F395084

General Info

Members Datasets Scaffolds Average Seq Length
299 224 282 188

Family's Representative Sequence

Representative Sequence 3300053086|Ga0500578_0000045|Ga0500578_0000045_96912_97565
Length 217
Sequence MASNVGAYLERFFPSGATYDQLDDDADADPVAVQERWLKTYYFARVAFSAVWVAAAFTIGDAYSFVGAVLLVIYPLWDAAANLVDAQRSGGLANNQTQAINLLVSLATTIVVLIAVMINMHWVLGVYGAWAILSGLMQLGSAVRRWRTAGAQWAMILSGAQSALAGGFFVFQATQAPEPSIKNIAGYAAFGAFYFFISALWLTVKGLRAQKPNNDGF

Samples

Sample ID Description Type Environment
1 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
2 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
3 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
4 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
5 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
6 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
7 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
8 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
9 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
10 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
11 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
12 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
13 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
14 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
15 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
25 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
66 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
67 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
68 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
69 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
107 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
217 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
218 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
221 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
224 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.65
Metatranscriptomes 0.33
Isolates 6.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.07
Nodule 6.35
Rhizoplane 3.01
Rhizosphere 60.87
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10073166 3300002067 Bacteria 982
2 JGI24735J21928_10076014 3300002067 Bacteria 962
3 JGI25156J39149_1000431 3300002705 Bacteria 25952
4 JGI25165J46597_1001109 3300003214 Bacteria 17051
5 rootH1_10086197 3300003316 Bacteria 5809
6 rootH1_10086197 3300003323 Bacteria 2597
7 rootL2_10073279 3300003322 Bacteria 1634
8 rootH1_10169646 3300003323 Bacteria 3032
9 Ga0007410J51695_1046823 3300003574 Bacteria 1275
10 Ga0055533_1000070 3300003756 Bacteria 153414
11 Ga0055532_1000011 3300003758 Bacteria 385294
12 Ga0055527_1000009 3300003760 Bacteria 385294
13 Ga0055535_1000008 3300003761 Bacteria 385294
14 Ga0055542_1000014 3300003762 Bacteria 385294
15 Ga0055529_1000010 3300003763 Bacteria 385294
16 Ga0055524_1000003 3300003775 Bacteria 399748
17 Ga0055531_10003284 3300003794 Bacteria 10362
18 Ga0065165_1009831 3300005262 Bacteria 4224
19 Ga0065165_1021870 3300005262 Bacteria 2210
20 Ga0070658_10329964 3300005327 Bacteria 1304
21 Ga0070670_100290396 3300005331 Bacteria 1429
22 Ga0070661_100685946 3300005344 Bacteria 834
23 Ga0070671_100151476 3300005355 Bacteria 1958
24 Ga0070671_100430890 3300005355 Bacteria 1130
25 Ga0070667_100121044 3300005367 Bacteria 2276
26 Ga0070667_100356054 3300005367 Bacteria 1326
27 Ga0070663_100159229 3300005455 Bacteria 1737
28 Ga0070665_100127655 3300005548 Bacteria 2546
29 Ga0070665_100491751 3300005548 Bacteria 1238
30 Ga0070664_100655007 3300005564 Bacteria 976
31 Ga0068856_100337289 3300005614 Bacteria 1525
32 Ga0068856_100931098 3300005614 Bacteria 888
33 Ga0068859_100517949 3300005617 Bacteria 1288
34 Ga0068864_100156170 3300005618 Bacteria 2071
35 Ga0068864_100566949 3300005618 Bacteria 1099
36 Ga0068851_10374483 3300005834 Bacteria 833
37 Ga0075368_10008206 3300006042 Bacteria 3711
38 Ga0075363_100249886 3300006048 Bacteria 1021
39 Ga0075364_10196066 3300006051 Bacteria 1368
40 Ga0075362_10015020 3300006177 Bacteria 3140
41 Ga0075367_10147695 3300006178 Bacteria 1458
42 Ga0075366_10018076 3300006195 Bacteria 4070
43 Ga0075370_10112199 3300006353 Bacteria 1584
44 Ga0075370_10129102 3300006353 Bacteria 1474
45 Ga0097620_100517942 3300006931 Bacteria 1288
46 Ga0099826_10000002 3300006948 Bacteria 1125830
47 Ga0105240_10001536 3300009093 Bacteria 39156
48 Ga0105247_10058862 3300009101 Bacteria 2377
49 Ga0105248_10174457 3300009177 Bacteria 2423
50 Ga0105248_10178745 3300009177 Bacteria 2391
51 Ga0105237_10046126 3300009545 Bacteria 4384
52 Ga0105237_10910639 3300009545 Bacteria 886
53 Ga0105238_10136097 3300009551 Bacteria 2434
54 Ga0105238_10219217 3300009551 Bacteria 1878
55 Ga0105246_10123413 3300011119 Bacteria 1923
56 Ga0157369_10470807 3300013105 Bacteria 1300
57 Ga0157369_10921527 3300013105 Bacteria 896
58 Ga0157374_10026095 3300013296 Bacteria 5254
59 Ga0157374_10036608 3300013296 Bacteria 4496
60 Ga0163162_10646441 3300013306 Bacteria 1181
61 Ga0157372_10750974 3300013307 Bacteria 1134
62 Ga0163163_10073974 3300014325 Bacteria 3398
63 Ga0157379_10212356 3300014968 Bacteria 1752
64 Ga0214544_1000002 3300021320 Bacteria 753857
65 Ga0214542_1000001 3300021321 Bacteria 1018696
66 Ga0214545_1000001 3300021324 Bacteria 1092817
67 Ga0214543_1000001 3300021327 Bacteria 776921
68 Ga0209674_100011 3300025226 Bacteria 997175
69 Ga0209672_100002 3300025228 Bacteria 1733325
70 Ga0209147_100003 3300025229 Bacteria 1733325
71 Ga0209563_101617 3300025230 Bacteria 5829
72 Ga0209563_103494 3300025230 Bacteria 3231
73 Ga0207427_100540 3300025231 Bacteria 19616
74 Ga0209258_100005 3300025242 Bacteria 1087938
75 Ga0209677_110901 3300025253 Bacteria 1468
76 Ga0209148_1000006 3300025254 Bacteria 1733325
77 Ga0209759_1000006 3300025256 Bacteria 492407
78 Ga0209233_1000018 3300025261 Bacteria 886857
79 Ga0209565_1006157 3300025263 Bacteria 3398
80 Ga0209455_1000003 3300025272 Bacteria 1471893
81 Ga0209675_1043646 3300025291 Bacteria 963
82 Ga0209564_1049647 3300025295 Bacteria 1036
83 Ga0209564_1073065 3300025295 Bacteria 703
84 Ga0209758_1000140 3300025297 Bacteria 174267
85 Ga0209758_1004273 3300025297 Bacteria 12065
86 Ga0209758_1050461 3300025297 Bacteria 1458
87 Ga0209758_1115475 3300025297 Unclassified 734
88 Ga0209256_1000007 3300025299 Bacteria 1136599
89 Ga0207426_1030310 3300025302 Bacteria 1775
90 Ga0209257_1000522 3300025304 Bacteria 66723
91 Ga0209257_1004329 3300025304 Bacteria 11121
92 Ga0209257_1013587 3300025304 Bacteria 3601
93 Ga0207697_10050788 3300025315 Bacteria 1713
94 Ga0207710_10041158 3300025900 Bacteria 2048
95 Ga0207680_10471361 3300025903 Bacteria 892
96 Ga0207647_10032800 3300025904 Bacteria 3332
97 Ga0207695_10001518 3300025913 Bacteria 38528
98 Ga0207671_10130960 3300025914 Bacteria 1925
99 Ga0207650_10220666 3300025925 Bacteria 1526
100 Ga0207709_10475836 3300025935 Bacteria 970
101 Ga0207658_10083633 3300025986 Bacteria 2454
102 Ga0207702_10448281 3300026078 Bacteria 1252
103 Ga0207641_10376675 3300026088 Bacteria 1358
104 Ga0207676_10113073 3300026095 Bacteria 2276
105 Ga0209282_1000001 3300027666 Bacteria 2450367
106 Ga0209813_10065891 3300027866 Bacteria 1167
107 Ga0268266_10177829 3300028379 Bacteria 1935
108 Ga0268266_10491049 3300028379 Bacteria 1171
109 Ga0268266_10823450 3300028379 Bacteria 897
110 Ga0307512_10228441 3300030522 Bacteria 960
111 Ga0307513_10101432 3300031456 Bacteria 2899
112 Ga0307509_10002906 3300031507 Bacteria 27071
113 Ga0307510_10066798 3300033180 Bacteria 3627
114 Ga0439465_0157284 3300041413 Bacteria 814
115 Ga0451841_0401942 3300041498 Bacteria 980
116 Ga0451853_0270099 3300041512 Bacteria 2442
117 Ga0466982_0279223 3300044672 Bacteria 963
118 Ga0466958_0036134 3300045836 Bacteria 2956
119 Ga0495617_161554 3300046452 Bacteria 710
120 Ga0495592_0000322 3300046454 Bacteria 40072
121 Ga0495592_0483442 3300046454 Bacteria 771
122 Ga0495590_0000099 3300046457 Bacteria 52654
123 Ga0495629_0647136 3300046459 Bacteria 704
124 Ga0495653_0008463 3300046463 Bacteria 8436
125 Ga0495653_0073214 3300046463 Bacteria 2557
126 Ga0495650_0021080 3300046471 Bacteria 3159
127 Ga0495650_0028726 3300046471 Bacteria 2546
128 Ga0495580_0001487 3300046472 Bacteria 20578
129 Ga0495582_0006663 3300046473 Bacteria 6416
130 Ga0495582_0010701 3300046473 Bacteria 5046
131 Ga0495662_0072874 3300046476 Bacteria 1666
132 Ga0495664_0000188 3300046477 Bacteria 30394
133 Ga0495664_0125239 3300046477 Bacteria 1554
134 Ga0495584_0000101 3300046491 Bacteria 57700
135 Ga0495585_0091291 3300046492 Bacteria 1640
136 Ga0495596_0000094 3300046500 Bacteria 62938
137 Ga0495596_0006590 3300046500 Bacteria 5325
138 Ga0495607_0051569 3300046501 Bacteria 2388
139 Ga0495606_0001141 3300046507 Bacteria 37735
140 Ga0495606_0001224 3300046507 Bacteria 35940
141 Ga0495606_0004183 3300046507 Bacteria 14621
142 Ga0495606_0042242 3300046507 Bacteria 3051
143 Ga0495606_0054910 3300046507 Bacteria 2578
144 Ga0495606_0056210 3300046507 Bacteria 2541
145 Ga0495606_0268944 3300046507 Bacteria 937
146 Ga0495616_0152407 3300046513 Bacteria 1045
147 Ga0495616_0319357 3300046513 Bacteria 652
148 Ga0495618_0001351 3300046514 Bacteria 16490
149 Ga0495618_0444496 3300046514 Bacteria 787
150 Ga0495620_0068616 3300046515 Bacteria 1456
151 Ga0495628_0001732 3300046516 Bacteria 19860
152 Ga0495628_0002801 3300046516 Bacteria 15649
153 Ga0495628_0062239 3300046516 Bacteria 2925
154 Ga0495628_0219119 3300046516 Bacteria 1429
155 Ga0495630_0022675 3300046517 Bacteria 4637
156 Ga0495632_0044591 3300046519 Bacteria 2213
157 Ga0495643_0066760 3300046522 Bacteria 1896
158 Ga0495648_0001271 3300046524 Bacteria 25153
159 Ga0495648_0060353 3300046524 Bacteria 2257
160 Ga0495648_0173276 3300046524 Bacteria 1104
161 Ga0495663_0219102 3300046525 Bacteria 668
162 Ga0495666_0000335 3300046526 Bacteria 20557
163 Ga0495652_0072487 3300046529 Bacteria 2870
164 Ga0495665_0002423 3300046531 Bacteria 10080
165 Ga0495665_0034311 3300046531 Bacteria 2712
166 Ga0495640_0002769 3300046533 Bacteria 14103
167 Ga0495640_0113536 3300046533 Bacteria 1767
168 Ga0495586_0000616 3300046535 Bacteria 20577
169 Ga0495586_0012807 3300046535 Bacteria 4445
170 Ga0495587_0008374 3300046536 Bacteria 6653
171 Ga0495597_0002434 3300046542 Bacteria 11806
172 Ga0495597_0051039 3300046542 Bacteria 1824
173 Ga0495645_0003450 3300046543 Bacteria 10721
174 Ga0495633_0000449 3300046558 Bacteria 42373
175 Ga0495667_0017105 3300046559 Bacteria 4897
176 Ga0495667_0385509 3300046559 Bacteria 884
177 Ga0495634_0003611 3300046642 Bacteria 12356
178 Ga0495634_0009448 3300046642 Bacteria 7191
179 Ga0495611_0337780 3300046648 Bacteria 692
180 Ga0495625_0153843 3300046660 Bacteria 1545
181 Ga0495635_0009569 3300046663 Bacteria 6772
182 Ga0495635_0403009 3300046663 Bacteria 908
183 Ga0495661_0001659 3300046665 Bacteria 18142
184 Ga0495599_0163835 3300046678 Bacteria 1374
185 Ga0495599_0385338 3300046678 Bacteria 836
186 Ga0495623_0356163 3300046679 Bacteria 796
187 Ga0495646_0001418 3300046680 Bacteria 14248
188 Ga0495646_0022957 3300046680 Bacteria 3929
189 Ga0495613_0002909 3300046689 Bacteria 12825
190 Ga0495624_0011116 3300046690 Bacteria 6191
191 Ga0495670_0047815 3300046691 Bacteria 2139
192 Ga0495589_0000033 3300046794 Bacteria 162794
193 Ga0495600_0033852 3300046809 Bacteria 3317
194 Ga0495581_0000739 3300047315 Bacteria 17317
195 Ga0495581_0007022 3300047315 Bacteria 6526
196 Ga0495604_0002010 3300047317 Bacteria 16396
197 Ga0495604_0171120 3300047317 Bacteria 1527
198 Ga0495604_0233205 3300047317 Bacteria 1261
199 Ga0495674_0011275 3300047319 Bacteria 8438
200 Ga0495676_0001635 3300047321 Bacteria 19509
201 Ga0495680_0037285 3300047322 Bacteria 3894
202 Ga0495680_0112233 3300047322 Bacteria 2019
203 Ga0495683_0067867 3300047323 Bacteria 1755
204 Ga0495687_000017 3300047443 Bacteria 350429
205 Ga0495687_000190 3300047443 Bacteria 89269
206 Ga0495687_041280 3300047443 Bacteria 2025
207 Ga0495687_164376 3300047443 Bacteria 742
208 Ga0495675_0009994 3300047444 Bacteria 5919
209 Ga0495679_000955 3300047446 Bacteria 17946
210 Ga0495684_0036880 3300047471 Bacteria 3748
211 Ga0495684_0471476 3300047471 Bacteria 868
212 Ga0495686_0000456 3300047472 Bacteria 61394
213 Ga0495686_0000811 3300047472 Bacteria 40468
214 Ga0495593_0003322 3300047673 Bacteria 9645
215 Ga0495602_0005930 3300048088 Bacteria 12818
216 Ga0495614_0000420 3300048089 Bacteria 17434
217 Ga0495614_0008201 3300048089 Bacteria 4646
218 Ga0496102_0206667 3300048905 Bacteria 1851
219 Ga0496102_0263311 3300048905 Bacteria 1625
220 Ga0496102_0376389 3300048905 Bacteria 1336
221 Ga0496102_0549838 3300048905 Bacteria 1077
222 Ga0496103_0054846 3300048906 Bacteria 2471
223 Ga0496103_0089623 3300048906 Bacteria 1940
224 Ga0496103_0509962 3300048906 Bacteria 769
225 Ga0496108_0125310 3300048911 Bacteria 2205
226 Ga0496112_0060321 3300048915 Bacteria 3738
227 Ga0496118_0147782 3300048921 Bacteria 1476
228 Ga0496119_0051129 3300048922 Bacteria 2542
229 Ga0496121_0436373 3300048924 Bacteria 848
230 Ga0496123_0121326 3300048926 Bacteria 1470
231 Ga0496124_0260032 3300048927 Bacteria 1278
232 Ga0496125_0062009 3300048928 Bacteria 2994
233 Ga0501032_0000046 3300049569 Bacteria 109405
234 Ga0501033_0002199 3300049570 Bacteria 16832
235 Ga0501033_0246570 3300049570 Unclassified 1267
236 Ga0501034_0000160 3300049571 Bacteria 126787
237 Ga0501034_0029923 3300049571 Bacteria 5535
238 Ga0501034_0135785 3300049571 Bacteria 2441
239 Ga0501036_0000326 3300049572 Bacteria 33146
240 Ga0501037_0000309 3300049573 Bacteria 41492
241 Ga0501038_0000026 3300049574 Bacteria 146493
242 Ga0501039_0000121 3300049575 Bacteria 54152
243 Ga0501043_0000135 3300049579 Bacteria 68762
244 Ga0501046_0017900 3300049580 Bacteria 5907
245 Ga0501047_0000101 3300049581 Bacteria 104950
246 Ga0501048_0003696 3300049582 Bacteria 11656
247 Ga0501067_0318932 3300049583 Bacteria 865
248 Ga0501068_0001208 3300049584 Bacteria 13736
249 Ga0501069_0011696 3300049585 Bacteria 4652
250 Ga0501070_0000297 3300049586 Bacteria 46317
251 Ga0501073_0009720 3300049589 Bacteria 7084
252 Ga0501074_0141238 3300049590 Bacteria 1722
253 Ga0501079_0068686 3300049741 Bacteria 2735
254 Ga0501080_0000121 3300049742 Bacteria 54804
255 Ga0501269_000555 3300049766 Bacteria 7079
256 Ga0501035_0000588 3300049822 Bacteria 40021
257 Ga0501035_0039815 3300049822 Bacteria 4251
258 Ga0501044_0003949 3300049823 Bacteria 16609
259 Ga0501044_0460408 3300049823 Bacteria 1177
260 nmdc:mga03683_80967_c1 3300050489 Bacteria 1402
261 nmdc:mga03n38_155013_c1 3300050490 Bacteria 1155
262 nmdc:mga00v17_66966_c1 3300050491 Bacteria 2218
263 nmdc:mga0yw44_114003_c1 3300050492 Bacteria 1735
264 nmdc:mga0yw44_421781_c1 3300050492 Bacteria 903
265 nmdc:mga0yw44_495428_c1 3300050492 Bacteria 829
266 nmdc:mga0k408_250505_c1 3300050493 Bacteria 1058
267 nmdc:mga04h51_43697_c1 3300050495 Bacteria 1475
268 nmdc:mga07m45_285087_c1 3300050496 Bacteria 961
269 Ga0500578_0000045 3300053086 Eukaryota 127571
270 Ga0500578_0035983 3300053086 Bacteria 3181
271 Ga0500578_0068239 3300053086 Bacteria 2267
272 Ga0500643_000032 3300053087 Bacteria 200350
273 Ga0500651_0040107 3300053093 Bacteria 2949
274 Ga0500569_002090 3300053109 Bacteria 3891
275 Ga0500642_0051078 3300053130 Bacteria 1825
276 Ga0500658_0000287 3300053134 Bacteria 22856
277 Ga0500577_0211537 3300053142 Bacteria 838
278 Ga0500619_010487 3300053154 Bacteria 2346
279 Ga0500622_0075195 3300053156 Bacteria 1700
280 Ga0500634_0000009 3300053161 Bacteria 144333
281 Ga0500599_001520 3300053736 Bacteria 2681
282 Ga0501084_0104418 3300054114 Bacteria 2380

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_421781_c1 nmdc:mga0yw44_421781_c1_55_585 162
2 3300045836 Ga0466958_0036134 Ga0466958_0036134_1097_1663 165
3 3300046452 Ga0495617_161554 Ga0495617_161554_100_690 165
4 3300046524 Ga0495648_0060353 Ga0495648_0060353_1092_1682 165
5 3300053087 Ga0500643_000032 Ga0500643_000032_42007_42597 165
6 3300053130 Ga0500642_0051078 Ga0500642_0051078_45_635 165
7 3300053142 Ga0500577_0211537 Ga0500577_0211537_61_651 165
8 3300053736 Ga0500599_001520 Ga0500599_001520_452_1042 165
9 3300021320 Ga0214544_1000002 Ga0214544_1000002233 166
10 3300021321 Ga0214542_1000001 Ga0214542_1000001583 166
11 3300021324 Ga0214545_1000001 Ga0214545_1000001649 166
12 3300021327 Ga0214543_1000001 Ga0214543_1000001546 166
13 3300025295 Ga0209564_1049647 Ga0209564_10496472 166
14 3300046691 Ga0495670_0047815 Ga0495670_0047815_590_1174 166
15 3300048905 Ga0496102_0376389 Ga0496102_0376389_438_1001 166
16 3300048906 Ga0496103_0054846 Ga0496103_0054846_999_1562 166
17 3300006048 Ga0075363_100249886 Ga0075363_1002498862 168
18 3300025297 Ga0209758_1050461 Ga0209758_10504612 168
19 3300046525 Ga0495663_0219102 Ga0495663_0219102_16_606 168
20 3300050490 nmdc:mga03n38_155013_c1 nmdc:mga03n38_155013_c1_279_869 168
21 3300003794 Ga0055531_10003284 Ga0055531_100032843 169
22 3300005262 Ga0065165_1021870 Ga0065165_10218703 169
23 3300005327 Ga0070658_10329964 Ga0070658_103299641 169
24 3300005344 Ga0070661_100685946 Ga0070661_1006859461 169
25 3300005548 Ga0070665_100491751 Ga0070665_1004917512 169
26 3300005614 Ga0068856_100931098 Ga0068856_1009310981 169
27 3300005834 Ga0068851_10374483 Ga0068851_103744831 169
28 3300013105 Ga0157369_10470807 Ga0157369_104708072 169
29 3300025297 Ga0209758_1000140 Ga0209758_100014081 169
30 3300025302 Ga0207426_1030310 Ga0207426_10303103 169
31 3300025304 Ga0209257_1000522 Ga0209257_100052260 169
32 3300028379 Ga0268266_10823450 Ga0268266_108234502 169
33 3300041413 Ga0439465_0157284 Ga0439465_0157284_201_779 169
34 3300048905 Ga0496102_0206667 Ga0496102_0206667_964_1530 169
35 3300041498 Ga0451841_0401942 Ga0451841_0401942_193_771 170
36 3300046492 Ga0495585_0091291 Ga0495585_0091291_349_948 171
37 3300046507 Ga0495606_0268944 Ga0495606_0268944_146_730 171
38 3300053086 Ga0500578_0035983 Ga0500578_0035983_1987_2571 171
39 3300003322 rootL2_10073279 rootL2_100732792 172
40 3300046524 Ga0495648_0173276 Ga0495648_0173276_99_689 172
41 3300003574 Ga0007410J51695_1046823 Ga0007410J51695_10468232 173
42 3300005548 Ga0070665_100127655 Ga0070665_1001276552 173
43 3300028379 Ga0268266_10177829 Ga0268266_101778292 173
44 3300041512 Ga0451853_0270099 Ga0451853_0270099_681_1259 173
45 3300044672 Ga0466982_0279223 Ga0466982_0279223_317_889 173
46 iso_pu_bacteria 2718217997 2719665984 173
47 iso_pu_bacteria 2718218232 2720613761 173
48 iso_pu_bacteria 2721755556 2723027309 173
49 iso_pu_bacteria 2728369352 2730108245 173
50 3300046457 Ga0495590_0000099 Ga0495590_0000099_33970_34521 174
51 3300046471 Ga0495650_0021080 Ga0495650_0021080_61_663 174
52 3300046500 Ga0495596_0000094 Ga0495596_0000094_39298_39843 174
53 3300046507 Ga0495606_0004183 Ga0495606_0004183_3913_4458 174
54 3300046507 Ga0495606_0042242 Ga0495606_0042242_897_1448 174
55 3300046660 Ga0495625_0153843 Ga0495625_0153843_454_999 174
56 3300047472 Ga0495686_0000456 Ga0495686_0000456_30475_31032 174
57 3300053134 Ga0500658_0000287 Ga0500658_0000287_16647_17237 174
58 3300046491 Ga0495584_0000101 Ga0495584_0000101_56987_57562 176
59 3300046507 Ga0495606_0001224 Ga0495606_0001224_33388_33963 176
60 3300046516 Ga0495628_0001732 Ga0495628_0001732_2494_3078 176
61 3300046559 Ga0495667_0385509 Ga0495667_0385509_206_790 176
62 3300047443 Ga0495687_000190 Ga0495687_000190_47890_48465 176
63 3300047472 Ga0495686_0000811 Ga0495686_0000811_36477_37088 176
64 3300050492 nmdc:mga0yw44_495428_c1 nmdc:mga0yw44_495428_c1_176_760 176
65 3300046507 Ga0495606_0001141 Ga0495606_0001141_16404_16997 177
66 3300048905 Ga0496102_0549838 Ga0496102_0549838_438_1010 177
67 3300048906 Ga0496103_0509962 Ga0496103_0509962_21_593 177
68 3300049766 Ga0501269_000555 Ga0501269_000555_1907_2482 177
69 iso_pu_bacteria 2517093001 2517108473 177
70 iso_pu_bacteria 2517093001 2517108597 177
71 iso_pu_bacteria 2517572143 2517889500 177
72 iso_pu_bacteria 2816332527 2818244331 177
73 iso_pu_bacteria 2847939898 2847943028 177
74 iso_pu_bacteria 2929615660 2929624302 177
75 iso_pu_bacteria 2929624759 2929633569 177
76 iso_pu_bacteria 2933577622 2933586226 177
77 iso_pu_bacteria 8055742211 8055743193 177
78 3300013307 Ga0157372_10750974 Ga0157372_107509741 178
79 3300049569 Ga0501032_0000046 Ga0501032_0000046_60050_60607 178
80 3300049570 Ga0501033_0002199 Ga0501033_0002199_13285_13842 178
81 3300049571 Ga0501034_0029923 Ga0501034_0029923_4782_5339 178
82 3300049572 Ga0501036_0000326 Ga0501036_0000326_26330_26887 178
83 3300049573 Ga0501037_0000309 Ga0501037_0000309_30570_31127 178
84 3300049574 Ga0501038_0000026 Ga0501038_0000026_127635_128192 178
85 3300049575 Ga0501039_0000121 Ga0501039_0000121_15295_15852 178
86 3300049579 Ga0501043_0000135 Ga0501043_0000135_29520_30077 178
87 3300049580 Ga0501046_0017900 Ga0501046_0017900_5088_5645 178
88 3300049581 Ga0501047_0000101 Ga0501047_0000101_47594_48151 178
89 3300049582 Ga0501048_0003696 Ga0501048_0003696_426_983 178
90 3300049583 Ga0501067_0318932 Ga0501067_0318932_258_815 178
91 3300049584 Ga0501068_0001208 Ga0501068_0001208_7191_7748 178
92 3300049585 Ga0501069_0011696 Ga0501069_0011696_1530_2087 178
93 3300049586 Ga0501070_0000297 Ga0501070_0000297_44220_44777 178
94 3300049589 Ga0501073_0009720 Ga0501073_0009720_5299_5856 178
95 3300049590 Ga0501074_0141238 Ga0501074_0141238_15_572 178
96 3300049741 Ga0501079_0068686 Ga0501079_0068686_430_987 178
97 3300049742 Ga0501080_0000121 Ga0501080_0000121_36189_36746 178
98 3300049822 Ga0501035_0000588 Ga0501035_0000588_32826_33383 178
99 3300049823 Ga0501044_0003949 Ga0501044_0003949_9458_10015 178
100 3300053086 Ga0500578_0068239 Ga0500578_0068239_245_841 178
101 3300053093 Ga0500651_0040107 Ga0500651_0040107_229_825 178
102 3300053109 Ga0500569_002090 Ga0500569_002090_2925_3521 178
103 3300054114 Ga0501084_0104418 Ga0501084_0104418_1037_1594 178
104 3300003775 Ga0055524_1000003 Ga0055524_1000003336 179
105 3300006353 Ga0075370_10112199 Ga0075370_101121992 179
106 3300006948 Ga0099826_10000002 Ga0099826_10000002737 179
107 3300025263 Ga0209565_1006157 Ga0209565_10061576 179
108 3300025291 Ga0209675_1043646 Ga0209675_10436461 179
109 3300025295 Ga0209564_1073065 Ga0209564_10730651 179
110 3300025299 Ga0209256_1000007 Ga0209256_100000731 179
111 3300027666 Ga0209282_1000001 Ga0209282_1000001418 179
112 3300048926 Ga0496123_0121326 Ga0496123_0121326_899_1459 179
113 3300005262 Ga0065165_1009831 Ga0065165_10098313 180
114 3300031507 Ga0307509_10002906 Ga0307509_1000290627 180
115 iso_pu_bacteria 2821443989 2821449706 180
116 iso_pu_bacteria 2888388044 2888393612 180
117 iso_pu_bacteria 2904483920 2904486324 180
118 iso_pu_bacteria 2919527303 2919527667 180
119 iso_pu_bacteria 8019538911 8019545073 180
120 3300025297 Ga0209758_1115475 Ga0209758_11154751 181
121 3300046454 Ga0495592_0000322 Ga0495592_0000322_10856_11440 181
122 3300047443 Ga0495687_000017 Ga0495687_000017_316112_316687 181
123 3300053154 Ga0500619_010487 Ga0500619_010487_397_981 181
124 3300003316 rootH1_10086197 rootH1_100861977 182
125 3300003323 rootH1_10169646 rootH1_101696464 182
126 3300025304 Ga0209257_1013587 Ga0209257_10135873 182
127 3300046500 Ga0495596_0006590 Ga0495596_0006590_3268_3843 182
128 3300046513 Ga0495616_0319357 Ga0495616_0319357_65_640 182
129 3300046542 Ga0495597_0002434 Ga0495597_0002434_2304_2879 182
130 3300046542 Ga0495597_0051039 Ga0495597_0051039_939_1514 182
131 3300046794 Ga0495589_0000033 Ga0495589_0000033_41592_42167 182
132 3300005331 Ga0070670_100290396 Ga0070670_1002903962 183
133 3300005355 Ga0070671_100430890 Ga0070671_1004308902 183
134 3300005367 Ga0070667_100356054 Ga0070667_1003560541 183
135 3300005617 Ga0068859_100517949 Ga0068859_1005179492 183
136 3300005618 Ga0068864_100156170 Ga0068864_1001561703 183
137 3300006931 Ga0097620_100517942 Ga0097620_1005179422 183
138 3300009093 Ga0105240_10001536 Ga0105240_100015367 183
139 3300009177 Ga0105248_10174457 Ga0105248_101744574 183
140 3300009545 Ga0105237_10910639 Ga0105237_109106391 183
141 3300013296 Ga0157374_10036608 Ga0157374_100366085 183
142 3300025304 Ga0209257_1004329 Ga0209257_10043293 183
143 3300025900 Ga0207710_10041158 Ga0207710_100411582 183
144 3300025903 Ga0207680_10471361 Ga0207680_104713612 183
145 3300025913 Ga0207695_10001518 Ga0207695_100015187 183
146 3300026088 Ga0207641_10376675 Ga0207641_103766752 183
147 3300026095 Ga0207676_10113073 Ga0207676_101130732 183
148 3300028379 Ga0268266_10491049 Ga0268266_104910492 183
149 3300046501 Ga0495607_0051569 Ga0495607_0051569_85_666 183
150 3300046507 Ga0495606_0056210 Ga0495606_0056210_150_731 183
151 3300046558 Ga0495633_0000449 Ga0495633_0000449_27640_28236 183
152 3300049571 Ga0501034_0000160 Ga0501034_0000160_91131_91703 183
153 3300053086 Ga0500578_0000045 Ga0500578_0000045_96912_97565 183
154 3300053156 Ga0500622_0075195 Ga0500622_0075195_760_1341 183
155 3300053161 Ga0500634_0000009 Ga0500634_0000009_106126_106698 183
156 3300002067 JGI24735J21928_10073166 JGI24735J21928_100731662 184
157 3300002067 JGI24735J21928_10076014 JGI24735J21928_100760142 184
158 3300002705 JGI25156J39149_1000431 JGI25156J39149_10004313 184
159 3300003214 JGI25165J46597_1001109 JGI25165J46597_100110910 184
160 3300003756 Ga0055533_1000070 Ga0055533_100007034 184
161 3300003758 Ga0055532_1000011 Ga0055532_1000011334 184
162 3300003760 Ga0055527_1000009 Ga0055527_1000009333 184
163 3300003761 Ga0055535_1000008 Ga0055535_100000834 184
164 3300003762 Ga0055542_1000014 Ga0055542_100001434 184
165 3300003763 Ga0055529_1000010 Ga0055529_100001034 184
166 3300005355 Ga0070671_100151476 Ga0070671_1001514762 184
167 3300005367 Ga0070667_100121044 Ga0070667_1001210441 184
168 3300005455 Ga0070663_100159229 Ga0070663_1001592291 184
169 3300005564 Ga0070664_100655007 Ga0070664_1006550071 184
170 3300005614 Ga0068856_100337289 Ga0068856_1003372893 184
171 3300005618 Ga0068864_100566949 Ga0068864_1005669491 184
172 3300006042 Ga0075368_10008206 Ga0075368_100082063 184
173 3300006051 Ga0075364_10196066 Ga0075364_101960661 184
174 3300006177 Ga0075362_10015020 Ga0075362_100150202 184
175 3300006178 Ga0075367_10147695 Ga0075367_101476952 184
176 3300006195 Ga0075366_10018076 Ga0075366_100180764 184
177 3300006353 Ga0075370_10129102 Ga0075370_101291022 184
178 3300009101 Ga0105247_10058862 Ga0105247_100588623 184
179 3300009177 Ga0105248_10178745 Ga0105248_101787453 184
180 3300009545 Ga0105237_10046126 Ga0105237_100461263 184
181 3300009551 Ga0105238_10136097 Ga0105238_101360972 184
182 3300009551 Ga0105238_10219217 Ga0105238_102192172 184
183 3300011119 Ga0105246_10123413 Ga0105246_101234132 184
184 3300013105 Ga0157369_10921527 Ga0157369_109215272 184
185 3300013296 Ga0157374_10026095 Ga0157374_100260953 184
186 3300013306 Ga0163162_10646441 Ga0163162_106464411 184
187 3300014325 Ga0163163_10073974 Ga0163163_100739742 184
188 3300014968 Ga0157379_10212356 Ga0157379_102123562 184
189 3300025226 Ga0209674_100011 Ga0209674_100011580 184
190 3300025228 Ga0209672_100002 Ga0209672_100002576 184
191 3300025229 Ga0209147_100003 Ga0209147_100003576 184
192 3300025230 Ga0209563_101617 Ga0209563_1016176 184
193 3300025230 Ga0209563_103494 Ga0209563_1034942 184
194 3300025231 Ga0207427_100540 Ga0207427_10054026 184
195 3300025242 Ga0209258_100005 Ga0209258_100005217 184
196 3300025253 Ga0209677_110901 Ga0209677_1109012 184
197 3300025254 Ga0209148_1000006 Ga0209148_1000006576 184
198 3300025256 Ga0209759_1000006 Ga0209759_1000006419 184
199 3300025261 Ga0209233_1000018 Ga0209233_1000018779 184
200 3300025272 Ga0209455_1000003 Ga0209455_1000003576 184
201 3300025297 Ga0209758_1004273 Ga0209758_100427313 184
202 3300025315 Ga0207697_10050788 Ga0207697_100507882 184
203 3300025904 Ga0207647_10032800 Ga0207647_100328002 184
204 3300025914 Ga0207671_10130960 Ga0207671_101309602 184
205 3300025925 Ga0207650_10220666 Ga0207650_102206662 184
206 3300025935 Ga0207709_10475836 Ga0207709_104758362 184
207 3300025986 Ga0207658_10083633 Ga0207658_100836333 184
208 3300026078 Ga0207702_10448281 Ga0207702_104482811 184
209 3300027866 Ga0209813_10065891 Ga0209813_100658912 184
210 3300030522 Ga0307512_10228441 Ga0307512_102284412 184
211 3300031456 Ga0307513_10101432 Ga0307513_101014322 184
212 3300033180 Ga0307510_10066798 Ga0307510_100667981 184
213 3300046454 Ga0495592_0483442 Ga0495592_0483442_38_613 184
214 3300046459 Ga0495629_0647136 Ga0495629_0647136_98_673 184
215 3300046463 Ga0495653_0008463 Ga0495653_0008463_4581_5156 184
216 3300046463 Ga0495653_0073214 Ga0495653_0073214_1794_2369 184
217 3300046471 Ga0495650_0028726 Ga0495650_0028726_1775_2350 184
218 3300046472 Ga0495580_0001487 Ga0495580_0001487_16721_17296 184
219 3300046473 Ga0495582_0006663 Ga0495582_0006663_1261_1836 184
220 3300046473 Ga0495582_0010701 Ga0495582_0010701_783_1358 184
221 3300046476 Ga0495662_0072874 Ga0495662_0072874_155_730 184
222 3300046477 Ga0495664_0000188 Ga0495664_0000188_26558_27133 184
223 3300046477 Ga0495664_0125239 Ga0495664_0125239_613_1188 184
224 3300046507 Ga0495606_0054910 Ga0495606_0054910_1711_2304 184
225 3300046513 Ga0495616_0152407 Ga0495616_0152407_430_1023 184
226 3300046514 Ga0495618_0001351 Ga0495618_0001351_15843_16418 184
227 3300046514 Ga0495618_0444496 Ga0495618_0444496_160_735 184
228 3300046515 Ga0495620_0068616 Ga0495620_0068616_376_969 184
229 3300046516 Ga0495628_0002801 Ga0495628_0002801_11792_12367 184
230 3300046516 Ga0495628_0062239 Ga0495628_0062239_1044_1619 184
231 3300046516 Ga0495628_0219119 Ga0495628_0219119_160_735 184
232 3300046517 Ga0495630_0022675 Ga0495630_0022675_875_1450 184
233 3300046519 Ga0495632_0044591 Ga0495632_0044591_106_699 184
234 3300046522 Ga0495643_0066760 Ga0495643_0066760_1055_1648 184
235 3300046524 Ga0495648_0001271 Ga0495648_0001271_6730_7305 184
236 3300046526 Ga0495666_0000335 Ga0495666_0000335_16719_17294 184
237 3300046529 Ga0495652_0072487 Ga0495652_0072487_822_1397 184
238 3300046531 Ga0495665_0002423 Ga0495665_0002423_8872_9447 184
239 3300046531 Ga0495665_0034311 Ga0495665_0034311_1271_1846 184
240 3300046533 Ga0495640_0002769 Ga0495640_0002769_6173_6748 184
241 3300046533 Ga0495640_0113536 Ga0495640_0113536_1042_1617 184
242 3300046535 Ga0495586_0000616 Ga0495586_0000616_3282_3857 184
243 3300046535 Ga0495586_0012807 Ga0495586_0012807_633_1208 184
244 3300046536 Ga0495587_0008374 Ga0495587_0008374_2378_2953 184
245 3300046543 Ga0495645_0003450 Ga0495645_0003450_6864_7439 184
246 3300046559 Ga0495667_0017105 Ga0495667_0017105_665_1240 184
247 3300046642 Ga0495634_0003611 Ga0495634_0003611_8499_9074 184
248 3300046642 Ga0495634_0009448 Ga0495634_0009448_1270_1845 184
249 3300046648 Ga0495611_0337780 Ga0495611_0337780_10_585 184
250 3300046663 Ga0495635_0009569 Ga0495635_0009569_2796_3371 184
251 3300046663 Ga0495635_0403009 Ga0495635_0403009_190_765 184
252 3300046665 Ga0495661_0001659 Ga0495661_0001659_156_731 184
253 3300046678 Ga0495599_0163835 Ga0495599_0163835_159_734 184
254 3300046678 Ga0495599_0385338 Ga0495599_0385338_131_706 184
255 3300046679 Ga0495623_0356163 Ga0495623_0356163_116_691 184
256 3300046680 Ga0495646_0001418 Ga0495646_0001418_9973_10548 184
257 3300046680 Ga0495646_0022957 Ga0495646_0022957_2726_3301 184
258 3300046689 Ga0495613_0002909 Ga0495613_0002909_9973_10548 184
259 3300046690 Ga0495624_0011116 Ga0495624_0011116_4453_5028 184
260 3300046809 Ga0495600_0033852 Ga0495600_0033852_1877_2452 184
261 3300047315 Ga0495581_0000739 Ga0495581_0000739_13857_14432 184
262 3300047315 Ga0495581_0007022 Ga0495581_0007022_5805_6380 184
263 3300047317 Ga0495604_0002010 Ga0495604_0002010_134_709 184
264 3300047317 Ga0495604_0171120 Ga0495604_0171120_259_834 184
265 3300047317 Ga0495604_0233205 Ga0495604_0233205_53_628 184
266 3300047319 Ga0495674_0011275 Ga0495674_0011275_4581_5156 184
267 3300047321 Ga0495676_0001635 Ga0495676_0001635_16698_17273 184
268 3300047322 Ga0495680_0037285 Ga0495680_0037285_3283_3858 184
269 3300047322 Ga0495680_0112233 Ga0495680_0112233_506_1081 184
270 3300047323 Ga0495683_0067867 Ga0495683_0067867_19_594 184
271 3300047443 Ga0495687_041280 Ga0495687_041280_519_1094 184
272 3300047443 Ga0495687_164376 Ga0495687_164376_63_656 184
273 3300047444 Ga0495675_0009994 Ga0495675_0009994_5090_5665 184
274 3300047446 Ga0495679_000955 Ga0495679_000955_2443_3018 184
275 3300047471 Ga0495684_0036880 Ga0495684_0036880_101_676 184
276 3300047471 Ga0495684_0471476 Ga0495684_0471476_255_830 184
277 3300047673 Ga0495593_0003322 Ga0495593_0003322_8940_9515 184
278 3300048088 Ga0495602_0005930 Ga0495602_0005930_3276_3851 184
279 3300048089 Ga0495614_0000420 Ga0495614_0000420_139_714 184
280 3300048089 Ga0495614_0008201 Ga0495614_0008201_2767_3342 184
281 3300048905 Ga0496102_0263311 Ga0496102_0263311_183_776 184
282 3300048906 Ga0496103_0089623 Ga0496103_0089623_1124_1717 184
283 3300048911 Ga0496108_0125310 Ga0496108_0125310_809_1402 184
284 3300048915 Ga0496112_0060321 Ga0496112_0060321_1988_2581 184
285 3300048921 Ga0496118_0147782 Ga0496118_0147782_847_1440 184
286 3300048922 Ga0496119_0051129 Ga0496119_0051129_752_1345 184
287 3300048924 Ga0496121_0436373 Ga0496121_0436373_177_770 184
288 3300048927 Ga0496124_0260032 Ga0496124_0260032_594_1187 184
289 3300048928 Ga0496125_0062009 Ga0496125_0062009_1973_2566 184
290 3300049570 Ga0501033_0246570 Ga0501033_0246570_398_973 184
291 3300049571 Ga0501034_0135785 Ga0501034_0135785_175_750 184
292 3300049822 Ga0501035_0039815 Ga0501035_0039815_2475_3050 184
293 3300049823 Ga0501044_0460408 Ga0501044_0460408_99_674 184
294 3300050489 nmdc:mga03683_80967_c1 nmdc:mga03683_80967_c1_644_1237 184
295 3300050491 nmdc:mga00v17_66966_c1 nmdc:mga00v17_66966_c1_1316_1909 184
296 3300050492 nmdc:mga0yw44_114003_c1 nmdc:mga0yw44_114003_c1_311_904 184
297 3300050493 nmdc:mga0k408_250505_c1 nmdc:mga0k408_250505_c1_310_903 184
298 3300050495 nmdc:mga04h51_43697_c1 nmdc:mga04h51_43697_c1_772_1365 184
299 3300050496 nmdc:mga07m45_285087_c1 nmdc:mga07m45_285087_c1_141_734 184

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d3u-assembly1.cif.gz_G structure of mrp complex from dietzia sp. dq12-45-1b 0.6314 90 170
7d3u-assembly1.cif.gz_G structure of mrp complex from dietzia sp. dq12-45-1b 0.468 90 170
5zug-assembly1.cif.gz_F structure of the bacterial acetate channel satp 0.4679 17 172
7q3g-assembly1.cif.gz_B pentameric ligand-gated ion channel, declic at ph 7 with 10 mm ca2+ 0.4591 84 180
6s1k-assembly1.cif.gz_I e. coli core signaling unit, carrying qqqq receptor mutation 0.4249 69 170
ID Description Score Start End Superfamily
4qpkA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.7267 95 141 1.10.287.130
af_Q06551_170_290_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.7009 98 146 3.30.70.270
af_Q55GU3_26_131_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6809 82 146 1.20.1280.290
af_A0A0B4JCU6_1_139_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.651 92 179 1.20.140.150
5jdnA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.6016 92 172 6.10.280.80
ID Description Score Start End GO Terms
AF-A0A1H6IW99-F1-model_v4 Uncharacterized membrane protein HdeD, DUF308 family 0.8308 13 182 GO:0016020
AF-A0A1V1T255-F1-model_v4 DUF308 domain-containing protein 0.8213 10 181 GO:0016020
AF-A0A1X0GDY7-F1-model_v4 deleted 0.8172 13 182
AF-A0A543M1T9-F1-model_v4 deleted 0.813 14 183
AF-A0A1W9Z4M6-F1-model_v4 DUF308 domain-containing protein 0.8015 4 182 GO:0016020

Feature Viewer

pLDDT pTM Quality
67.78 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map