F395269

General Info

Members Datasets Scaffolds Average Seq Length
300 176 600 243

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100010076|Ga0068855_1000100764
Length 268
Sequence MRSRVAQVSGGAVMHLRVARVVGVVRNAPACGDLGGANVDRPLAAAVRSPIAAGRDRERARVARDLPTPVIRHLGLVEYEPTWRAMQRFTDERDVTTPDEIWFLEHPPVFTLGMNASRAHVLAPGDIPVVQIDRGGQVTYHGPGQLVVYPLIDLRRSGLGVRDLVTALEKSVIDLAAAHGVAAEARRSAPGVYVEGRKLASVGIRVRRGASYHGLAVNVRLDLEPFGRINPCGYEGLQMTQLCELGAAASVSAAAEALEPHLLRALGF

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.33
Rhizosphere 92
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100010076 3300005563 Bacteria 11392
2 rootH1_10043732 3300003316 Bacteria 2181
3 rootL2_10087475 3300003322 Bacteria 4220
4 rootH1_10280804 3300003323 Unclassified 1490
5 Ga0070683_100156412 3300005329 Bacteria 2162
6 Ga0070690_100227961 3300005330 Bacteria 1308
7 Ga0070666_10000496 3300005335 Bacteria 23684
8 Ga0070680_100134852 3300005336 Bacteria 2067
9 Ga0070680_100322560 3300005336 Bacteria 1311
10 Ga0070668_100006395 3300005347 Bacteria 8727
11 Ga0070669_100087648 3300005353 Bacteria 2328
12 Ga0070675_100656727 3300005354 Bacteria 953
13 Ga0070674_100254291 3300005356 Bacteria 1381
14 Ga0070709_10037764 3300005434 Bacteria 2952
15 Ga0070713_100001303 3300005436 Bacteria 15968
16 Ga0070713_100022776 3300005436 Bacteria 4847
17 Ga0070713_100263856 3300005436 Bacteria 1575
18 Ga0070711_100351912 3300005439 Bacteria 1184
19 Ga0070711_100464305 3300005439 Bacteria 1038
20 Ga0070694_100213214 3300005444 Bacteria 1445
21 Ga0070708_100000732 3300005445 Bacteria 24873
22 Ga0070708_100002849 3300005445 Bacteria 13437
23 Ga0070708_100012795 3300005445 Bacteria 6855
24 Ga0070678_100000952 3300005456 Bacteria 14892
25 Ga0070662_100781448 3300005457 Bacteria 811
26 Ga0070681_10001429 3300005458 Bacteria 21006
27 Ga0070681_10004599 3300005458 Bacteria 13177
28 Ga0070681_10010868 3300005458 Bacteria 8998
29 Ga0070681_10112955 3300005458 Bacteria 2656
30 Ga0070681_10134790 3300005458 Bacteria 2400
31 Ga0070681_10346398 3300005458 Bacteria 1396
32 Ga0068867_100057856 3300005459 Bacteria 2872
33 Ga0070706_100171596 3300005467 Bacteria 2025
34 Ga0070706_100428101 3300005467 Bacteria 1232
35 Ga0070707_100012722 3300005468 Bacteria 7856
36 Ga0070707_100031619 3300005468 Bacteria 5043
37 Ga0070707_100098858 3300005468 Bacteria 2826
38 Ga0070698_100035770 3300005471 Bacteria 5133
39 Ga0070699_100083581 3300005518 Bacteria 2785
40 Ga0070679_100031356 3300005530 Bacteria 5250
41 Ga0070679_100081519 3300005530 Bacteria 3225
42 Ga0070679_100083973 3300005530 Bacteria 3173
43 Ga0070679_100089254 3300005530 Bacteria 3070
44 Ga0070697_100036360 3300005536 Bacteria 3978
45 Ga0070696_100116754 3300005546 Bacteria 1927
46 Ga0070696_100312448 3300005546 Bacteria 1207
47 Ga0070696_100636712 3300005546 Bacteria 863
48 Ga0070665_100000509 3300005548 Bacteria 55803
49 Ga0070665_100055835 3300005548 Bacteria 3960
50 Ga0068855_100014849 3300005563 Bacteria 9379
51 Ga0068855_100047731 3300005563 Bacteria 5058
52 Ga0068855_100229629 3300005563 Bacteria 2079
53 Ga0068857_100150878 3300005577 Bacteria 2105
54 Ga0068856_100162526 3300005614 Bacteria 2244
55 Ga0068866_10000585 3300005718 Bacteria 16571
56 Ga0068861_100158163 3300005719 Bacteria 1866
57 Ga0068858_100050798 3300005842 Bacteria 3837
58 Ga0068860_100016540 3300005843 Bacteria 7194
59 Ga0068862_100012988 3300005844 Bacteria 6888
60 Ga0081539_10004940 3300005985 Bacteria 14177
61 Ga0070716_100024415 3300006173 Bacteria 3217
62 Ga0070712_100087754 3300006175 Bacteria 2270
63 Ga0097621_100070174 3300006237 Bacteria 2893
64 Ga0068871_100043863 3300006358 Bacteria 3594
65 Ga0068871_100183087 3300006358 Bacteria 1801
66 Ga0075428_100004938 3300006844 Bacteria 14805
67 Ga0068865_100002090 3300006881 Bacteria 11793
68 Ga0105240_10008157 3300009093 Bacteria 15019
69 Ga0105240_10032354 3300009093 Bacteria 6773
70 Ga0105240_10040573 3300009093 Bacteria 5951
71 Ga0105240_10168617 3300009093 Bacteria 2595
72 Ga0111539_10041027 3300009094 Bacteria 5567
73 Ga0111539_10161764 3300009094 Bacteria 2618
74 Ga0111539_11064052 3300009094 Bacteria 940
75 Ga0105247_10223281 3300009101 Bacteria 1276
76 Ga0105242_10000422 3300009176 Bacteria 33749
77 Ga0105248_10008369 3300009177 Bacteria 11361
78 Ga0105237_10030219 3300009545 Bacteria 5505
79 Ga0105237_10232360 3300009545 Bacteria 1845
80 Ga0105249_10013882 3300009553 Bacteria 7120
81 Ga0105249_10096958 3300009553 Bacteria 2767
82 Ga0099796_10000120 3300010159 Bacteria 11798
83 Ga0157370_10042972 3300013104 Bacteria 4352
84 Ga0157374_10154963 3300013296 Bacteria 2229
85 Ga0163162_10045164 3300013306 Bacteria 4413
86 Ga0157372_10038475 3300013307 Bacteria 5279
87 Ga0157375_10847297 3300013308 Bacteria 1061
88 Ga0163163_10179634 3300014325 Bacteria 2163
89 Ga0163163_10211564 3300014325 Bacteria 1988
90 Ga0206353_11836620 3300020082 Bacteria 960
91 Ga0213872_10121785 3300021361 Bacteria 1153
92 Ga0213874_10043005 3300021377 Bacteria 1359
93 Ga0207642_10007118 3300025899 Bacteria 3760
94 Ga0207680_10019813 3300025903 Bacteria 3606
95 Ga0207699_10072496 3300025906 Bacteria 2109
96 Ga0207645_10157174 3300025907 Bacteria 1486
97 Ga0207684_10104393 3300025910 Bacteria 2423
98 Ga0207684_10213014 3300025910 Bacteria 1666
99 Ga0207707_10000165 3300025912 Bacteria 69371
100 Ga0207707_10008137 3300025912 Bacteria 9106
101 Ga0207707_10010278 3300025912 Bacteria 8122
102 Ga0207707_10055063 3300025912 Bacteria 3461
103 Ga0207707_10094248 3300025912 Bacteria 2616
104 Ga0207707_10116325 3300025912 Bacteria 2336
105 Ga0207695_10018974 3300025913 Bacteria 7932
106 Ga0207695_10026065 3300025913 Bacteria 6530
107 Ga0207695_10057220 3300025913 Bacteria 4052
108 Ga0207695_10069351 3300025913 Bacteria 3608
109 Ga0207695_10080735 3300025913 Bacteria 3293
110 Ga0207695_10165029 3300025913 Bacteria 2144
111 Ga0207695_10169049 3300025913 Bacteria 2113
112 Ga0207695_10449717 3300025913 Bacteria 1171
113 Ga0207671_10087406 3300025914 Unclassified 2344
114 Ga0207671_10141790 3300025914 Bacteria 1852
115 Ga0207693_10000226 3300025915 Bacteria 51496
116 Ga0207693_10018462 3300025915 Bacteria 5556
117 Ga0207663_10029824 3300025916 Bacteria 3209
118 Ga0207663_10109963 3300025916 Bacteria 1868
119 Ga0207660_10017010 3300025917 Bacteria 4824
120 Ga0207660_10055058 3300025917 Bacteria 2841
121 Ga0207652_10002078 3300025921 Bacteria 17253
122 Ga0207652_10007737 3300025921 Bacteria 8632
123 Ga0207652_10109528 3300025921 Bacteria 2449
124 Ga0207646_10007636 3300025922 Bacteria 10947
125 Ga0207646_10029538 3300025922 Bacteria 4980
126 Ga0207694_10178892 3300025924 Bacteria 1719
127 Ga0207700_10028408 3300025928 Bacteria 3932
128 Ga0207700_10096468 3300025928 Bacteria 2348
129 Ga0207664_10215117 3300025929 Bacteria 1664
130 Ga0207669_10546200 3300025937 Bacteria 934
131 Ga0207704_10601427 3300025938 Bacteria 900
132 Ga0207665_10002356 3300025939 Bacteria 12761
133 Ga0207665_10023107 3300025939 Bacteria 4096
134 Ga0207661_10094039 3300025944 Bacteria 2503
135 Ga0207661_10185714 3300025944 Bacteria 1819
136 Ga0207667_10002663 3300025949 Bacteria 22069
137 Ga0207667_10073769 3300025949 Bacteria 3545
138 Ga0207712_10061674 3300025961 Bacteria 2662
139 Ga0207712_10087578 3300025961 Bacteria 2284
140 Ga0207668_10084500 3300025972 Bacteria 2313
141 Ga0207677_10221342 3300026023 Bacteria 1518
142 Ga0207702_10150298 3300026078 Bacteria 2118
143 Ga0207674_10108120 3300026116 Bacteria 2758
144 Ga0207675_100001082 3300026118 Bacteria 26982
145 Ga0207683_10001388 3300026121 Bacteria 21837
146 Ga0209179_1000082 3300027512 Bacteria 15283
147 Ga0209971_1008614 3300027682 Bacteria 2421
148 Ga0268266_10000246 3300028379 Bacteria 91633
149 Ga0268266_10429352 3300028379 Bacteria 1253
150 Ga0268265_10001567 3300028380 Bacteria 18947
151 Ga0265334_10007463 3300028573 Bacteria 4689
152 Ga0265339_10164844 3300031249 Unclassified 1113
153 Ga0265331_10007137 3300031250 Bacteria 6501
154 Ga0307408_100025790 3300031548 Bacteria 4029
155 Ga0265313_10021141 3300031595 Bacteria 3566
156 Ga0307516_10000067 3300031730 Bacteria 111575
157 Ga0307416_100211359 3300032002 Bacteria 1851
158 Ga0307415_100466246 3300032126 Bacteria 1096
159 Ga0307510_10000006 3300033180 Bacteria 566474
160 Ga0373934_0160161 3300035086 Bacteria 923
161 Ga0373956_0237525 3300035119 Bacteria 866
162 Ga0373943_0010507 3300035170 Bacteria 4147
163 Ga0373927_0023804 3300035695 Bacteria 4008
164 Ga0373937_0012306 3300036401 Bacteria 7522
165 Ga0373937_0025898 3300036401 Bacteria 5297
166 Ga0395900_0837242 3300037418 Bacteria 846
167 Ga0395898_0093880 3300037466 Bacteria 2883
168 Ga0395898_0097212 3300037466 Bacteria 2828
169 Ga0436365_1359151 3300039437 Bacteria 4195
170 Ga0436365_1665547 3300039437 Bacteria 1252
171 Ga0436360_0991780 3300039438 Bacteria 11480
172 Ga0436361_0277829 3300039447 Bacteria 1230
173 Ga0436363_1065977 3300039450 Bacteria 4328
174 Ga0436363_1304979 3300039450 Bacteria 1245
175 Ga0439442_024818 3300042002 Bacteria 1247
176 Ga0466966_0000674 3300044684 Bacteria 21627
177 Ga0466961_0031432 3300044693 Bacteria 3412
178 Ga0466963_0374543 3300044694 Bacteria 1003
179 Ga0466964_0006013 3300044706 Bacteria 4522
180 Ga0466970_0044378 3300044765 Bacteria 2366
181 Ga0466957_0188693 3300044842 Bacteria 1349
182 Ga0466959_0071909 3300045049 Bacteria 2504
183 Ga0466959_0088576 3300045049 Bacteria 2225
184 Ga0466958_0105328 3300045836 Bacteria 1757
185 Ga0466958_0223014 3300045836 Bacteria 1203
186 Ga0495580_0087168 3300046472 Bacteria 2174
187 Ga0495580_0197885 3300046472 Bacteria 1385
188 Ga0495628_0046619 3300046516 Bacteria 3442
189 Ga0495648_0106606 3300046524 Bacteria 1534
190 Ga0495665_0031812 3300046531 Bacteria 2823
191 Ga0495625_0392344 3300046660 Bacteria 869
192 Ga0495599_0202246 3300046678 Bacteria 1220
193 Ga0495604_0113349 3300047317 Bacteria 1974
194 Ga0495674_0065531 3300047319 Bacteria 3155
195 Ga0495687_019751 3300047443 Bacteria 3297
196 Ga0495602_0037118 3300048088 Bacteria 4526
197 Ga0496102_0001303 3300048905 Bacteria 22429
198 Ga0496102_0005430 3300048905 Bacteria 10814
199 Ga0496114_0011764 3300048917 Bacteria 7001
200 Ga0496115_0279186 3300048918 Bacteria 1371
201 Ga0496116_0003851 3300048919 Bacteria 14645
202 Ga0496117_0000229 3300048920 Bacteria 105861
203 Ga0496118_0000016 3300048921 Bacteria 549586
204 Ga0496119_0024550 3300048922 Bacteria 4236
205 Ga0496120_0012195 3300048923 Bacteria 5860
206 Ga0496121_0017798 3300048924 Bacteria 7220
207 Ga0496121_0050388 3300048924 Bacteria 3518
208 Ga0496124_0090347 3300048927 Bacteria 2498
209 Ga0496125_0005789 3300048928 Bacteria 13576
210 Ga0496125_0047300 3300048928 Bacteria 3600
211 Ga0501031_0012964 3300049568 Bacteria 5441
212 Ga0501031_0035581 3300049568 Bacteria 3248
213 Ga0501031_0049255 3300049568 Bacteria 2746
214 Ga0501031_0104687 3300049568 Bacteria 1847
215 Ga0501032_0066249 3300049569 Bacteria 2414
216 Ga0501036_0026477 3300049572 Bacteria 4895
217 Ga0501036_0198014 3300049572 Bacteria 1690
218 Ga0501037_0040821 3300049573 Bacteria 3414
219 Ga0501037_0119482 3300049573 Bacteria 1896
220 Ga0501038_0052866 3300049574 Bacteria 3500
221 Ga0501039_0003512 3300049575 Bacteria 11738
222 Ga0501039_0007387 3300049575 Bacteria 8381
223 Ga0501040_0012219 3300049576 Bacteria 5623
224 Ga0501040_0119973 3300049576 Bacteria 1845
225 Ga0501041_0009363 3300049577 Bacteria 5771
226 Ga0501041_0015313 3300049577 Bacteria 4552
227 Ga0501041_0053762 3300049577 Bacteria 2456
228 Ga0501042_0006262 3300049578 Bacteria 7727
229 Ga0501042_0008866 3300049578 Bacteria 6669
230 Ga0501042_0033899 3300049578 Bacteria 3620
231 Ga0501043_0080597 3300049579 Bacteria 2558
232 Ga0501046_0033488 3300049580 Bacteria 4151
233 Ga0501048_0030096 3300049582 Bacteria 3931
234 Ga0501048_0184303 3300049582 Bacteria 1480
235 Ga0501067_0007355 3300049583 Bacteria 6117
236 Ga0501068_0001706 3300049584 Bacteria 11694
237 Ga0501069_0003744 3300049585 Bacteria 7815
238 Ga0501070_0042756 3300049586 Bacteria 3773
239 Ga0501071_0001264 3300049587 Bacteria 14339
240 Ga0501071_0001289 3300049587 Bacteria 14262
241 Ga0501071_0094419 3300049587 Bacteria 2200
242 Ga0501071_0166882 3300049587 Bacteria 1647
243 Ga0501072_0002050 3300049588 Bacteria 14984
244 Ga0501072_0007114 3300049588 Bacteria 8490
245 Ga0501072_0180839 3300049588 Bacteria 1682
246 Ga0501073_0060335 3300049589 Bacteria 2647
247 Ga0501073_0061092 3300049589 Bacteria 2630
248 Ga0501073_0184532 3300049589 Bacteria 1444
249 Ga0501074_0022842 3300049590 Bacteria 4548
250 Ga0501074_0164279 3300049590 Bacteria 1585
251 Ga0501075_0003706 3300049591 Bacteria 10261
252 Ga0501075_0023558 3300049591 Bacteria 4509
253 Ga0501075_0135718 3300049591 Bacteria 1875
254 Ga0501075_0158017 3300049591 Bacteria 1729
255 Ga0501075_0258167 3300049591 Bacteria 1328
256 Ga0501076_0003640 3300049592 Bacteria 10830
257 Ga0501076_0004190 3300049592 Bacteria 10210
258 Ga0501076_0067488 3300049592 Bacteria 2856
259 Ga0501076_0106428 3300049592 Bacteria 2264
260 Ga0501076_0111366 3300049592 Bacteria 2212
261 Ga0501077_0001836 3300049593 Bacteria 12847
262 Ga0501077_0050684 3300049593 Bacteria 2638
263 Ga0501077_0052687 3300049593 Bacteria 2584
264 Ga0501079_0002951 3300049741 Bacteria 12431
265 Ga0501079_0006731 3300049741 Bacteria 8647
266 Ga0501079_0017214 3300049741 Bacteria 5518
267 Ga0501079_0046267 3300049741 Bacteria 3357
268 Ga0501079_0056599 3300049741 Bacteria 3026
269 Ga0501079_0073924 3300049741 Bacteria 2635
270 Ga0501079_0124781 3300049741 Bacteria 2003
271 Ga0501079_0225597 3300049741 Bacteria 1464
272 Ga0501079_0309947 3300049741 Bacteria 1235
273 Ga0501080_0026631 3300049742 Bacteria 5372
274 Ga0501080_0066126 3300049742 Bacteria 3362
275 Ga0501080_0231433 3300049742 Bacteria 1689
276 Ga0501080_0500453 3300049742 Bacteria 1086
277 Ga0501081_0001397 3300049743 Bacteria 14726
278 Ga0501081_0014852 3300049743 Bacteria 5138
279 Ga0501081_0028443 3300049743 Bacteria 3773
280 Ga0501081_0138856 3300049743 Bacteria 1741
281 Ga0501081_0251816 3300049743 Bacteria 1289
282 Ga0501083_0200987 3300049744 Bacteria 1300
283 Ga0501035_0133321 3300049822 Bacteria 2164
284 Ga0501035_0226858 3300049822 Bacteria 1593
285 Ga0501045_0071827 3300049824 Bacteria 2548
286 nmdc:mga06r32_164093_c1 3300050510 Bacteria 2204
287 Ga0501084_0004464 3300054114 Bacteria 11424
288 Ga0501084_0007168 3300054114 Bacteria 9183
289 Ga0501084_0026669 3300054114 Bacteria 4824
290 Ga0501084_0150660 3300054114 Bacteria 1960
291 Ga0501084_0157464 3300054114 Bacteria 1916
292 Ga0501084_0251388 3300054114 Bacteria 1492
293 Ga0501084_0462335 3300054114 Bacteria 1073
294 Ga0501082_0005815 3300060353 Bacteria 10708
295 Ga0501082_0210431 3300060353 Bacteria 1692
296 Ga0466962_0009001 3300061719 Bacteria 4781
297 Ga0530510_0004394 3300061734 Bacteria 9759
298 Ga0530510_0053875 3300061734 Bacteria 2907
299 Ga0530510_0096224 3300061734 Bacteria 2164
300 Ga0530510_0223250 3300061734 Bacteria 1400
301 Ga0068855_100010076
302 rootH1_10043732
303 rootL2_10087475
304 rootH1_10280804
305 Ga0070683_100156412
306 Ga0070690_100227961
307 Ga0070666_10000496
308 Ga0070680_100134852
309 Ga0070680_100322560
310 Ga0070668_100006395
311 Ga0070669_100087648
312 Ga0070675_100656727
313 Ga0070674_100254291
314 Ga0070709_10037764
315 Ga0070713_100001303
316 Ga0070713_100022776
317 Ga0070713_100263856
318 Ga0070711_100351912
319 Ga0070711_100464305
320 Ga0070694_100213214
321 Ga0070708_100000732
322 Ga0070708_100002849
323 Ga0070708_100012795
324 Ga0070678_100000952
325 Ga0070662_100781448
326 Ga0070681_10001429
327 Ga0070681_10004599
328 Ga0070681_10010868
329 Ga0070681_10112955
330 Ga0070681_10134790
331 Ga0070681_10346398
332 Ga0068867_100057856
333 Ga0070706_100171596
334 Ga0070706_100428101
335 Ga0070707_100012722
336 Ga0070707_100031619
337 Ga0070707_100098858
338 Ga0070698_100035770
339 Ga0070699_100083581
340 Ga0070679_100031356
341 Ga0070679_100081519
342 Ga0070679_100083973
343 Ga0070679_100089254
344 Ga0070697_100036360
345 Ga0070696_100116754
346 Ga0070696_100312448
347 Ga0070696_100636712
348 Ga0070665_100000509
349 Ga0070665_100055835
350 Ga0068855_100014849
351 Ga0068855_100047731
352 Ga0068855_100229629
353 Ga0068857_100150878
354 Ga0068856_100162526
355 Ga0068866_10000585
356 Ga0068861_100158163
357 Ga0068858_100050798
358 Ga0068860_100016540
359 Ga0068862_100012988
360 Ga0081539_10004940
361 Ga0070716_100024415
362 Ga0070712_100087754
363 Ga0097621_100070174
364 Ga0068871_100043863
365 Ga0068871_100183087
366 Ga0075428_100004938
367 Ga0068865_100002090
368 Ga0105240_10008157
369 Ga0105240_10032354
370 Ga0105240_10040573
371 Ga0105240_10168617
372 Ga0111539_10041027
373 Ga0111539_10161764
374 Ga0111539_11064052
375 Ga0105247_10223281
376 Ga0105242_10000422
377 Ga0105248_10008369
378 Ga0105237_10030219
379 Ga0105237_10232360
380 Ga0105249_10013882
381 Ga0105249_10096958
382 Ga0099796_10000120
383 Ga0157370_10042972
384 Ga0157374_10154963
385 Ga0163162_10045164
386 Ga0157372_10038475
387 Ga0157375_10847297
388 Ga0163163_10179634
389 Ga0163163_10211564
390 Ga0206353_11836620
391 Ga0213872_10121785
392 Ga0213874_10043005
393 Ga0207642_10007118
394 Ga0207680_10019813
395 Ga0207699_10072496
396 Ga0207645_10157174
397 Ga0207684_10104393
398 Ga0207684_10213014
399 Ga0207707_10000165
400 Ga0207707_10008137
401 Ga0207707_10010278
402 Ga0207707_10055063
403 Ga0207707_10094248
404 Ga0207707_10116325
405 Ga0207695_10018974
406 Ga0207695_10026065
407 Ga0207695_10057220
408 Ga0207695_10069351
409 Ga0207695_10080735
410 Ga0207695_10165029
411 Ga0207695_10169049
412 Ga0207695_10449717
413 Ga0207671_10087406
414 Ga0207671_10141790
415 Ga0207693_10000226
416 Ga0207693_10018462
417 Ga0207663_10029824
418 Ga0207663_10109963
419 Ga0207660_10017010
420 Ga0207660_10055058
421 Ga0207652_10002078
422 Ga0207652_10007737
423 Ga0207652_10109528
424 Ga0207646_10007636
425 Ga0207646_10029538
426 Ga0207694_10178892
427 Ga0207700_10028408
428 Ga0207700_10096468
429 Ga0207664_10215117
430 Ga0207669_10546200
431 Ga0207704_10601427
432 Ga0207665_10002356
433 Ga0207665_10023107
434 Ga0207661_10094039
435 Ga0207661_10185714
436 Ga0207667_10002663
437 Ga0207667_10073769
438 Ga0207712_10061674
439 Ga0207712_10087578
440 Ga0207668_10084500
441 Ga0207677_10221342
442 Ga0207702_10150298
443 Ga0207674_10108120
444 Ga0207675_100001082
445 Ga0207683_10001388
446 Ga0209179_1000082
447 Ga0209971_1008614
448 Ga0268266_10000246
449 Ga0268266_10429352
450 Ga0268265_10001567
451 Ga0265334_10007463
452 Ga0265339_10164844
453 Ga0265331_10007137
454 Ga0307408_100025790
455 Ga0265313_10021141
456 Ga0307516_10000067
457 Ga0307416_100211359
458 Ga0307415_100466246
459 Ga0307510_10000006
460 Ga0373934_0160161
461 Ga0373956_0237525
462 Ga0373943_0010507
463 Ga0373927_0023804
464 Ga0373937_0012306
465 Ga0373937_0025898
466 Ga0395900_0837242
467 Ga0395898_0093880
468 Ga0395898_0097212
469 Ga0436365_1359151
470 Ga0436365_1665547
471 Ga0436360_0991780
472 Ga0436361_0277829
473 Ga0436363_1065977
474 Ga0436363_1304979
475 Ga0439442_024818
476 Ga0466966_0000674
477 Ga0466961_0031432
478 Ga0466963_0374543
479 Ga0466964_0006013
480 Ga0466970_0044378
481 Ga0466957_0188693
482 Ga0466959_0071909
483 Ga0466959_0088576
484 Ga0466958_0105328
485 Ga0466958_0223014
486 Ga0495580_0087168
487 Ga0495580_0197885
488 Ga0495628_0046619
489 Ga0495648_0106606
490 Ga0495665_0031812
491 Ga0495625_0392344
492 Ga0495599_0202246
493 Ga0495604_0113349
494 Ga0495674_0065531
495 Ga0495687_019751
496 Ga0495602_0037118
497 Ga0496102_0001303
498 Ga0496102_0005430
499 Ga0496114_0011764
500 Ga0496115_0279186
501 Ga0496116_0003851
502 Ga0496117_0000229
503 Ga0496118_0000016
504 Ga0496119_0024550
505 Ga0496120_0012195
506 Ga0496121_0017798
507 Ga0496121_0050388
508 Ga0496124_0090347
509 Ga0496125_0005789
510 Ga0496125_0047300
511 Ga0501031_0012964
512 Ga0501031_0035581
513 Ga0501031_0049255
514 Ga0501031_0104687
515 Ga0501032_0066249
516 Ga0501036_0026477
517 Ga0501036_0198014
518 Ga0501037_0040821
519 Ga0501037_0119482
520 Ga0501038_0052866
521 Ga0501039_0003512
522 Ga0501039_0007387
523 Ga0501040_0012219
524 Ga0501040_0119973
525 Ga0501041_0009363
526 Ga0501041_0015313
527 Ga0501041_0053762
528 Ga0501042_0006262
529 Ga0501042_0008866
530 Ga0501042_0033899
531 Ga0501043_0080597
532 Ga0501046_0033488
533 Ga0501048_0030096
534 Ga0501048_0184303
535 Ga0501067_0007355
536 Ga0501068_0001706
537 Ga0501069_0003744
538 Ga0501070_0042756
539 Ga0501071_0001264
540 Ga0501071_0001289
541 Ga0501071_0094419
542 Ga0501071_0166882
543 Ga0501072_0002050
544 Ga0501072_0007114
545 Ga0501072_0180839
546 Ga0501073_0060335
547 Ga0501073_0061092
548 Ga0501073_0184532
549 Ga0501074_0022842
550 Ga0501074_0164279
551 Ga0501075_0003706
552 Ga0501075_0023558
553 Ga0501075_0135718
554 Ga0501075_0158017
555 Ga0501075_0258167
556 Ga0501076_0003640
557 Ga0501076_0004190
558 Ga0501076_0067488
559 Ga0501076_0106428
560 Ga0501076_0111366
561 Ga0501077_0001836
562 Ga0501077_0050684
563 Ga0501077_0052687
564 Ga0501079_0002951
565 Ga0501079_0006731
566 Ga0501079_0017214
567 Ga0501079_0046267
568 Ga0501079_0056599
569 Ga0501079_0073924
570 Ga0501079_0124781
571 Ga0501079_0225597
572 Ga0501079_0309947
573 Ga0501080_0026631
574 Ga0501080_0066126
575 Ga0501080_0231433
576 Ga0501080_0500453
577 Ga0501081_0001397
578 Ga0501081_0014852
579 Ga0501081_0028443
580 Ga0501081_0138856
581 Ga0501081_0251816
582 Ga0501083_0200987
583 Ga0501035_0133321
584 Ga0501035_0226858
585 Ga0501045_0071827
586 nmdc:mga06r32_164093_c1
587 Ga0501084_0004464
588 Ga0501084_0007168
589 Ga0501084_0026669
590 Ga0501084_0150660
591 Ga0501084_0157464
592 Ga0501084_0251388
593 Ga0501084_0462335
594 Ga0501082_0005815
595 Ga0501082_0210431
596 Ga0466962_0009001
597 Ga0530510_0004394
598 Ga0530510_0053875
599 Ga0530510_0096224
600 Ga0530510_0223250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

78

263

0.93

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

115

222

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.9195 25 222
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9067 24 224
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.8656 24 224
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8348 25 222
2c7i-assembly2.cif.gz_B structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.7936 24 223
ID Description Score Start End Superfamily
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9817 25 221 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.953 25 221 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9463 25 222 3.30.930.10
af_P0C7R2_45_252_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9391 25 201 3.30.930.10
1w66A01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9195 25 222 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A3A6TXK2-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9883 24 223 GO:0005737
GO:0033819
AF-A0A7Z0QPE0-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9877 24 224 GO:0005737
GO:0033819
AF-A0A136A5T3-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9873 24 224 GO:0005737
GO:0033819
AF-A0A2T4CS76-F1-model_v4 deleted 0.9861 28 188
AF-A0A0G9HBL1-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9858 24 224 GO:0005737
GO:0033819

Map