F395200

General Info

Members Datasets Scaffolds Average Seq Length
300 146 600 245

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100042696|Ga0070680_1000426963
Length 243
Sequence VIDTHTHLDALDDDPAAVVDRARAAGVTRILTVGTDVAGSRRALELADAHDEVYAVIGIHPHEAASAGDGMVGEVCRLHDHPKAVAIGEIGLDYYRDYAPHDAQRRLFDAQLALAADIEAPVVIHTRAADEDTLAALAGFLHCFSSPHLLPAALERGWFVSFAGNATFPKAVDLRLAAREVPADRILAETDAPYLAPQPVRGRRNEPAFVMHTLAALAQARDEDPDELERQIDRNATACFALP

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 1.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.67
Rhizosphere 90.33
Stem 0
Stem Tuber 0
Unclassified 3.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100042696 3300005336 Bacteria 3680
2 Ga0070658_10005067 3300005327 Bacteria 10725
3 Ga0070680_100089010 3300005336 Bacteria 2554
4 Ga0070682_100041980 3300005337 Bacteria 2822
5 Ga0070660_100017918 3300005339 Bacteria 5167
6 Ga0070660_100020585 3300005339 Bacteria 4850
7 Ga0070661_100030879 3300005344 Bacteria 3873
8 Ga0070659_100015334 3300005366 Bacteria 5739
9 Ga0070709_10003335 3300005434 Bacteria 8633
10 Ga0070714_100006899 3300005435 Bacteria 8804
11 Ga0070714_100033653 3300005435 Bacteria 4286
12 Ga0070714_100052149 3300005435 Bacteria 3489
13 Ga0070714_100137500 3300005435 Bacteria 2189
14 Ga0070713_100013174 3300005436 Bacteria 6096
15 Ga0070710_10001370 3300005437 Bacteria 11509
16 Ga0070710_10006594 3300005437 Bacteria 5581
17 Ga0070710_10449878 3300005437 Bacteria 873
18 Ga0070711_100010962 3300005439 Bacteria 5619
19 Ga0070711_100061826 3300005439 Bacteria 2608
20 Ga0070681_10011999 3300005458 Bacteria 8590
21 Ga0070681_10082958 3300005458 Bacteria 3159
22 Ga0070681_10233054 3300005458 Bacteria 1755
23 Ga0070706_100199300 3300005467 Bacteria 1870
24 Ga0070679_100258799 3300005530 Bacteria 1695
25 Ga0070679_100264108 3300005530 Bacteria 1676
26 Ga0070679_100340014 3300005530 Bacteria 1449
27 Ga0070684_100188837 3300005535 Bacteria 1875
28 Ga0070684_100343957 3300005535 Bacteria 1371
29 Ga0070697_100504660 3300005536 Bacteria 1058
30 Ga0068853_100268242 3300005539 Bacteria 1571
31 Ga0070695_100000005 3300005545 Bacteria 97484
32 Ga0070693_100457760 3300005547 Bacteria 897
33 Ga0068855_100031278 3300005563 Bacteria 6357
34 Ga0068855_100618463 3300005563 Bacteria 1166
35 Ga0070664_100098349 3300005564 Bacteria 2542
36 Ga0068856_100020050 3300005614 Bacteria 6492
37 Ga0068852_100058841 3300005616 Bacteria 3330
38 Ga0068852_100394624 3300005616 Bacteria 1360
39 Ga0068858_100786318 3300005842 Bacteria 928
40 Ga0070717_10030275 3300006028 Bacteria 4348
41 Ga0070717_10102185 3300006028 Bacteria 2435
42 Ga0070717_10193630 3300006028 Unclassified 1777
43 Ga0070715_10000878 3300006163 Bacteria 8326
44 Ga0070716_100010653 3300006173 Bacteria 4615
45 Ga0070712_100048281 3300006175 Bacteria 2950
46 Ga0075434_100314810 3300006871 Bacteria 1586
47 Ga0105240_10010278 3300009093 Bacteria 13176
48 Ga0105240_10014851 3300009093 Bacteria 10615
49 Ga0105247_10081813 3300009101 Bacteria 2037
50 Ga0157371_10518171 3300013102 Bacteria 882
51 Ga0157370_10007418 3300013104 Bacteria 11939
52 Ga0157369_10114126 3300013105 Bacteria 2869
53 Ga0157369_10129314 3300013105 Bacteria 2677
54 Ga0157374_10186196 3300013296 Bacteria 2030
55 Ga0157372_10021807 3300013307 Bacteria 6924
56 Ga0157372_10953180 3300013307 Bacteria 995
57 Ga0157379_10452385 3300014968 Unclassified 1186
58 Ga0182006_1028491 3300015261 Bacteria 2270
59 Ga0206356_11065317 3300020070 Bacteria 1999
60 Ga0206356_11509181 3300020070 Bacteria 952
61 Ga0206353_10795244 3300020082 Bacteria 5561
62 Ga0206353_11066925 3300020082 Bacteria 3406
63 Ga0207692_10003990 3300025898 Bacteria 5800
64 Ga0207685_10004562 3300025905 Bacteria 3542
65 Ga0207699_10038869 3300025906 Bacteria 2730
66 Ga0207699_10105045 3300025906 Bacteria 1800
67 Ga0207705_10006869 3300025909 Bacteria 8412
68 Ga0207684_10129945 3300025910 Bacteria 2162
69 Ga0207707_10057034 3300025912 Bacteria 3399
70 Ga0207707_10505608 3300025912 Bacteria 1030
71 Ga0207695_10024627 3300025913 Bacteria 6763
72 Ga0207695_10120995 3300025913 Bacteria 2586
73 Ga0207671_10196781 3300025914 Bacteria 1573
74 Ga0207693_10000954 3300025915 Bacteria 25940
75 Ga0207693_10005241 3300025915 Bacteria 10848
76 Ga0207693_10444613 3300025915 Bacteria 1013
77 Ga0207663_10009167 3300025916 Bacteria 5220
78 Ga0207663_10094841 3300025916 Bacteria 1989
79 Ga0207660_10189087 3300025917 Bacteria 1602
80 Ga0207657_10004535 3300025919 Bacteria 14676
81 Ga0207657_10026303 3300025919 Bacteria 5349
82 Ga0207657_10081416 3300025919 Bacteria 2720
83 Ga0207649_10639296 3300025920 Bacteria 821
84 Ga0207652_10206940 3300025921 Bacteria 1766
85 Ga0207646_10046329 3300025922 Bacteria 3900
86 Ga0207646_10244186 3300025922 Bacteria 1622
87 Ga0207687_10304657 3300025927 Unclassified 1284
88 Ga0207664_10002601 3300025929 Bacteria 11955
89 Ga0207664_10009608 3300025929 Bacteria 6795
90 Ga0207664_10019828 3300025929 Bacteria 4977
91 Ga0207664_10020312 3300025929 Bacteria 4921
92 Ga0207664_10038660 3300025929 Bacteria 3701
93 Ga0207664_10050295 3300025929 Bacteria 3286
94 Ga0207664_10128887 3300025929 Bacteria 2127
95 Ga0207664_10194466 3300025929 Bacteria 1748
96 Ga0207665_10000298 3300025939 Bacteria 34286
97 Ga0207661_10471198 3300025944 Unclassified 1145
98 Ga0207679_10257117 3300025945 Bacteria 1488
99 Ga0207667_10037383 3300025949 Bacteria 5190
100 Ga0207667_10367983 3300025949 Bacteria 1465
101 Ga0207639_10246234 3300026041 Bacteria 1557
102 Ga0207702_10092517 3300026078 Bacteria 2650
103 Ga0207698_10210111 3300026142 Bacteria 1750
104 Ga0265319_1021173 3300028563 Bacteria 2393
105 Ga0265334_10043323 3300028573 Bacteria 1751
106 Ga0265336_10028129 3300028666 Bacteria 1757
107 Ga0265338_10006090 3300028800 Bacteria 15491
108 Ga0265338_10009372 3300028800 Bacteria 11691
109 Ga0265338_10016384 3300028800 Bacteria 8071
110 Ga0265338_10187767 3300028800 Bacteria 1569
111 Ga0265324_10010955 3300029957 Bacteria 3474
112 Ga0265327_10011974 3300031251 Bacteria 5909
113 Ga0265327_10061541 3300031251 Bacteria 1915
114 Ga0265313_10015798 3300031595 Bacteria 4372
115 Ga0265342_10177303 3300031712 Bacteria 1169
116 Ga0373960_0021697 3300035121 Bacteria 1711
117 Ga0373933_0046650 3300035724 Bacteria 2574
118 Ga0373937_0001125 3300036401 Bacteria 22495
119 Ga0373937_0390088 3300036401 Unclassified 1321
120 Ga0395900_0467440 3300037418 Bacteria 1215
121 Ga0395898_0020075 3300037466 Bacteria 6790
122 Ga0395898_0139942 3300037466 Bacteria 2317
123 Ga0395905_0115820 3300037471 Bacteria 2519
124 Ga0395901_0819223 3300038443 Bacteria 918
125 Ga0466969_0001800 3300044656 Bacteria 11430
126 Ga0466969_0022012 3300044656 Bacteria 3294
127 Ga0466969_0101585 3300044656 Bacteria 1353
128 Ga0466965_0035033 3300044683 Bacteria 2458
129 Ga0466966_0071256 3300044684 Bacteria 2178
130 Ga0466961_0005664 3300044693 Bacteria 7894
131 Ga0466961_0035386 3300044693 Bacteria 3207
132 Ga0466961_0124589 3300044693 Bacteria 1617
133 Ga0466963_0001173 3300044694 Bacteria 13751
134 Ga0466963_0009763 3300044694 Bacteria 5789
135 Ga0466963_0018595 3300044694 Bacteria 4347
136 Ga0466963_0019348 3300044694 Bacteria 4268
137 Ga0466963_0036213 3300044694 Bacteria 3218
138 Ga0466963_0046963 3300044694 Bacteria 2849
139 Ga0466963_0055675 3300044694 Bacteria 2630
140 Ga0466963_0099042 3300044694 Bacteria 1993
141 Ga0466963_0439420 3300044694 Unclassified 920
142 Ga0466964_0009247 3300044706 Bacteria 3707
143 Ga0466964_0010640 3300044706 Bacteria 3470
144 Ga0466964_0030448 3300044706 Bacteria 2136
145 Ga0466964_0035793 3300044706 Bacteria 1987
146 Ga0466971_0007276 3300044719 Bacteria 4819
147 Ga0466971_0017453 3300044719 Bacteria 3175
148 Ga0466968_0003248 3300044735 Bacteria 5989
149 Ga0466968_0025664 3300044735 Bacteria 2414
150 Ga0466968_0061773 3300044735 Bacteria 1616
151 Ga0466970_0095513 3300044765 Bacteria 1616
152 Ga0466957_0002965 3300044842 Bacteria 9207
153 Ga0466957_0025369 3300044842 Bacteria 3513
154 Ga0466957_0050771 3300044842 Bacteria 2524
155 Ga0466957_0063879 3300044842 Bacteria 2264
156 Ga0466960_0002415 3300044901 Bacteria 7044
157 Ga0466960_0030888 3300044901 Bacteria 2468
158 Ga0466959_0017268 3300045049 Bacteria 5287
159 Ga0466959_0033709 3300045049 Bacteria 3786
160 Ga0466959_0044962 3300045049 Bacteria 3253
161 Ga0466959_0094885 3300045049 Bacteria 2139
162 Ga0466959_0168331 3300045049 Bacteria 1538
163 Ga0466959_0200918 3300045049 Bacteria 1388
164 Ga0466958_0002756 3300045836 Bacteria 8921
165 Ga0466958_0004037 3300045836 Bacteria 7700
166 Ga0466958_0005405 3300045836 Bacteria 6868
167 Ga0466958_0010300 3300045836 Bacteria 5233
168 Ga0466958_0026389 3300045836 Bacteria 3433
169 Ga0466958_0064474 3300045836 Bacteria 2234
170 Ga0466958_0174125 3300045836 Unclassified 1364
171 Ga0466958_0408182 3300045836 Bacteria 877
172 Ga0466967_0014311 3300045976 Bacteria 6174
173 Ga0466967_0027884 3300045976 Bacteria 4705
174 Ga0466967_0033593 3300045976 Bacteria 4344
175 Ga0466967_0037252 3300045976 Bacteria 4160
176 Ga0466967_0042969 3300045976 Bacteria 3911
177 Ga0466967_0049842 3300045976 Bacteria 3664
178 Ga0466967_0050521 3300045976 Bacteria 3641
179 Ga0466967_0054083 3300045976 Bacteria 3531
180 Ga0466967_0082092 3300045976 Bacteria 2912
181 Ga0466967_0184924 3300045976 Bacteria 1967
182 Ga0466967_0237764 3300045976 Bacteria 1736
183 Ga0466967_0307394 3300045976 Bacteria 1526
184 Ga0466967_0341824 3300045976 Bacteria 1447
185 Ga0466967_0367905 3300045976 Bacteria 1394
186 Ga0466967_0521146 3300045976 Bacteria 1168
187 Ga0495592_0000124 3300046454 Bacteria 68396
188 Ga0495592_0064211 3300046454 Bacteria 2691
189 Ga0495592_0080578 3300046454 Bacteria 2355
190 Ga0495629_0033811 3300046459 Bacteria 3615
191 Ga0495641_0017754 3300046461 Bacteria 3696
192 Ga0495641_0035618 3300046461 Bacteria 2344
193 Ga0495651_0000310 3300046462 Bacteria 37941
194 Ga0495651_0039770 3300046462 Bacteria 3659
195 Ga0495651_0119170 3300046462 Bacteria 1941
196 Ga0495653_0000599 3300046463 Bacteria 27664
197 Ga0495653_0023897 3300046463 Bacteria 4932
198 Ga0495653_0249689 3300046463 Bacteria 1178
199 Ga0495653_0313296 3300046463 Unclassified 1019
200 Ga0495653_0454637 3300046463 Bacteria 805
201 Ga0495582_0069709 3300046473 Bacteria 1944
202 Ga0495664_0126322 3300046477 Bacteria 1547
203 Ga0495664_0234507 3300046477 Bacteria 1110
204 Ga0495608_0001941 3300046511 Bacteria 14842
205 Ga0495608_0222872 3300046511 Bacteria 1182
206 Ga0495618_0000808 3300046514 Bacteria 21809
207 Ga0495618_0060501 3300046514 Bacteria 2401
208 Ga0495628_0000436 3300046516 Bacteria 37941
209 Ga0495628_0036430 3300046516 Bacteria 3948
210 Ga0495652_0000050 3300046529 Bacteria 120480
211 Ga0495652_0050167 3300046529 Bacteria 3569
212 Ga0495652_0313277 3300046529 Bacteria 1136
213 Ga0495640_0072229 3300046533 Bacteria 2312
214 Ga0495640_0198565 3300046533 Bacteria 1272
215 Ga0495586_0080500 3300046535 Bacteria 1789
216 Ga0495587_0000084 3300046536 Bacteria 72926
217 Ga0495587_0047593 3300046536 Bacteria 2542
218 Ga0495645_0000067 3300046543 Bacteria 73037
219 Ga0495667_0010892 3300046559 Bacteria 6148
220 Ga0495667_0177121 3300046559 Bacteria 1369
221 Ga0495634_0159748 3300046642 Bacteria 1421
222 Ga0495635_0027473 3300046663 Bacteria 3958
223 Ga0495635_0032197 3300046663 Bacteria 3638
224 Ga0495635_0062136 3300046663 Bacteria 2564
225 Ga0495635_0394380 3300046663 Bacteria 920
226 Ga0495657_0018205 3300046675 Bacteria 5089
227 Ga0495657_0089657 3300046675 Bacteria 1975
228 Ga0495599_0000009 3300046678 Bacteria 217299
229 Ga0495599_0162358 3300046678 Bacteria 1381
230 Ga0495599_0195174 3300046678 Bacteria 1244
231 Ga0495623_0000264 3300046679 Bacteria 33990
232 Ga0495623_0067967 3300046679 Bacteria 2223
233 Ga0495646_0082433 3300046680 Bacteria 1871
234 Ga0495646_0110833 3300046680 Bacteria 1563
235 Ga0495658_0249316 3300046683 Bacteria 1116
236 Ga0495613_0027316 3300046689 Bacteria 4247
237 Ga0495613_0427062 3300046689 Bacteria 901
238 Ga0495604_0000608 3300047317 Bacteria 30795
239 Ga0495604_0088468 3300047317 Bacteria 2304
240 Ga0495604_0443340 3300047317 Bacteria 849
241 Ga0495674_0112937 3300047319 Bacteria 2301
242 Ga0495674_0391908 3300047319 Bacteria 1122
243 Ga0495680_0016707 3300047322 Bacteria 6295
244 Ga0495680_0283886 3300047322 Bacteria 1166
245 Ga0495675_0000363 3300047444 Bacteria 31622
246 Ga0495684_0029832 3300047471 Bacteria 4186
247 Ga0495684_0095578 3300047471 Bacteria 2249
248 Ga0495684_0208136 3300047471 Bacteria 1439
249 Ga0495602_0000234 3300048088 Bacteria 51947
250 Ga0495602_0040264 3300048088 Bacteria 4289
251 Ga0496101_0010589 3300048904 Bacteria 6091
252 Ga0496101_0017975 3300048904 Bacteria 4800
253 Ga0496101_0506330 3300048904 Bacteria 954
254 Ga0496102_0077309 3300048905 Bacteria 3063
255 Ga0496104_0028823 3300048907 Bacteria 5146
256 Ga0496104_0222509 3300048907 Bacteria 1800
257 Ga0496105_0005165 3300048908 Bacteria 9898
258 Ga0496105_0005678 3300048908 Bacteria 9494
259 Ga0496106_0069708 3300048909 Bacteria 2684
260 Ga0496107_0007966 3300048910 Bacteria 7313
261 Ga0496107_0010721 3300048910 Bacteria 6374
262 Ga0496107_0116476 3300048910 Unclassified 1967
263 Ga0496108_0001117 3300048911 Bacteria 21001
264 Ga0496108_0042100 3300048911 Bacteria 3812
265 Ga0496108_0044984 3300048911 Bacteria 3686
266 Ga0496109_0001252 3300048912 Bacteria 21083
267 Ga0496109_0241613 3300048912 Bacteria 1699
268 Ga0496110_0004002 3300048913 Bacteria 11354
269 Ga0496111_0049360 3300048914 Bacteria 3034
270 Ga0496111_0134742 3300048914 Bacteria 1829
271 Ga0496112_0017450 3300048915 Bacteria 6743
272 Ga0496112_0133949 3300048915 Bacteria 2448
273 Ga0496112_0186170 3300048915 Bacteria 2039
274 Ga0496112_0730351 3300048915 Bacteria 917
275 Ga0496113_0087328 3300048916 Bacteria 2398
276 Ga0496113_0235104 3300048916 Bacteria 1462
277 Ga0496114_0010423 3300048917 Bacteria 7394
278 Ga0496114_0073196 3300048917 Bacteria 2883
279 Ga0496115_0061527 3300048918 Bacteria 3026
280 Ga0501067_0049217 3300049583 Bacteria 2336
281 Ga0501067_0161155 3300049583 Bacteria 1249
282 Ga0501069_0049487 3300049585 Bacteria 2336
283 Ga0501074_0087294 3300049590 Bacteria 2234
284 nmdc:mga0n895_252133_c1 3300050512 Bacteria 1791
285 Ga0495601_0003551 3300053077 Bacteria 8964
286 Ga0495612_0049378 3300053078 Unclassified 1726
287 Ga0495595_0007037 3300053084 Bacteria 4595
288 Ga0495595_0007126 3300053084 Bacteria 4570
289 Ga0495595_0020352 3300053084 Bacteria 2888
290 Ga0495595_0064183 3300053084 Bacteria 1725
291 Ga0495595_0210736 3300053084 Bacteria 968
292 Ga0495619_0003374 3300053085 Bacteria 10327
293 Ga0495619_0050008 3300053085 Bacteria 2758
294 Ga0495619_0059294 3300053085 Bacteria 2542
295 Ga0495619_0116136 3300053085 Bacteria 1832
296 Ga0495619_0171844 3300053085 Bacteria 1499
297 Ga0495619_0220047 3300053085 Bacteria 1315
298 Ga0466962_0004082 3300061719 Bacteria 6993
299 Ga0466962_0054255 3300061719 Bacteria 1915
300 Ga0466962_0096569 3300061719 Bacteria 1417
301 Ga0070680_100042696
302 Ga0070658_10005067
303 Ga0070680_100089010
304 Ga0070682_100041980
305 Ga0070660_100017918
306 Ga0070660_100020585
307 Ga0070661_100030879
308 Ga0070659_100015334
309 Ga0070709_10003335
310 Ga0070714_100006899
311 Ga0070714_100033653
312 Ga0070714_100052149
313 Ga0070714_100137500
314 Ga0070713_100013174
315 Ga0070710_10001370
316 Ga0070710_10006594
317 Ga0070710_10449878
318 Ga0070711_100010962
319 Ga0070711_100061826
320 Ga0070681_10011999
321 Ga0070681_10082958
322 Ga0070681_10233054
323 Ga0070706_100199300
324 Ga0070679_100258799
325 Ga0070679_100264108
326 Ga0070679_100340014
327 Ga0070684_100188837
328 Ga0070684_100343957
329 Ga0070697_100504660
330 Ga0068853_100268242
331 Ga0070695_100000005
332 Ga0070693_100457760
333 Ga0068855_100031278
334 Ga0068855_100618463
335 Ga0070664_100098349
336 Ga0068856_100020050
337 Ga0068852_100058841
338 Ga0068852_100394624
339 Ga0068858_100786318
340 Ga0070717_10030275
341 Ga0070717_10102185
342 Ga0070717_10193630
343 Ga0070715_10000878
344 Ga0070716_100010653
345 Ga0070712_100048281
346 Ga0075434_100314810
347 Ga0105240_10010278
348 Ga0105240_10014851
349 Ga0105247_10081813
350 Ga0157371_10518171
351 Ga0157370_10007418
352 Ga0157369_10114126
353 Ga0157369_10129314
354 Ga0157374_10186196
355 Ga0157372_10021807
356 Ga0157372_10953180
357 Ga0157379_10452385
358 Ga0182006_1028491
359 Ga0206356_11065317
360 Ga0206356_11509181
361 Ga0206353_10795244
362 Ga0206353_11066925
363 Ga0207692_10003990
364 Ga0207685_10004562
365 Ga0207699_10038869
366 Ga0207699_10105045
367 Ga0207705_10006869
368 Ga0207684_10129945
369 Ga0207707_10057034
370 Ga0207707_10505608
371 Ga0207695_10024627
372 Ga0207695_10120995
373 Ga0207671_10196781
374 Ga0207693_10000954
375 Ga0207693_10005241
376 Ga0207693_10444613
377 Ga0207663_10009167
378 Ga0207663_10094841
379 Ga0207660_10189087
380 Ga0207657_10004535
381 Ga0207657_10026303
382 Ga0207657_10081416
383 Ga0207649_10639296
384 Ga0207652_10206940
385 Ga0207646_10046329
386 Ga0207646_10244186
387 Ga0207687_10304657
388 Ga0207664_10002601
389 Ga0207664_10009608
390 Ga0207664_10019828
391 Ga0207664_10020312
392 Ga0207664_10038660
393 Ga0207664_10050295
394 Ga0207664_10128887
395 Ga0207664_10194466
396 Ga0207665_10000298
397 Ga0207661_10471198
398 Ga0207679_10257117
399 Ga0207667_10037383
400 Ga0207667_10367983
401 Ga0207639_10246234
402 Ga0207702_10092517
403 Ga0207698_10210111
404 Ga0265319_1021173
405 Ga0265334_10043323
406 Ga0265336_10028129
407 Ga0265338_10006090
408 Ga0265338_10009372
409 Ga0265338_10016384
410 Ga0265338_10187767
411 Ga0265324_10010955
412 Ga0265327_10011974
413 Ga0265327_10061541
414 Ga0265313_10015798
415 Ga0265342_10177303
416 Ga0373960_0021697
417 Ga0373933_0046650
418 Ga0373937_0001125
419 Ga0373937_0390088
420 Ga0395900_0467440
421 Ga0395898_0020075
422 Ga0395898_0139942
423 Ga0395905_0115820
424 Ga0395901_0819223
425 Ga0466969_0001800
426 Ga0466969_0022012
427 Ga0466969_0101585
428 Ga0466965_0035033
429 Ga0466966_0071256
430 Ga0466961_0005664
431 Ga0466961_0035386
432 Ga0466961_0124589
433 Ga0466963_0001173
434 Ga0466963_0009763
435 Ga0466963_0018595
436 Ga0466963_0019348
437 Ga0466963_0036213
438 Ga0466963_0046963
439 Ga0466963_0055675
440 Ga0466963_0099042
441 Ga0466963_0439420
442 Ga0466964_0009247
443 Ga0466964_0010640
444 Ga0466964_0030448
445 Ga0466964_0035793
446 Ga0466971_0007276
447 Ga0466971_0017453
448 Ga0466968_0003248
449 Ga0466968_0025664
450 Ga0466968_0061773
451 Ga0466970_0095513
452 Ga0466957_0002965
453 Ga0466957_0025369
454 Ga0466957_0050771
455 Ga0466957_0063879
456 Ga0466960_0002415
457 Ga0466960_0030888
458 Ga0466959_0017268
459 Ga0466959_0033709
460 Ga0466959_0044962
461 Ga0466959_0094885
462 Ga0466959_0168331
463 Ga0466959_0200918
464 Ga0466958_0002756
465 Ga0466958_0004037
466 Ga0466958_0005405
467 Ga0466958_0010300
468 Ga0466958_0026389
469 Ga0466958_0064474
470 Ga0466958_0174125
471 Ga0466958_0408182
472 Ga0466967_0014311
473 Ga0466967_0027884
474 Ga0466967_0033593
475 Ga0466967_0037252
476 Ga0466967_0042969
477 Ga0466967_0049842
478 Ga0466967_0050521
479 Ga0466967_0054083
480 Ga0466967_0082092
481 Ga0466967_0184924
482 Ga0466967_0237764
483 Ga0466967_0307394
484 Ga0466967_0341824
485 Ga0466967_0367905
486 Ga0466967_0521146
487 Ga0495592_0000124
488 Ga0495592_0064211
489 Ga0495592_0080578
490 Ga0495629_0033811
491 Ga0495641_0017754
492 Ga0495641_0035618
493 Ga0495651_0000310
494 Ga0495651_0039770
495 Ga0495651_0119170
496 Ga0495653_0000599
497 Ga0495653_0023897
498 Ga0495653_0249689
499 Ga0495653_0313296
500 Ga0495653_0454637
501 Ga0495582_0069709
502 Ga0495664_0126322
503 Ga0495664_0234507
504 Ga0495608_0001941
505 Ga0495608_0222872
506 Ga0495618_0000808
507 Ga0495618_0060501
508 Ga0495628_0000436
509 Ga0495628_0036430
510 Ga0495652_0000050
511 Ga0495652_0050167
512 Ga0495652_0313277
513 Ga0495640_0072229
514 Ga0495640_0198565
515 Ga0495586_0080500
516 Ga0495587_0000084
517 Ga0495587_0047593
518 Ga0495645_0000067
519 Ga0495667_0010892
520 Ga0495667_0177121
521 Ga0495634_0159748
522 Ga0495635_0027473
523 Ga0495635_0032197
524 Ga0495635_0062136
525 Ga0495635_0394380
526 Ga0495657_0018205
527 Ga0495657_0089657
528 Ga0495599_0000009
529 Ga0495599_0162358
530 Ga0495599_0195174
531 Ga0495623_0000264
532 Ga0495623_0067967
533 Ga0495646_0082433
534 Ga0495646_0110833
535 Ga0495658_0249316
536 Ga0495613_0027316
537 Ga0495613_0427062
538 Ga0495604_0000608
539 Ga0495604_0088468
540 Ga0495604_0443340
541 Ga0495674_0112937
542 Ga0495674_0391908
543 Ga0495680_0016707
544 Ga0495680_0283886
545 Ga0495675_0000363
546 Ga0495684_0029832
547 Ga0495684_0095578
548 Ga0495684_0208136
549 Ga0495602_0000234
550 Ga0495602_0040264
551 Ga0496101_0010589
552 Ga0496101_0017975
553 Ga0496101_0506330
554 Ga0496102_0077309
555 Ga0496104_0028823
556 Ga0496104_0222509
557 Ga0496105_0005165
558 Ga0496105_0005678
559 Ga0496106_0069708
560 Ga0496107_0007966
561 Ga0496107_0010721
562 Ga0496107_0116476
563 Ga0496108_0001117
564 Ga0496108_0042100
565 Ga0496108_0044984
566 Ga0496109_0001252
567 Ga0496109_0241613
568 Ga0496110_0004002
569 Ga0496111_0049360
570 Ga0496111_0134742
571 Ga0496112_0017450
572 Ga0496112_0133949
573 Ga0496112_0186170
574 Ga0496112_0730351
575 Ga0496113_0087328
576 Ga0496113_0235104
577 Ga0496114_0010423
578 Ga0496114_0073196
579 Ga0496115_0061527
580 Ga0501067_0049217
581 Ga0501067_0161155
582 Ga0501069_0049487
583 Ga0501074_0087294
584 nmdc:mga0n895_252133_c1
585 Ga0495601_0003551
586 Ga0495612_0049378
587 Ga0495595_0007037
588 Ga0495595_0007126
589 Ga0495595_0020352
590 Ga0495595_0064183
591 Ga0495595_0210736
592 Ga0495619_0003374
593 Ga0495619_0050008
594 Ga0495619_0059294
595 Ga0495619_0116136
596 Ga0495619_0171844
597 Ga0495619_0220047
598 Ga0466962_0004082
599 Ga0466962_0054255
600 Ga0466962_0096569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

2

241

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9185 4 237
1yix-assembly2.cif.gz_B crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution 0.9146 1 236
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9123 1 235
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9122 4 237
1yix-assembly2.cif.gz_B crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution 0.9073 1 236
ID Description Score Start End Superfamily
af_O81787_59_161_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.9547 209 233 1.10.472.10
af_Q54KD6_54_339_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9211 7 237 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9185 4 237 3.20.20.140
af_P0AFQ7_2_265_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.915 1 236 3.20.20.140
af_O08343_1_262_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9132 1 237 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A538ICX7-F1-model_v4 TatD family deoxyribonuclease 0.9565 1 172 GO:0005829
GO:0016788
AF-A0A7C3YLZ0-F1-model_v4 TatD family deoxyribonuclease 0.9483 35 237 GO:0004536
GO:0005829
GO:0046872
AF-A0A3B9QH37-F1-model_v4 Hydrolase TatD 0.9481 16 186 GO:0005829
GO:0016788
GO:0046872
AF-A0A523VEX0-F1-model_v4 TatD family deoxyribonuclease 0.9469 19 237 GO:0004536
GO:0005829
GO:0046872
AF-A0A538GT88-F1-model_v4 TatD family deoxyribonuclease 0.9463 1 237 GO:0004536
GO:0005829
GO:0046872

Map