000119 Ga0070669_10000011932 250
49 3300005367 Ga0070667_100000407 Ga0070667_10000040723 250
50 3300005578 Ga0068854_100001958 Ga0068854_1000019587 250
51 3300005617 Ga0068859_100004554 Ga0068859_10000455410 250
52 3300005618 Ga0068864_100000183 Ga0068864_10000018316 250
53 3300005719 Ga0068861_100026368 Ga0068861_1000263683 250
54 3300005841 Ga0068863_100067693 Ga0068863_1000676934 250
55 3300005844 Ga0068862_100000011 Ga0068862_100000011250 250
56 3300006931 Ga0097620_100004554 Ga0097620_1000045548 250
57 3300009093 Ga0105240_10030389 Ga0105240_100303893 250
58 3300009177 Ga0105248_10000998 Ga0105248_100009988 250
59 3300013105 Ga0157369_10004559 Ga0157369_100045596 250
60 3300013105 Ga0157369_10013693 Ga0157369_100136936 250
61 3300014325 Ga0163163_10026070 Ga0163163_100260703 250
62 3300014326 Ga0157380_10000087 Ga0157380_100000878 250
63 3300025904 Ga0207647_10052552 Ga0207647_100525522 250
64 3300025913 Ga0207695_10003916 Ga0207695_100039163 250
65 3300025923 Ga0207681_10000001 Ga0207681_10000001673 250
66 3300025925 Ga0207650_10000050 Ga0207650_1000005016 250
67 3300025941 Ga0207711_10000662 Ga0207711_1000066234 250
68 3300025972 Ga0207668_10145103 Ga0207668_101451032 250
69 3300025981 Ga0207640_10006808 Ga0207640_100068086 250
70 3300025986 Ga0207658_10002819 Ga0207658_100028195 250
71 3300026088 Ga0207641_10013669 Ga0207641_100136697 250
72 3300026095 Ga0207676_10000004 Ga0207676_10000004379 250
73 3300026118 Ga0207675_100001128 Ga0207675_10000112818 250
74 3300028380 Ga0268265_10000002 Ga0268265_10000002690 250
75 3300031731 Ga0307405_10089357 Ga0307405_100893571 250
76 3300031731 Ga0307405_10287906 Ga0307405_102879062 250
77 3300031995 Ga0307409_100109364 Ga0307409_1001093643 250
78 3300032002 Ga0307416_100030732 Ga0307416_1000307323 250
79 3300045976 Ga0466967_0467585 Ga0466967_0467585_265_1017 250
80 3300001976 JGI24752J21851_1011815 JGI24752J21851_10118152 251
81 3300005290 Ga0065712_10074716 Ga0065712_100747163 251
82 3300005293 Ga0065715_10246626 Ga0065715_102466262 251
83 3300005327 Ga0070658_10094443 Ga0070658_100944432 251
84 3300005327 Ga0070658_10309208 Ga0070658_103092082 251
85 3300005327 Ga0070658_10505575 Ga0070658_105055751 251
86 3300005328 Ga0070676_10258986 Ga0070676_102589862 251
87 3300005333 Ga0070677_10041899 Ga0070677_100418992 251
88 3300005335 Ga0070666_10138425 Ga0070666_101384252 251
89 3300005339 Ga0070660_100259556 Ga0070660_1002595562 251
90 3300005347 Ga0070668_100105208 Ga0070668_1001052084 251
91 3300005355 Ga0070671_100021593 Ga0070671_1000215933 251
92 3300005366 Ga0070659_100018890 Ga0070659_1000188904 251
93 3300005366 Ga0070659_100082056 Ga0070659_1000820562 251
94 3300005366 Ga0070659_100129529 Ga0070659_1001295292 251
95 3300005366 Ga0070659_100248163 Ga0070659_1002481632 251
96 3300005366 Ga0070659_100700524 Ga0070659_1007005241 251
97 3300005367 Ga0070667_100011149 Ga0070667_1000111494 251
98 3300005455 Ga0070663_100388518 Ga0070663_1003885182 251
99 3300005455 Ga0070663_100428363 Ga0070663_1004283631 251
100 3300005455 Ga0070663_100439983 Ga0070663_1004399832 251
101 3300005457 Ga0070662_100118198 Ga0070662_1001181983 251
102 3300005457 Ga0070662_100553602 Ga0070662_1005536021 251
103 3300005459 Ga0068867_100076513 Ga0068867_1000765134 251
104 3300005539 Ga0068853_100000256 Ga0068853_1000002566 251
105 3300005539 Ga0068853_100382831 Ga0068853_1003828312 251
106 3300005548 Ga0070665_100006682 Ga0070665_10000668211 251
107 3300005563 Ga0068855_100311462 Ga0068855_1003114623 251
108 3300005564 Ga0070664_100102657 Ga0070664_1001026573 251
109 3300005564 Ga0070664_100314517 Ga0070664_1003145173 251
110 3300005564 Ga0070664_100371067 Ga0070664_1003710671 251
111 3300005564 Ga0070664_100435059 Ga0070664_1004350591 251
112 3300005577 Ga0068857_100018142 Ga0068857_1000181423 251
113 3300005577 Ga0068857_100026691 Ga0068857_1000266911 251
114 3300005578 Ga0068854_100057595 Ga0068854_1000575953 251
115 3300005578 Ga0068854_100478001 Ga0068854_1004780012 251
116 3300005614 Ga0068856_100019423 Ga0068856_1000194232 251
117 3300005614 Ga0068856_100232843 Ga0068856_1002328432 251
118 3300005616 Ga0068852_100018142 Ga0068852_1000181422 251
119 3300005616 Ga0068852_100095507 Ga0068852_1000955072 251
120 3300005617 Ga0068859_100097135 Ga0068859_1000971353 251
121 3300005618 Ga0068864_100107181 Ga0068864_1001071812 251
122 3300005719 Ga0068861_100256250 Ga0068861_1002562502 251
123 3300005834 Ga0068851_10060927 Ga0068851_100609272 251
124 3300005841 Ga0068863_100004752 Ga0068863_1000047529 251
125 3300005842 Ga0068858_100008058 Ga0068858_1000080583 251
126 3300005843 Ga0068860_100419621 Ga0068860_1004196211 251
127 3300005844 Ga0068862_100165943 Ga0068862_1001659433 251
128 3300005844 Ga0068862_100329127 Ga0068862_1003291272 251
129 3300006237 Ga0097621_100216705 Ga0097621_1002167052 251
130 3300006237 Ga0097621_100310054 Ga0097621_1003100542 251
131 3300006358 Ga0068871_100103745 Ga0068871_1001037452 251
132 3300006358 Ga0068871_100181702 Ga0068871_1001817022 251
133 3300006881 Ga0068865_100155838 Ga0068865_1001558384 251
134 3300006931 Ga0097620_100097132 Ga0097620_1000971323 251
135 3300009148 Ga0105243_10305194 Ga0105243_103051943 251
136 3300009177 Ga0105248_10200070 Ga0105248_102000703 251
137 3300009545 Ga0105237_10027692 Ga0105237_100276922 251
138 3300009553 Ga0105249_10077424 Ga0105249_100774244 251
139 3300013100 Ga0157373_10013050 Ga0157373_100130509 251
140 3300013100 Ga0157373_10030300 Ga0157373_100303005 251
141 3300013100 Ga0157373_10224480 Ga0157373_102244802 251
142 3300013104 Ga0157370_10465426 Ga0157370_104654262 251
143 3300013308 Ga0157375_10006174 Ga0157375_100061748 251
144 3300014325 Ga0163163_10300684 Ga0163163_103006842 251
145 3300014968 Ga0157379_10002519 Ga0157379_1000251911 251
146 3300017792 Ga0163161_10012814 Ga0163161_100128142 251
147 3300025304 Ga0209257_1023570 Ga0209257_10235703 251
148 3300025321 Ga0207656_10205606 Ga0207656_102056062 251
149 3300025903 Ga0207680_10026049 Ga0207680_100260493 251
150 3300025907 Ga0207645_10100868 Ga0207645_101008683 251
151 3300025909 Ga0207705_10083907 Ga0207705_100839072 251
152 3300025909 Ga0207705_10269340 Ga0207705_102693402 251
153 3300025917 Ga0207660_10060769 Ga0207660_100607691 251
154 3300025919 Ga0207657_10213049 Ga0207657_102130492 251
155 3300025931 Ga0207644_10194660 Ga0207644_101946602 251
156 3300025932 Ga0207690_10153111 Ga0207690_101531112 251
157 3300025932 Ga0207690_10249744 Ga0207690_102497442 251
158 3300025933 Ga0207706_10009419 Ga0207706_100094192 251
159 3300025933 Ga0207706_10052246 Ga0207706_100522465 251
160 3300025933 Ga0207706_10316015 Ga0207706_103160152 251
161 3300025933 Ga0207706_10429640 Ga0207706_104296402 251
162 3300025938 Ga0207704_10192864 Ga0207704_101928642 251
163 3300025945 Ga0207679_10036247 Ga0207679_100362473 251
164 3300025949 Ga0207667_10149498 Ga0207667_101494982 251
165 3300025949 Ga0207667_10673835 Ga0207667_106738351 251
166 3300025972 Ga0207668_10190704 Ga0207668_101907042 251
167 3300025986 Ga0207658_10069179 Ga0207658_100691793 251
168 3300026035 Ga0207703_10291068 Ga0207703_102910682 251
169 3300026041 Ga0207639_10224021 Ga0207639_102240212 251
170 3300026041 Ga0207639_10405062 Ga0207639_104050622 251
171 3300026067 Ga0207678_10192328 Ga0207678_101923282 251
172 3300026067 Ga0207678_10241618 Ga0207678_102416182 251
173 3300026067 Ga0207678_10262850 Ga0207678_102628502 251
174 3300026067 Ga0207678_10307407 Ga0207678_103074072 251
175 3300026078 Ga0207702_10007017 Ga0207702_100070178 251
176 3300026078 Ga0207702_10460330 Ga0207702_104603303 251
177 3300026088 Ga0207641_10008329 Ga0207641_100083299 251
178 3300026089 Ga0207648_10178065 Ga0207648_101780652 251
179 3300026095 Ga0207676_10007277 Ga0207676_100072773 251
180 3300026116 Ga0207674_10000344 Ga0207674_1000034435 251
181 3300026116 Ga0207674_10015947 Ga0207674_100159472 251
182 3300026116 Ga0207674_10175536 Ga0207674_101755363 251
183 3300026116 Ga0207674_10343258 Ga0207674_103432582 251
184 3300026118 Ga0207675_100197149 Ga0207675_1001971494 251
185 3300026142 Ga0207698_10235000 Ga0207698_102350002 251
186 3300028379 Ga0268266_10066641 Ga0268266_100666415 251
187 3300028379 Ga0268266_10222774 Ga0268266_102227743 251
188 3300028380 Ga0268265_10224201 Ga0268265_102242012 251
189 3300028380 Ga0268265_10314786 Ga0268265_103147862 251
190 3300028381 Ga0268264_10174351 Ga0268264_101743512 251
191 3300031548 Ga0307408_100018443 Ga0307408_1000184436 251
192 3300031548 Ga0307408_100041171 Ga0307408_1000411712 251
193 3300031548 Ga0307408_100086600 Ga0307408_1000866002 251
194 3300031548 Ga0307408_100366522 Ga0307408_1003665222 251
195 3300031731 Ga0307405_10010855 Ga0307405_100108553 251
196 3300031731 Ga0307405_10015885 Ga0307405_100158855 251
197 3300031731 Ga0307405_10071840 Ga0307405_100718402 251
198 3300031731 Ga0307405_10143723 Ga0307405_101437233 251
199 3300031731 Ga0307405_10243956 Ga0307405_102439561 251
200 3300031824 Ga0307413_10011815 Ga0307413_100118154 251
201 3300031824 Ga0307413_10019215 Ga0307413_100192154 251
202 3300031824 Ga0307413_10049492 Ga0307413_100494922 251
203 3300031824 Ga0307413_10049873 Ga0307413_100498732 251
204 3300031824 Ga0307413_10084996 Ga0307413_100849962 251
205 3300031824 Ga0307413_10104401 Ga0307413_101044012 251
206 3300031824 Ga0307413_10204889 Ga0307413_102048891 251
207 3300031824 Ga0307413_10225655 Ga0307413_102256551 251
208 3300031852 Ga0307410_10000437 Ga0307410_100004377 251
209 3300031852 Ga0307410_10002245 Ga0307410_100022452 251
210 3300031852 Ga0307410_10018602 Ga0307410_100186022 251
211 3300031852 Ga0307410_10020245 Ga0307410_100202451 251
212 3300031852 Ga0307410_10054988 Ga0307410_100549882 251
213 3300031852 Ga0307410_10120075 Ga0307410_101200752 251
214 3300031852 Ga0307410_10261591 Ga0307410_102615912 251
215 3300031852 Ga0307410_10373307 Ga0307410_103733071 251
216 3300031901 Ga0307406_10067694 Ga0307406_100676943 251
217 3300031901 Ga0307406_10189145 Ga0307406_101891452 251
218 3300031903 Ga0307407_10012018 Ga0307407_100120183 251
219 3300031903 Ga0307407_10028272 Ga0307407_100282724 251
220 3300031903 Ga0307407_10029650 Ga0307407_100296502 251
221 3300031903 Ga0307407_10140292 Ga0307407_101402922 251
222 3300031903 Ga0307407_10143031 Ga0307407_101430312 251
223 3300031903 Ga0307407_10163881 Ga0307407_101638812 251
224 3300031903 Ga0307407_10404195 Ga0307407_104041951 251
225 3300031911 Ga0307412_10018501 Ga0307412_100185012 251
226 3300031911 Ga0307412_10040412 Ga0307412_100404123 251
227 3300031911 Ga0307412_10050961 Ga0307412_100509613 251
228 3300031911 Ga0307412_10063893 Ga0307412_100638931 251
229 3300031911 Ga0307412_10114275 Ga0307412_101142752 251
230 3300031911 Ga0307412_10251421 Ga0307412_102514212 251
231 3300031995 Ga0307409_100015346 Ga0307409_1000153462 251
232 3300031995 Ga0307409_100055120 Ga0307409_1000551203 251
233 3300031995 Ga0307409_100063979 Ga0307409_1000639792 251
234 3300031995 Ga0307409_100095690 Ga0307409_1000956903 251
235 3300031995 Ga0307409_100582048 Ga0307409_1005820482 251
236 3300031995 Ga0307409_101072994 Ga0307409_1010729941 251
237 3300032002 Ga0307416_100010650 Ga0307416_1000106504 251
238 3300032002 Ga0307416_100099552 Ga0307416_1000995522 251
239 3300032002 Ga0307416_100347621 Ga0307416_1003476212 251
240 3300032002 Ga0307416_100902880 Ga0307416_1009028802 251
241 3300032004 Ga0307414_10001211 Ga0307414_100012112 251
242 3300032004 Ga0307414_10002592 Ga0307414_1000259210 251
243 3300032004 Ga0307414_10032445 Ga0307414_100324452 251
244 3300032004 Ga0307414_10063949 Ga0307414_100639492 251
245 3300032004 Ga0307414_10162999 Ga0307414_101629992 251
246 3300032004 Ga0307414_10278865 Ga0307414_102788652 251
247 3300032004 Ga0307414_10330877 Ga0307414_103308772 251
248 3300032005 Ga0307411_10005121 Ga0307411_100051213 251
249 3300032005 Ga0307411_10011401 Ga0307411_100114013 251
250 3300032005 Ga0307411_10028131 Ga0307411_100281312 251
251 3300032005 Ga0307411_10040932 Ga0307411_100409322 251
252 3300032005 Ga0307411_10067242 Ga0307411_100672422 251
253 3300032005 Ga0307411_10083066 Ga0307411_100830663 251
254 3300032005 Ga0307411_10209942 Ga0307411_102099422 251
255 3300032005 Ga0307411_10244259 Ga0307411_102442592 251
256 3300032005 Ga0307411_10453387 Ga0307411_104533871 251
257 3300032005 Ga0307411_10487561 Ga0307411_104875612 251
258 3300032005 Ga0307411_10565276 Ga0307411_105652761 251
259 3300032126 Ga0307415_100011669 Ga0307415_1000116693 251
260 3300032126 Ga0307415_100013186 Ga0307415_1000131867 251
261 3300032126 Ga0307415_100039067 Ga0307415_1000390673 251
262 3300032126 Ga0307415_100049466 Ga0307415_1000494662 251
263 3300032126 Ga0307415_100161638 Ga0307415_1001616382 251
264 3300032126 Ga0307415_100614121 Ga0307415_1006141211 251
265 3300032126 Ga0307415_100784808 Ga0307415_1007848081 251
266 3300037312 Ga0395899_0080132 Ga0395899_0080132_917_1675 251
267 3300037466 Ga0395898_0048231 Ga0395898_0048231_2152_2910 251
268 3300037471 Ga0395905_0021418 Ga0395905_0021418_4638_5393 251
269 3300037471 Ga0395905_0307074 Ga0395905_0307074_215_970 251
270 3300038443 Ga0395901_0144063 Ga0395901_0144063_1185_1940 251
271 3300042000 Ga0439437_001354 Ga0439437_001354_105_863 251
272 3300042006 Ga0439432_046889 Ga0439432_046889_189_944 251
273 3300042007 Ga0439449_0077673 Ga0439449_0077673_433_1188 251
274 3300042015 Ga0439462_0039731 Ga0439462_0039731_23_778 251
275 3300042116 Ga0450912_000518 Ga0450912_000518_409_1164 251
276 3300044683 Ga0466965_0086748 Ga0466965_0086748_541_1296 251
277 3300046660 Ga0495625_0041342 Ga0495625_0041342_1213_1974 251
278 3300046684 Ga0495669_0000306 Ga0495669_0000306_24247_25002 251
279 3300046684 Ga0495669_0007410 Ga0495669_0007410_3338_4093 251
280 3300046684 Ga0495669_0078435 Ga0495669_0078435_609_1364 251
281 3300048905 Ga0496102_0303664 Ga0496102_0303664_613_1368 251
282 3300048906 Ga0496103_0135190 Ga0496103_0135190_658_1413 251
283 3300048910 Ga0496107_0032870 Ga0496107_0032870_319_1074 251
284 3300048910 Ga0496107_0039564 Ga0496107_0039564_249_1004 251
285 3300048910 Ga0496107_0074795 Ga0496107_0074795_777_1532 251
286 3300048911 Ga0496108_0109887 Ga0496108_0109887_691_1446 251
287 3300048911 Ga0496108_0121181 Ga0496108_0121181_1393_2148 251
288 3300048912 Ga0496109_0020963 Ga0496109_0020963_339_1094 251
289 3300048912 Ga0496109_0111869 Ga0496109_0111869_309_1064 251
290 3300048913 Ga0496110_0144090 Ga0496110_0144090_975_1730 251
291 3300048913 Ga0496110_0422376 Ga0496110_0422376_109_864 251
292 3300048914 Ga0496111_0003669 Ga0496111_0003669_7425_8180 251
293 3300048915 Ga0496112_0002414 Ga0496112_0002414_4110_4865 251
294 3300048917 Ga0496114_0010963 Ga0496114_0010963_411_1166 251
295 3300048928 Ga0496125_0127995 Ga0496125_0127995_266_1027 251
296 3300053104 Ga0500556_0000088 Ga0500556_0000088_44699_45460 251
297 3300053130 Ga0500642_0000001 Ga0500642_0000001_1429902_1430663 251
298 3300053157 Ga0500624_000173 Ga0500624_000173_21414_22181 251
299 3300053177 Ga0500636_0007644 Ga0500636_0007644_70_837 251
300 iso_pu_bacteria 2524023250 2524611313 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

58

287

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5151 6 242
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.4919 6 242
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.4911 6 242
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.4702 6 242
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.3556 15 251
ID Description Score Start End Superfamily
af_Q2FZP8_207_396_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4985 43 250 1.20.1250.20
af_Q2FZP8_207_396_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4735 43 250 1.20.1250.20
af_P75810_10_191_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4658 41 242 1.20.1250.20
af_Q2G226_6_195_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4523 42 241 1.20.1250.20
af_E7FB53_277_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4471 43 251 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A560C3B8-F1-model_v4 Probable membrane transporter protein 0.9841 1 247 GO:0005886
AF-A0A1E4MEX4-F1-model_v4 Probable membrane transporter protein 0.9824 1 251 GO:0005886
AF-A0A512AGF6-F1-model_v4 Probable membrane transporter protein 0.9824 1 251 GO:0005886
AF-A8YQR1-F1-model_v4 Probable membrane transporter protein 0.982 3 247 GO:0005886
AF-A0A0P9BGA6-F1-model_v4 Probable membrane transporter protein 0.9819 2 233 GO:0005886

Feature Viewer

pLDDT pTM Quality
86.94 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map