F395084
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 224 | 282 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300053086|Ga0500578_0000045|Ga0500578_0000045_96912_97565 |
| Length | 217 |
| Sequence | MASNVGAYLERFFPSGATYDQLDDDADADPVAVQERWLKTYYFARVAFSAVWVAAAFTIGDAYSFVGAVLLVIYPLWDAAANLVDAQRSGGLANNQTQAINLLVSLATTIVVLIAVMINMHWVLGVYGAWAILSGLMQLGSAVRRWRTAGAQWAMILSGAQSALAGGFFVFQATQAPEPSIKNIAGYAAFGAFYFFISALWLTVKGLRAQKPNNDGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 2 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 3 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 4 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 5 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 6 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 7 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 8 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 9 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 10 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 11 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 12 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 13 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 14 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 15 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 45 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 66 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 67 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 68 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 69 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 100 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 103 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 104 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 105 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 106 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 107 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 108 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 109 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 110 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 111 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 173 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 176 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 177 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 178 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 179 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 180 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 181 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 182 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 202 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 205 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 206 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 207 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 208 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 209 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 210 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 211 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 212 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 213 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 214 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 215 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 216 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 217 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 218 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 219 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 220 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 221 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 222 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 224 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.65 |
| Metatranscriptomes | 0.33 |
| Isolates | 6.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.07 |
| Nodule | 6.35 |
| Rhizoplane | 3.01 |
| Rhizosphere | 60.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10073166 | 3300002067 | Bacteria | 982 |
| 2 | JGI24735J21928_10076014 | 3300002067 | Bacteria | 962 |
| 3 | JGI25156J39149_1000431 | 3300002705 | Bacteria | 25952 |
| 4 | JGI25165J46597_1001109 | 3300003214 | Bacteria | 17051 |
| 5 | rootH1_10086197 | 3300003316 | Bacteria | 5809 |
| 6 | rootH1_10086197 | 3300003323 | Bacteria | 2597 |
| 7 | rootL2_10073279 | 3300003322 | Bacteria | 1634 |
| 8 | rootH1_10169646 | 3300003323 | Bacteria | 3032 |
| 9 | Ga0007410J51695_1046823 | 3300003574 | Bacteria | 1275 |
| 10 | Ga0055533_1000070 | 3300003756 | Bacteria | 153414 |
| 11 | Ga0055532_1000011 | 3300003758 | Bacteria | 385294 |
| 12 | Ga0055527_1000009 | 3300003760 | Bacteria | 385294 |
| 13 | Ga0055535_1000008 | 3300003761 | Bacteria | 385294 |
| 14 | Ga0055542_1000014 | 3300003762 | Bacteria | 385294 |
| 15 | Ga0055529_1000010 | 3300003763 | Bacteria | 385294 |
| 16 | Ga0055524_1000003 | 3300003775 | Bacteria | 399748 |
| 17 | Ga0055531_10003284 | 3300003794 | Bacteria | 10362 |
| 18 | Ga0065165_1009831 | 3300005262 | Bacteria | 4224 |
| 19 | Ga0065165_1021870 | 3300005262 | Bacteria | 2210 |
| 20 | Ga0070658_10329964 | 3300005327 | Bacteria | 1304 |
| 21 | Ga0070670_100290396 | 3300005331 | Bacteria | 1429 |
| 22 | Ga0070661_100685946 | 3300005344 | Bacteria | 834 |
| 23 | Ga0070671_100151476 | 3300005355 | Bacteria | 1958 |
| 24 | Ga0070671_100430890 | 3300005355 | Bacteria | 1130 |
| 25 | Ga0070667_100121044 | 3300005367 | Bacteria | 2276 |
| 26 | Ga0070667_100356054 | 3300005367 | Bacteria | 1326 |
| 27 | Ga0070663_100159229 | 3300005455 | Bacteria | 1737 |
| 28 | Ga0070665_100127655 | 3300005548 | Bacteria | 2546 |
| 29 | Ga0070665_100491751 | 3300005548 | Bacteria | 1238 |
| 30 | Ga0070664_100655007 | 3300005564 | Bacteria | 976 |
| 31 | Ga0068856_100337289 | 3300005614 | Bacteria | 1525 |
| 32 | Ga0068856_100931098 | 3300005614 | Bacteria | 888 |
| 33 | Ga0068859_100517949 | 3300005617 | Bacteria | 1288 |
| 34 | Ga0068864_100156170 | 3300005618 | Bacteria | 2071 |
| 35 | Ga0068864_100566949 | 3300005618 | Bacteria | 1099 |
| 36 | Ga0068851_10374483 | 3300005834 | Bacteria | 833 |
| 37 | Ga0075368_10008206 | 3300006042 | Bacteria | 3711 |
| 38 | Ga0075363_100249886 | 3300006048 | Bacteria | 1021 |
| 39 | Ga0075364_10196066 | 3300006051 | Bacteria | 1368 |
| 40 | Ga0075362_10015020 | 3300006177 | Bacteria | 3140 |
| 41 | Ga0075367_10147695 | 3300006178 | Bacteria | 1458 |
| 42 | Ga0075366_10018076 | 3300006195 | Bacteria | 4070 |
| 43 | Ga0075370_10112199 | 3300006353 | Bacteria | 1584 |
| 44 | Ga0075370_10129102 | 3300006353 | Bacteria | 1474 |
| 45 | Ga0097620_100517942 | 3300006931 | Bacteria | 1288 |
| 46 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 47 | Ga0105240_10001536 | 3300009093 | Bacteria | 39156 |
| 48 | Ga0105247_10058862 | 3300009101 | Bacteria | 2377 |
| 49 | Ga0105248_10174457 | 3300009177 | Bacteria | 2423 |
| 50 | Ga0105248_10178745 | 3300009177 | Bacteria | 2391 |
| 51 | Ga0105237_10046126 | 3300009545 | Bacteria | 4384 |
| 52 | Ga0105237_10910639 | 3300009545 | Bacteria | 886 |
| 53 | Ga0105238_10136097 | 3300009551 | Bacteria | 2434 |
| 54 | Ga0105238_10219217 | 3300009551 | Bacteria | 1878 |
| 55 | Ga0105246_10123413 | 3300011119 | Bacteria | 1923 |
| 56 | Ga0157369_10470807 | 3300013105 | Bacteria | 1300 |
| 57 | Ga0157369_10921527 | 3300013105 | Bacteria | 896 |
| 58 | Ga0157374_10026095 | 3300013296 | Bacteria | 5254 |
| 59 | Ga0157374_10036608 | 3300013296 | Bacteria | 4496 |
| 60 | Ga0163162_10646441 | 3300013306 | Bacteria | 1181 |
| 61 | Ga0157372_10750974 | 3300013307 | Bacteria | 1134 |
| 62 | Ga0163163_10073974 | 3300014325 | Bacteria | 3398 |
| 63 | Ga0157379_10212356 | 3300014968 | Bacteria | 1752 |
| 64 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 65 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 66 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 67 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 68 | Ga0209674_100011 | 3300025226 | Bacteria | 997175 |
| 69 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 70 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 71 | Ga0209563_101617 | 3300025230 | Bacteria | 5829 |
| 72 | Ga0209563_103494 | 3300025230 | Bacteria | 3231 |
| 73 | Ga0207427_100540 | 3300025231 | Bacteria | 19616 |
| 74 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 75 | Ga0209677_110901 | 3300025253 | Bacteria | 1468 |
| 76 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 77 | Ga0209759_1000006 | 3300025256 | Bacteria | 492407 |
| 78 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 79 | Ga0209565_1006157 | 3300025263 | Bacteria | 3398 |
| 80 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 81 | Ga0209675_1043646 | 3300025291 | Bacteria | 963 |
| 82 | Ga0209564_1049647 | 3300025295 | Bacteria | 1036 |
| 83 | Ga0209564_1073065 | 3300025295 | Bacteria | 703 |
| 84 | Ga0209758_1000140 | 3300025297 | Bacteria | 174267 |
| 85 | Ga0209758_1004273 | 3300025297 | Bacteria | 12065 |
| 86 | Ga0209758_1050461 | 3300025297 | Bacteria | 1458 |
| 87 | Ga0209758_1115475 | 3300025297 | Unclassified | 734 |
| 88 | Ga0209256_1000007 | 3300025299 | Bacteria | 1136599 |
| 89 | Ga0207426_1030310 | 3300025302 | Bacteria | 1775 |
| 90 | Ga0209257_1000522 | 3300025304 | Bacteria | 66723 |
| 91 | Ga0209257_1004329 | 3300025304 | Bacteria | 11121 |
| 92 | Ga0209257_1013587 | 3300025304 | Bacteria | 3601 |
| 93 | Ga0207697_10050788 | 3300025315 | Bacteria | 1713 |
| 94 | Ga0207710_10041158 | 3300025900 | Bacteria | 2048 |
| 95 | Ga0207680_10471361 | 3300025903 | Bacteria | 892 |
| 96 | Ga0207647_10032800 | 3300025904 | Bacteria | 3332 |
| 97 | Ga0207695_10001518 | 3300025913 | Bacteria | 38528 |
| 98 | Ga0207671_10130960 | 3300025914 | Bacteria | 1925 |
| 99 | Ga0207650_10220666 | 3300025925 | Bacteria | 1526 |
| 100 | Ga0207709_10475836 | 3300025935 | Bacteria | 970 |
| 101 | Ga0207658_10083633 | 3300025986 | Bacteria | 2454 |
| 102 | Ga0207702_10448281 | 3300026078 | Bacteria | 1252 |
| 103 | Ga0207641_10376675 | 3300026088 | Bacteria | 1358 |
| 104 | Ga0207676_10113073 | 3300026095 | Bacteria | 2276 |
| 105 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 106 | Ga0209813_10065891 | 3300027866 | Bacteria | 1167 |
| 107 | Ga0268266_10177829 | 3300028379 | Bacteria | 1935 |
| 108 | Ga0268266_10491049 | 3300028379 | Bacteria | 1171 |
| 109 | Ga0268266_10823450 | 3300028379 | Bacteria | 897 |
| 110 | Ga0307512_10228441 | 3300030522 | Bacteria | 960 |
| 111 | Ga0307513_10101432 | 3300031456 | Bacteria | 2899 |
| 112 | Ga0307509_10002906 | 3300031507 | Bacteria | 27071 |
| 113 | Ga0307510_10066798 | 3300033180 | Bacteria | 3627 |
| 114 | Ga0439465_0157284 | 3300041413 | Bacteria | 814 |
| 115 | Ga0451841_0401942 | 3300041498 | Bacteria | 980 |
| 116 | Ga0451853_0270099 | 3300041512 | Bacteria | 2442 |
| 117 | Ga0466982_0279223 | 3300044672 | Bacteria | 963 |
| 118 | Ga0466958_0036134 | 3300045836 | Bacteria | 2956 |
| 119 | Ga0495617_161554 | 3300046452 | Bacteria | 710 |
| 120 | Ga0495592_0000322 | 3300046454 | Bacteria | 40072 |
| 121 | Ga0495592_0483442 | 3300046454 | Bacteria | 771 |
| 122 | Ga0495590_0000099 | 3300046457 | Bacteria | 52654 |
| 123 | Ga0495629_0647136 | 3300046459 | Bacteria | 704 |
| 124 | Ga0495653_0008463 | 3300046463 | Bacteria | 8436 |
| 125 | Ga0495653_0073214 | 3300046463 | Bacteria | 2557 |
| 126 | Ga0495650_0021080 | 3300046471 | Bacteria | 3159 |
| 127 | Ga0495650_0028726 | 3300046471 | Bacteria | 2546 |
| 128 | Ga0495580_0001487 | 3300046472 | Bacteria | 20578 |
| 129 | Ga0495582_0006663 | 3300046473 | Bacteria | 6416 |
| 130 | Ga0495582_0010701 | 3300046473 | Bacteria | 5046 |
| 131 | Ga0495662_0072874 | 3300046476 | Bacteria | 1666 |
| 132 | Ga0495664_0000188 | 3300046477 | Bacteria | 30394 |
| 133 | Ga0495664_0125239 | 3300046477 | Bacteria | 1554 |
| 134 | Ga0495584_0000101 | 3300046491 | Bacteria | 57700 |
| 135 | Ga0495585_0091291 | 3300046492 | Bacteria | 1640 |
| 136 | Ga0495596_0000094 | 3300046500 | Bacteria | 62938 |
| 137 | Ga0495596_0006590 | 3300046500 | Bacteria | 5325 |
| 138 | Ga0495607_0051569 | 3300046501 | Bacteria | 2388 |
| 139 | Ga0495606_0001141 | 3300046507 | Bacteria | 37735 |
| 140 | Ga0495606_0001224 | 3300046507 | Bacteria | 35940 |
| 141 | Ga0495606_0004183 | 3300046507 | Bacteria | 14621 |
| 142 | Ga0495606_0042242 | 3300046507 | Bacteria | 3051 |
| 143 | Ga0495606_0054910 | 3300046507 | Bacteria | 2578 |
| 144 | Ga0495606_0056210 | 3300046507 | Bacteria | 2541 |
| 145 | Ga0495606_0268944 | 3300046507 | Bacteria | 937 |
| 146 | Ga0495616_0152407 | 3300046513 | Bacteria | 1045 |
| 147 | Ga0495616_0319357 | 3300046513 | Bacteria | 652 |
| 148 | Ga0495618_0001351 | 3300046514 | Bacteria | 16490 |
| 149 | Ga0495618_0444496 | 3300046514 | Bacteria | 787 |
| 150 | Ga0495620_0068616 | 3300046515 | Bacteria | 1456 |
| 151 | Ga0495628_0001732 | 3300046516 | Bacteria | 19860 |
| 152 | Ga0495628_0002801 | 3300046516 | Bacteria | 15649 |
| 153 | Ga0495628_0062239 | 3300046516 | Bacteria | 2925 |
| 154 | Ga0495628_0219119 | 3300046516 | Bacteria | 1429 |
| 155 | Ga0495630_0022675 | 3300046517 | Bacteria | 4637 |
| 156 | Ga0495632_0044591 | 3300046519 | Bacteria | 2213 |
| 157 | Ga0495643_0066760 | 3300046522 | Bacteria | 1896 |
| 158 | Ga0495648_0001271 | 3300046524 | Bacteria | 25153 |
| 159 | Ga0495648_0060353 | 3300046524 | Bacteria | 2257 |
| 160 | Ga0495648_0173276 | 3300046524 | Bacteria | 1104 |
| 161 | Ga0495663_0219102 | 3300046525 | Bacteria | 668 |
| 162 | Ga0495666_0000335 | 3300046526 | Bacteria | 20557 |
| 163 | Ga0495652_0072487 | 3300046529 | Bacteria | 2870 |
| 164 | Ga0495665_0002423 | 3300046531 | Bacteria | 10080 |
| 165 | Ga0495665_0034311 | 3300046531 | Bacteria | 2712 |
| 166 | Ga0495640_0002769 | 3300046533 | Bacteria | 14103 |
| 167 | Ga0495640_0113536 | 3300046533 | Bacteria | 1767 |
| 168 | Ga0495586_0000616 | 3300046535 | Bacteria | 20577 |
| 169 | Ga0495586_0012807 | 3300046535 | Bacteria | 4445 |
| 170 | Ga0495587_0008374 | 3300046536 | Bacteria | 6653 |
| 171 | Ga0495597_0002434 | 3300046542 | Bacteria | 11806 |
| 172 | Ga0495597_0051039 | 3300046542 | Bacteria | 1824 |
| 173 | Ga0495645_0003450 | 3300046543 | Bacteria | 10721 |
| 174 | Ga0495633_0000449 | 3300046558 | Bacteria | 42373 |
| 175 | Ga0495667_0017105 | 3300046559 | Bacteria | 4897 |
| 176 | Ga0495667_0385509 | 3300046559 | Bacteria | 884 |
| 177 | Ga0495634_0003611 | 3300046642 | Bacteria | 12356 |
| 178 | Ga0495634_0009448 | 3300046642 | Bacteria | 7191 |
| 179 | Ga0495611_0337780 | 3300046648 | Bacteria | 692 |
| 180 | Ga0495625_0153843 | 3300046660 | Bacteria | 1545 |
| 181 | Ga0495635_0009569 | 3300046663 | Bacteria | 6772 |
| 182 | Ga0495635_0403009 | 3300046663 | Bacteria | 908 |
| 183 | Ga0495661_0001659 | 3300046665 | Bacteria | 18142 |
| 184 | Ga0495599_0163835 | 3300046678 | Bacteria | 1374 |
| 185 | Ga0495599_0385338 | 3300046678 | Bacteria | 836 |
| 186 | Ga0495623_0356163 | 3300046679 | Bacteria | 796 |
| 187 | Ga0495646_0001418 | 3300046680 | Bacteria | 14248 |
| 188 | Ga0495646_0022957 | 3300046680 | Bacteria | 3929 |
| 189 | Ga0495613_0002909 | 3300046689 | Bacteria | 12825 |
| 190 | Ga0495624_0011116 | 3300046690 | Bacteria | 6191 |
| 191 | Ga0495670_0047815 | 3300046691 | Bacteria | 2139 |
| 192 | Ga0495589_0000033 | 3300046794 | Bacteria | 162794 |
| 193 | Ga0495600_0033852 | 3300046809 | Bacteria | 3317 |
| 194 | Ga0495581_0000739 | 3300047315 | Bacteria | 17317 |
| 195 | Ga0495581_0007022 | 3300047315 | Bacteria | 6526 |
| 196 | Ga0495604_0002010 | 3300047317 | Bacteria | 16396 |
| 197 | Ga0495604_0171120 | 3300047317 | Bacteria | 1527 |
| 198 | Ga0495604_0233205 | 3300047317 | Bacteria | 1261 |
| 199 | Ga0495674_0011275 | 3300047319 | Bacteria | 8438 |
| 200 | Ga0495676_0001635 | 3300047321 | Bacteria | 19509 |
| 201 | Ga0495680_0037285 | 3300047322 | Bacteria | 3894 |
| 202 | Ga0495680_0112233 | 3300047322 | Bacteria | 2019 |
| 203 | Ga0495683_0067867 | 3300047323 | Bacteria | 1755 |
| 204 | Ga0495687_000017 | 3300047443 | Bacteria | 350429 |
| 205 | Ga0495687_000190 | 3300047443 | Bacteria | 89269 |
| 206 | Ga0495687_041280 | 3300047443 | Bacteria | 2025 |
| 207 | Ga0495687_164376 | 3300047443 | Bacteria | 742 |
| 208 | Ga0495675_0009994 | 3300047444 | Bacteria | 5919 |
| 209 | Ga0495679_000955 | 3300047446 | Bacteria | 17946 |
| 210 | Ga0495684_0036880 | 3300047471 | Bacteria | 3748 |
| 211 | Ga0495684_0471476 | 3300047471 | Bacteria | 868 |
| 212 | Ga0495686_0000456 | 3300047472 | Bacteria | 61394 |
| 213 | Ga0495686_0000811 | 3300047472 | Bacteria | 40468 |
| 214 | Ga0495593_0003322 | 3300047673 | Bacteria | 9645 |
| 215 | Ga0495602_0005930 | 3300048088 | Bacteria | 12818 |
| 216 | Ga0495614_0000420 | 3300048089 | Bacteria | 17434 |
| 217 | Ga0495614_0008201 | 3300048089 | Bacteria | 4646 |
| 218 | Ga0496102_0206667 | 3300048905 | Bacteria | 1851 |
| 219 | Ga0496102_0263311 | 3300048905 | Bacteria | 1625 |
| 220 | Ga0496102_0376389 | 3300048905 | Bacteria | 1336 |
| 221 | Ga0496102_0549838 | 3300048905 | Bacteria | 1077 |
| 222 | Ga0496103_0054846 | 3300048906 | Bacteria | 2471 |
| 223 | Ga0496103_0089623 | 3300048906 | Bacteria | 1940 |
| 224 | Ga0496103_0509962 | 3300048906 | Bacteria | 769 |
| 225 | Ga0496108_0125310 | 3300048911 | Bacteria | 2205 |
| 226 | Ga0496112_0060321 | 3300048915 | Bacteria | 3738 |
| 227 | Ga0496118_0147782 | 3300048921 | Bacteria | 1476 |
| 228 | Ga0496119_0051129 | 3300048922 | Bacteria | 2542 |
| 229 | Ga0496121_0436373 | 3300048924 | Bacteria | 848 |
| 230 | Ga0496123_0121326 | 3300048926 | Bacteria | 1470 |
| 231 | Ga0496124_0260032 | 3300048927 | Bacteria | 1278 |
| 232 | Ga0496125_0062009 | 3300048928 | Bacteria | 2994 |
| 233 | Ga0501032_0000046 | 3300049569 | Bacteria | 109405 |
| 234 | Ga0501033_0002199 | 3300049570 | Bacteria | 16832 |
| 235 | Ga0501033_0246570 | 3300049570 | Unclassified | 1267 |
| 236 | Ga0501034_0000160 | 3300049571 | Bacteria | 126787 |
| 237 | Ga0501034_0029923 | 3300049571 | Bacteria | 5535 |
| 238 | Ga0501034_0135785 | 3300049571 | Bacteria | 2441 |
| 239 | Ga0501036_0000326 | 3300049572 | Bacteria | 33146 |
| 240 | Ga0501037_0000309 | 3300049573 | Bacteria | 41492 |
| 241 | Ga0501038_0000026 | 3300049574 | Bacteria | 146493 |
| 242 | Ga0501039_0000121 | 3300049575 | Bacteria | 54152 |
| 243 | Ga0501043_0000135 | 3300049579 | Bacteria | 68762 |
| 244 | Ga0501046_0017900 | 3300049580 | Bacteria | 5907 |
| 245 | Ga0501047_0000101 | 3300049581 | Bacteria | 104950 |
| 246 | Ga0501048_0003696 | 3300049582 | Bacteria | 11656 |
| 247 | Ga0501067_0318932 | 3300049583 | Bacteria | 865 |
| 248 | Ga0501068_0001208 | 3300049584 | Bacteria | 13736 |
| 249 | Ga0501069_0011696 | 3300049585 | Bacteria | 4652 |
| 250 | Ga0501070_0000297 | 3300049586 | Bacteria | 46317 |
| 251 | Ga0501073_0009720 | 3300049589 | Bacteria | 7084 |
| 252 | Ga0501074_0141238 | 3300049590 | Bacteria | 1722 |
| 253 | Ga0501079_0068686 | 3300049741 | Bacteria | 2735 |
| 254 | Ga0501080_0000121 | 3300049742 | Bacteria | 54804 |
| 255 | Ga0501269_000555 | 3300049766 | Bacteria | 7079 |
| 256 | Ga0501035_0000588 | 3300049822 | Bacteria | 40021 |
| 257 | Ga0501035_0039815 | 3300049822 | Bacteria | 4251 |
| 258 | Ga0501044_0003949 | 3300049823 | Bacteria | 16609 |
| 259 | Ga0501044_0460408 | 3300049823 | Bacteria | 1177 |
| 260 | nmdc:mga03683_80967_c1 | 3300050489 | Bacteria | 1402 |
| 261 | nmdc:mga03n38_155013_c1 | 3300050490 | Bacteria | 1155 |
| 262 | nmdc:mga00v17_66966_c1 | 3300050491 | Bacteria | 2218 |
| 263 | nmdc:mga0yw44_114003_c1 | 3300050492 | Bacteria | 1735 |
| 264 | nmdc:mga0yw44_421781_c1 | 3300050492 | Bacteria | 903 |
| 265 | nmdc:mga0yw44_495428_c1 | 3300050492 | Bacteria | 829 |
| 266 | nmdc:mga0k408_250505_c1 | 3300050493 | Bacteria | 1058 |
| 267 | nmdc:mga04h51_43697_c1 | 3300050495 | Bacteria | 1475 |
| 268 | nmdc:mga07m45_285087_c1 | 3300050496 | Bacteria | 961 |
| 269 | Ga0500578_0000045 | 3300053086 | Eukaryota | 127571 |
| 270 | Ga0500578_0035983 | 3300053086 | Bacteria | 3181 |
| 271 | Ga0500578_0068239 | 3300053086 | Bacteria | 2267 |
| 272 | Ga0500643_000032 | 3300053087 | Bacteria | 200350 |
| 273 | Ga0500651_0040107 | 3300053093 | Bacteria | 2949 |
| 274 | Ga0500569_002090 | 3300053109 | Bacteria | 3891 |
| 275 | Ga0500642_0051078 | 3300053130 | Bacteria | 1825 |
| 276 | Ga0500658_0000287 | 3300053134 | Bacteria | 22856 |
| 277 | Ga0500577_0211537 | 3300053142 | Bacteria | 838 |
| 278 | Ga0500619_010487 | 3300053154 | Bacteria | 2346 |
| 279 | Ga0500622_0075195 | 3300053156 | Bacteria | 1700 |
| 280 | Ga0500634_0000009 | 3300053161 | Bacteria | 144333 |
| 281 | Ga0500599_001520 | 3300053736 | Bacteria | 2681 |
| 282 | Ga0501084_0104418 | 3300054114 | Bacteria | 2380 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050492 | nmdc:mga0yw44_421781_c1 | nmdc:mga0yw44_421781_c1_55_585 | 162 |
| 2 | 3300045836 | Ga0466958_0036134 | Ga0466958_0036134_1097_1663 | 165 |
| 3 | 3300046452 | Ga0495617_161554 | Ga0495617_161554_100_690 | 165 |
| 4 | 3300046524 | Ga0495648_0060353 | Ga0495648_0060353_1092_1682 | 165 |
| 5 | 3300053087 | Ga0500643_000032 | Ga0500643_000032_42007_42597 | 165 |
| 6 | 3300053130 | Ga0500642_0051078 | Ga0500642_0051078_45_635 | 165 |
| 7 | 3300053142 | Ga0500577_0211537 | Ga0500577_0211537_61_651 | 165 |
| 8 | 3300053736 | Ga0500599_001520 | Ga0500599_001520_452_1042 | 165 |
| 9 | 3300021320 | Ga0214544_1000002 | Ga0214544_1000002233 | 166 |
| 10 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001583 | 166 |
| 11 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001649 | 166 |
| 12 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001546 | 166 |
| 13 | 3300025295 | Ga0209564_1049647 | Ga0209564_10496472 | 166 |
| 14 | 3300046691 | Ga0495670_0047815 | Ga0495670_0047815_590_1174 | 166 |
| 15 | 3300048905 | Ga0496102_0376389 | Ga0496102_0376389_438_1001 | 166 |
| 16 | 3300048906 | Ga0496103_0054846 | Ga0496103_0054846_999_1562 | 166 |
| 17 | 3300006048 | Ga0075363_100249886 | Ga0075363_1002498862 | 168 |
| 18 | 3300025297 | Ga0209758_1050461 | Ga0209758_10504612 | 168 |
| 19 | 3300046525 | Ga0495663_0219102 | Ga0495663_0219102_16_606 | 168 |
| 20 | 3300050490 | nmdc:mga03n38_155013_c1 | nmdc:mga03n38_155013_c1_279_869 | 168 |
| 21 | 3300003794 | Ga0055531_10003284 | Ga0055531_100032843 | 169 |
| 22 | 3300005262 | Ga0065165_1021870 | Ga0065165_10218703 | 169 |
| 23 | 3300005327 | Ga0070658_10329964 | Ga0070658_103299641 | 169 |
| 24 | 3300005344 | Ga0070661_100685946 | Ga0070661_1006859461 | 169 |
| 25 | 3300005548 | Ga0070665_100491751 | Ga0070665_1004917512 | 169 |
| 26 | 3300005614 | Ga0068856_100931098 | Ga0068856_1009310981 | 169 |
| 27 | 3300005834 | Ga0068851_10374483 | Ga0068851_103744831 | 169 |
| 28 | 3300013105 | Ga0157369_10470807 | Ga0157369_104708072 | 169 |
| 29 | 3300025297 | Ga0209758_1000140 | Ga0209758_100014081 | 169 |
| 30 | 3300025302 | Ga0207426_1030310 | Ga0207426_10303103 | 169 |
| 31 | 3300025304 | Ga0209257_1000522 | Ga0209257_100052260 | 169 |
| 32 | 3300028379 | Ga0268266_10823450 | Ga0268266_108234502 | 169 |
| 33 | 3300041413 | Ga0439465_0157284 | Ga0439465_0157284_201_779 | 169 |
| 34 | 3300048905 | Ga0496102_0206667 | Ga0496102_0206667_964_1530 | 169 |
| 35 | 3300041498 | Ga0451841_0401942 | Ga0451841_0401942_193_771 | 170 |
| 36 | 3300046492 | Ga0495585_0091291 | Ga0495585_0091291_349_948 | 171 |
| 37 | 3300046507 | Ga0495606_0268944 | Ga0495606_0268944_146_730 | 171 |
| 38 | 3300053086 | Ga0500578_0035983 | Ga0500578_0035983_1987_2571 | 171 |
| 39 | 3300003322 | rootL2_10073279 | rootL2_100732792 | 172 |
| 40 | 3300046524 | Ga0495648_0173276 | Ga0495648_0173276_99_689 | 172 |
| 41 | 3300003574 | Ga0007410J51695_1046823 | Ga0007410J51695_10468232 | 173 |
| 42 | 3300005548 | Ga0070665_100127655 | Ga0070665_1001276552 | 173 |
| 43 | 3300028379 | Ga0268266_10177829 | Ga0268266_101778292 | 173 |
| 44 | 3300041512 | Ga0451853_0270099 | Ga0451853_0270099_681_1259 | 173 |
| 45 | 3300044672 | Ga0466982_0279223 | Ga0466982_0279223_317_889 | 173 |
| 46 | iso_pu_bacteria | 2718217997 | 2719665984 | 173 |
| 47 | iso_pu_bacteria | 2718218232 | 2720613761 | 173 |
| 48 | iso_pu_bacteria | 2721755556 | 2723027309 | 173 |
| 49 | iso_pu_bacteria | 2728369352 | 2730108245 | 173 |
| 50 | 3300046457 | Ga0495590_0000099 | Ga0495590_0000099_33970_34521 | 174 |
| 51 | 3300046471 | Ga0495650_0021080 | Ga0495650_0021080_61_663 | 174 |
| 52 | 3300046500 | Ga0495596_0000094 | Ga0495596_0000094_39298_39843 | 174 |
| 53 | 3300046507 | Ga0495606_0004183 | Ga0495606_0004183_3913_4458 | 174 |
| 54 | 3300046507 | Ga0495606_0042242 | Ga0495606_0042242_897_1448 | 174 |
| 55 | 3300046660 | Ga0495625_0153843 | Ga0495625_0153843_454_999 | 174 |
| 56 | 3300047472 | Ga0495686_0000456 | Ga0495686_0000456_30475_31032 | 174 |
| 57 | 3300053134 | Ga0500658_0000287 | Ga0500658_0000287_16647_17237 | 174 |
| 58 | 3300046491 | Ga0495584_0000101 | Ga0495584_0000101_56987_57562 | 176 |
| 59 | 3300046507 | Ga0495606_0001224 | Ga0495606_0001224_33388_33963 | 176 |
| 60 | 3300046516 | Ga0495628_0001732 | Ga0495628_0001732_2494_3078 | 176 |
| 61 | 3300046559 | Ga0495667_0385509 | Ga0495667_0385509_206_790 | 176 |
| 62 | 3300047443 | Ga0495687_000190 | Ga0495687_000190_47890_48465 | 176 |
| 63 | 3300047472 | Ga0495686_0000811 | Ga0495686_0000811_36477_37088 | 176 |
| 64 | 3300050492 | nmdc:mga0yw44_495428_c1 | nmdc:mga0yw44_495428_c1_176_760 | 176 |
| 65 | 3300046507 | Ga0495606_0001141 | Ga0495606_0001141_16404_16997 | 177 |
| 66 | 3300048905 | Ga0496102_0549838 | Ga0496102_0549838_438_1010 | 177 |
| 67 | 3300048906 | Ga0496103_0509962 | Ga0496103_0509962_21_593 | 177 |
| 68 | 3300049766 | Ga0501269_000555 | Ga0501269_000555_1907_2482 | 177 |
| 69 | iso_pu_bacteria | 2517093001 | 2517108473 | 177 |
| 70 | iso_pu_bacteria | 2517093001 | 2517108597 | 177 |
| 71 | iso_pu_bacteria | 2517572143 | 2517889500 | 177 |
| 72 | iso_pu_bacteria | 2816332527 | 2818244331 | 177 |
| 73 | iso_pu_bacteria | 2847939898 | 2847943028 | 177 |
| 74 | iso_pu_bacteria | 2929615660 | 2929624302 | 177 |
| 75 | iso_pu_bacteria | 2929624759 | 2929633569 | 177 |
| 76 | iso_pu_bacteria | 2933577622 | 2933586226 | 177 |
| 77 | iso_pu_bacteria | 8055742211 | 8055743193 | 177 |
| 78 | 3300013307 | Ga0157372_10750974 | Ga0157372_107509741 | 178 |
| 79 | 3300049569 | Ga0501032_0000046 | Ga0501032_0000046_60050_60607 | 178 |
| 80 | 3300049570 | Ga0501033_0002199 | Ga0501033_0002199_13285_13842 | 178 |
| 81 | 3300049571 | Ga0501034_0029923 | Ga0501034_0029923_4782_5339 | 178 |
| 82 | 3300049572 | Ga0501036_0000326 | Ga0501036_0000326_26330_26887 | 178 |
| 83 | 3300049573 | Ga0501037_0000309 | Ga0501037_0000309_30570_31127 | 178 |
| 84 | 3300049574 | Ga0501038_0000026 | Ga0501038_0000026_127635_128192 | 178 |
| 85 | 3300049575 | Ga0501039_0000121 | Ga0501039_0000121_15295_15852 | 178 |
| 86 | 3300049579 | Ga0501043_0000135 | Ga0501043_0000135_29520_30077 | 178 |
| 87 | 3300049580 | Ga0501046_0017900 | Ga0501046_0017900_5088_5645 | 178 |
| 88 | 3300049581 | Ga0501047_0000101 | Ga0501047_0000101_47594_48151 | 178 |
| 89 | 3300049582 | Ga0501048_0003696 | Ga0501048_0003696_426_983 | 178 |
| 90 | 3300049583 | Ga0501067_0318932 | Ga0501067_0318932_258_815 | 178 |
| 91 | 3300049584 | Ga0501068_0001208 | Ga0501068_0001208_7191_7748 | 178 |
| 92 | 3300049585 | Ga0501069_0011696 | Ga0501069_0011696_1530_2087 | 178 |
| 93 | 3300049586 | Ga0501070_0000297 | Ga0501070_0000297_44220_44777 | 178 |
| 94 | 3300049589 | Ga0501073_0009720 | Ga0501073_0009720_5299_5856 | 178 |
| 95 | 3300049590 | Ga0501074_0141238 | Ga0501074_0141238_15_572 | 178 |
| 96 | 3300049741 | Ga0501079_0068686 | Ga0501079_0068686_430_987 | 178 |
| 97 | 3300049742 | Ga0501080_0000121 | Ga0501080_0000121_36189_36746 | 178 |
| 98 | 3300049822 | Ga0501035_0000588 | Ga0501035_0000588_32826_33383 | 178 |
| 99 | 3300049823 | Ga0501044_0003949 | Ga0501044_0003949_9458_10015 | 178 |
| 100 | 3300053086 | Ga0500578_0068239 | Ga0500578_0068239_245_841 | 178 |
| 101 | 3300053093 | Ga0500651_0040107 | Ga0500651_0040107_229_825 | 178 |
| 102 | 3300053109 | Ga0500569_002090 | Ga0500569_002090_2925_3521 | 178 |
| 103 | 3300054114 | Ga0501084_0104418 | Ga0501084_0104418_1037_1594 | 178 |
| 104 | 3300003775 | Ga0055524_1000003 | Ga0055524_1000003336 | 179 |
| 105 | 3300006353 | Ga0075370_10112199 | Ga0075370_101121992 | 179 |
| 106 | 3300006948 | Ga0099826_10000002 | Ga0099826_10000002737 | 179 |
| 107 | 3300025263 | Ga0209565_1006157 | Ga0209565_10061576 | 179 |
| 108 | 3300025291 | Ga0209675_1043646 | Ga0209675_10436461 | 179 |
| 109 | 3300025295 | Ga0209564_1073065 | Ga0209564_10730651 | 179 |
| 110 | 3300025299 | Ga0209256_1000007 | Ga0209256_100000731 | 179 |
| 111 | 3300027666 | Ga0209282_1000001 | Ga0209282_1000001418 | 179 |
| 112 | 3300048926 | Ga0496123_0121326 | Ga0496123_0121326_899_1459 | 179 |
| 113 | 3300005262 | Ga0065165_1009831 | Ga0065165_10098313 | 180 |
| 114 | 3300031507 | Ga0307509_10002906 | Ga0307509_1000290627 | 180 |
| 115 | iso_pu_bacteria | 2821443989 | 2821449706 | 180 |
| 116 | iso_pu_bacteria | 2888388044 | 2888393612 | 180 |
| 117 | iso_pu_bacteria | 2904483920 | 2904486324 | 180 |
| 118 | iso_pu_bacteria | 2919527303 | 2919527667 | 180 |
| 119 | iso_pu_bacteria | 8019538911 | 8019545073 | 180 |
| 120 | 3300025297 | Ga0209758_1115475 | Ga0209758_11154751 | 181 |
| 121 | 3300046454 | Ga0495592_0000322 | Ga0495592_0000322_10856_11440 | 181 |
| 122 | 3300047443 | Ga0495687_000017 | Ga0495687_000017_316112_316687 | 181 |
| 123 | 3300053154 | Ga0500619_010487 | Ga0500619_010487_397_981 | 181 |
| 124 | 3300003316 | rootH1_10086197 | rootH1_100861977 | 182 |
| 125 | 3300003323 | rootH1_10169646 | rootH1_101696464 | 182 |
| 126 | 3300025304 | Ga0209257_1013587 | Ga0209257_10135873 | 182 |
| 127 | 3300046500 | Ga0495596_0006590 | Ga0495596_0006590_3268_3843 | 182 |
| 128 | 3300046513 | Ga0495616_0319357 | Ga0495616_0319357_65_640 | 182 |
| 129 | 3300046542 | Ga0495597_0002434 | Ga0495597_0002434_2304_2879 | 182 |
| 130 | 3300046542 | Ga0495597_0051039 | Ga0495597_0051039_939_1514 | 182 |
| 131 | 3300046794 | Ga0495589_0000033 | Ga0495589_0000033_41592_42167 | 182 |
| 132 | 3300005331 | Ga0070670_100290396 | Ga0070670_1002903962 | 183 |
| 133 | 3300005355 | Ga0070671_100430890 | Ga0070671_1004308902 | 183 |
| 134 | 3300005367 | Ga0070667_100356054 | Ga0070667_1003560541 | 183 |
| 135 | 3300005617 | Ga0068859_100517949 | Ga0068859_1005179492 | 183 |
| 136 | 3300005618 | Ga0068864_100156170 | Ga0068864_1001561703 | 183 |
| 137 | 3300006931 | Ga0097620_100517942 | Ga0097620_1005179422 | 183 |
| 138 | 3300009093 | Ga0105240_10001536 | Ga0105240_100015367 | 183 |
| 139 | 3300009177 | Ga0105248_10174457 | Ga0105248_101744574 | 183 |
| 140 | 3300009545 | Ga0105237_10910639 | Ga0105237_109106391 | 183 |
| 141 | 3300013296 | Ga0157374_10036608 | Ga0157374_100366085 | 183 |
| 142 | 3300025304 | Ga0209257_1004329 | Ga0209257_10043293 | 183 |
| 143 | 3300025900 | Ga0207710_10041158 | Ga0207710_100411582 | 183 |
| 144 | 3300025903 | Ga0207680_10471361 | Ga0207680_104713612 | 183 |
| 145 | 3300025913 | Ga0207695_10001518 | Ga0207695_100015187 | 183 |
| 146 | 3300026088 | Ga0207641_10376675 | Ga0207641_103766752 | 183 |
| 147 | 3300026095 | Ga0207676_10113073 | Ga0207676_101130732 | 183 |
| 148 | 3300028379 | Ga0268266_10491049 | Ga0268266_104910492 | 183 |
| 149 | 3300046501 | Ga0495607_0051569 | Ga0495607_0051569_85_666 | 183 |
| 150 | 3300046507 | Ga0495606_0056210 | Ga0495606_0056210_150_731 | 183 |
| 151 | 3300046558 | Ga0495633_0000449 | Ga0495633_0000449_27640_28236 | 183 |
| 152 | 3300049571 | Ga0501034_0000160 | Ga0501034_0000160_91131_91703 | 183 |
| 153 | 3300053086 | Ga0500578_0000045 | Ga0500578_0000045_96912_97565 | 183 |
| 154 | 3300053156 | Ga0500622_0075195 | Ga0500622_0075195_760_1341 | 183 |
| 155 | 3300053161 | Ga0500634_0000009 | Ga0500634_0000009_106126_106698 | 183 |
| 156 | 3300002067 | JGI24735J21928_10073166 | JGI24735J21928_100731662 | 184 |
| 157 | 3300002067 | JGI24735J21928_10076014 | JGI24735J21928_100760142 | 184 |
| 158 | 3300002705 | JGI25156J39149_1000431 | JGI25156J39149_10004313 | 184 |
| 159 | 3300003214 | JGI25165J46597_1001109 | JGI25165J46597_100110910 | 184 |
| 160 | 3300003756 | Ga0055533_1000070 | Ga0055533_100007034 | 184 |
| 161 | 3300003758 | Ga0055532_1000011 | Ga0055532_1000011334 | 184 |
| 162 | 3300003760 | Ga0055527_1000009 | Ga0055527_1000009333 | 184 |
| 163 | 3300003761 | Ga0055535_1000008 | Ga0055535_100000834 | 184 |
| 164 | 3300003762 | Ga0055542_1000014 | Ga0055542_100001434 | 184 |
| 165 | 3300003763 | Ga0055529_1000010 | Ga0055529_100001034 | 184 |
| 166 | 3300005355 | Ga0070671_100151476 | Ga0070671_1001514762 | 184 |
| 167 | 3300005367 | Ga0070667_100121044 | Ga0070667_1001210441 | 184 |
| 168 | 3300005455 | Ga0070663_100159229 | Ga0070663_1001592291 | 184 |
| 169 | 3300005564 | Ga0070664_100655007 | Ga0070664_1006550071 | 184 |
| 170 | 3300005614 | Ga0068856_100337289 | Ga0068856_1003372893 | 184 |
| 171 | 3300005618 | Ga0068864_100566949 | Ga0068864_1005669491 | 184 |
| 172 | 3300006042 | Ga0075368_10008206 | Ga0075368_100082063 | 184 |
| 173 | 3300006051 | Ga0075364_10196066 | Ga0075364_101960661 | 184 |
| 174 | 3300006177 | Ga0075362_10015020 | Ga0075362_100150202 | 184 |
| 175 | 3300006178 | Ga0075367_10147695 | Ga0075367_101476952 | 184 |
| 176 | 3300006195 | Ga0075366_10018076 | Ga0075366_100180764 | 184 |
| 177 | 3300006353 | Ga0075370_10129102 | Ga0075370_101291022 | 184 |
| 178 | 3300009101 | Ga0105247_10058862 | Ga0105247_100588623 | 184 |
| 179 | 3300009177 | Ga0105248_10178745 | Ga0105248_101787453 | 184 |
| 180 | 3300009545 | Ga0105237_10046126 | Ga0105237_100461263 | 184 |
| 181 | 3300009551 | Ga0105238_10136097 | Ga0105238_101360972 | 184 |
| 182 | 3300009551 | Ga0105238_10219217 | Ga0105238_102192172 | 184 |
| 183 | 3300011119 | Ga0105246_10123413 | Ga0105246_101234132 | 184 |
| 184 | 3300013105 | Ga0157369_10921527 | Ga0157369_109215272 | 184 |
| 185 | 3300013296 | Ga0157374_10026095 | Ga0157374_100260953 | 184 |
| 186 | 3300013306 | Ga0163162_10646441 | Ga0163162_106464411 | 184 |
| 187 | 3300014325 | Ga0163163_10073974 | Ga0163163_100739742 | 184 |
| 188 | 3300014968 | Ga0157379_10212356 | Ga0157379_102123562 | 184 |
| 189 | 3300025226 | Ga0209674_100011 | Ga0209674_100011580 | 184 |
| 190 | 3300025228 | Ga0209672_100002 | Ga0209672_100002576 | 184 |
| 191 | 3300025229 | Ga0209147_100003 | Ga0209147_100003576 | 184 |
| 192 | 3300025230 | Ga0209563_101617 | Ga0209563_1016176 | 184 |
| 193 | 3300025230 | Ga0209563_103494 | Ga0209563_1034942 | 184 |
| 194 | 3300025231 | Ga0207427_100540 | Ga0207427_10054026 | 184 |
| 195 | 3300025242 | Ga0209258_100005 | Ga0209258_100005217 | 184 |
| 196 | 3300025253 | Ga0209677_110901 | Ga0209677_1109012 | 184 |
| 197 | 3300025254 | Ga0209148_1000006 | Ga0209148_1000006576 | 184 |
| 198 | 3300025256 | Ga0209759_1000006 | Ga0209759_1000006419 | 184 |
| 199 | 3300025261 | Ga0209233_1000018 | Ga0209233_1000018779 | 184 |
| 200 | 3300025272 | Ga0209455_1000003 | Ga0209455_1000003576 | 184 |
| 201 | 3300025297 | Ga0209758_1004273 | Ga0209758_100427313 | 184 |
| 202 | 3300025315 | Ga0207697_10050788 | Ga0207697_100507882 | 184 |
| 203 | 3300025904 | Ga0207647_10032800 | Ga0207647_100328002 | 184 |
| 204 | 3300025914 | Ga0207671_10130960 | Ga0207671_101309602 | 184 |
| 205 | 3300025925 | Ga0207650_10220666 | Ga0207650_102206662 | 184 |
| 206 | 3300025935 | Ga0207709_10475836 | Ga0207709_104758362 | 184 |
| 207 | 3300025986 | Ga0207658_10083633 | Ga0207658_100836333 | 184 |
| 208 | 3300026078 | Ga0207702_10448281 | Ga0207702_104482811 | 184 |
| 209 | 3300027866 | Ga0209813_10065891 | Ga0209813_100658912 | 184 |
| 210 | 3300030522 | Ga0307512_10228441 | Ga0307512_102284412 | 184 |
| 211 | 3300031456 | Ga0307513_10101432 | Ga0307513_101014322 | 184 |
| 212 | 3300033180 | Ga0307510_10066798 | Ga0307510_100667981 | 184 |
| 213 | 3300046454 | Ga0495592_0483442 | Ga0495592_0483442_38_613 | 184 |
| 214 | 3300046459 | Ga0495629_0647136 | Ga0495629_0647136_98_673 | 184 |
| 215 | 3300046463 | Ga0495653_0008463 | Ga0495653_0008463_4581_5156 | 184 |
| 216 | 3300046463 | Ga0495653_0073214 | Ga0495653_0073214_1794_2369 | 184 |
| 217 | 3300046471 | Ga0495650_0028726 | Ga0495650_0028726_1775_2350 | 184 |
| 218 | 3300046472 | Ga0495580_0001487 | Ga0495580_0001487_16721_17296 | 184 |
| 219 | 3300046473 | Ga0495582_0006663 | Ga0495582_0006663_1261_1836 | 184 |
| 220 | 3300046473 | Ga0495582_0010701 | Ga0495582_0010701_783_1358 | 184 |
| 221 | 3300046476 | Ga0495662_0072874 | Ga0495662_0072874_155_730 | 184 |
| 222 | 3300046477 | Ga0495664_0000188 | Ga0495664_0000188_26558_27133 | 184 |
| 223 | 3300046477 | Ga0495664_0125239 | Ga0495664_0125239_613_1188 | 184 |
| 224 | 3300046507 | Ga0495606_0054910 | Ga0495606_0054910_1711_2304 | 184 |
| 225 | 3300046513 | Ga0495616_0152407 | Ga0495616_0152407_430_1023 | 184 |
| 226 | 3300046514 | Ga0495618_0001351 | Ga0495618_0001351_15843_16418 | 184 |
| 227 | 3300046514 | Ga0495618_0444496 | Ga0495618_0444496_160_735 | 184 |
| 228 | 3300046515 | Ga0495620_0068616 | Ga0495620_0068616_376_969 | 184 |
| 229 | 3300046516 | Ga0495628_0002801 | Ga0495628_0002801_11792_12367 | 184 |
| 230 | 3300046516 | Ga0495628_0062239 | Ga0495628_0062239_1044_1619 | 184 |
| 231 | 3300046516 | Ga0495628_0219119 | Ga0495628_0219119_160_735 | 184 |
| 232 | 3300046517 | Ga0495630_0022675 | Ga0495630_0022675_875_1450 | 184 |
| 233 | 3300046519 | Ga0495632_0044591 | Ga0495632_0044591_106_699 | 184 |
| 234 | 3300046522 | Ga0495643_0066760 | Ga0495643_0066760_1055_1648 | 184 |
| 235 | 3300046524 | Ga0495648_0001271 | Ga0495648_0001271_6730_7305 | 184 |
| 236 | 3300046526 | Ga0495666_0000335 | Ga0495666_0000335_16719_17294 | 184 |
| 237 | 3300046529 | Ga0495652_0072487 | Ga0495652_0072487_822_1397 | 184 |
| 238 | 3300046531 | Ga0495665_0002423 | Ga0495665_0002423_8872_9447 | 184 |
| 239 | 3300046531 | Ga0495665_0034311 | Ga0495665_0034311_1271_1846 | 184 |
| 240 | 3300046533 | Ga0495640_0002769 | Ga0495640_0002769_6173_6748 | 184 |
| 241 | 3300046533 | Ga0495640_0113536 | Ga0495640_0113536_1042_1617 | 184 |
| 242 | 3300046535 | Ga0495586_0000616 | Ga0495586_0000616_3282_3857 | 184 |
| 243 | 3300046535 | Ga0495586_0012807 | Ga0495586_0012807_633_1208 | 184 |
| 244 | 3300046536 | Ga0495587_0008374 | Ga0495587_0008374_2378_2953 | 184 |
| 245 | 3300046543 | Ga0495645_0003450 | Ga0495645_0003450_6864_7439 | 184 |
| 246 | 3300046559 | Ga0495667_0017105 | Ga0495667_0017105_665_1240 | 184 |
| 247 | 3300046642 | Ga0495634_0003611 | Ga0495634_0003611_8499_9074 | 184 |
| 248 | 3300046642 | Ga0495634_0009448 | Ga0495634_0009448_1270_1845 | 184 |
| 249 | 3300046648 | Ga0495611_0337780 | Ga0495611_0337780_10_585 | 184 |
| 250 | 3300046663 | Ga0495635_0009569 | Ga0495635_0009569_2796_3371 | 184 |
| 251 | 3300046663 | Ga0495635_0403009 | Ga0495635_0403009_190_765 | 184 |
| 252 | 3300046665 | Ga0495661_0001659 | Ga0495661_0001659_156_731 | 184 |
| 253 | 3300046678 | Ga0495599_0163835 | Ga0495599_0163835_159_734 | 184 |
| 254 | 3300046678 | Ga0495599_0385338 | Ga0495599_0385338_131_706 | 184 |
| 255 | 3300046679 | Ga0495623_0356163 | Ga0495623_0356163_116_691 | 184 |
| 256 | 3300046680 | Ga0495646_0001418 | Ga0495646_0001418_9973_10548 | 184 |
| 257 | 3300046680 | Ga0495646_0022957 | Ga0495646_0022957_2726_3301 | 184 |
| 258 | 3300046689 | Ga0495613_0002909 | Ga0495613_0002909_9973_10548 | 184 |
| 259 | 3300046690 | Ga0495624_0011116 | Ga0495624_0011116_4453_5028 | 184 |
| 260 | 3300046809 | Ga0495600_0033852 | Ga0495600_0033852_1877_2452 | 184 |
| 261 | 3300047315 | Ga0495581_0000739 | Ga0495581_0000739_13857_14432 | 184 |
| 262 | 3300047315 | Ga0495581_0007022 | Ga0495581_0007022_5805_6380 | 184 |
| 263 | 3300047317 | Ga0495604_0002010 | Ga0495604_0002010_134_709 | 184 |
| 264 | 3300047317 | Ga0495604_0171120 | Ga0495604_0171120_259_834 | 184 |
| 265 | 3300047317 | Ga0495604_0233205 | Ga0495604_0233205_53_628 | 184 |
| 266 | 3300047319 | Ga0495674_0011275 | Ga0495674_0011275_4581_5156 | 184 |
| 267 | 3300047321 | Ga0495676_0001635 | Ga0495676_0001635_16698_17273 | 184 |
| 268 | 3300047322 | Ga0495680_0037285 | Ga0495680_0037285_3283_3858 | 184 |
| 269 | 3300047322 | Ga0495680_0112233 | Ga0495680_0112233_506_1081 | 184 |
| 270 | 3300047323 | Ga0495683_0067867 | Ga0495683_0067867_19_594 | 184 |
| 271 | 3300047443 | Ga0495687_041280 | Ga0495687_041280_519_1094 | 184 |
| 272 | 3300047443 | Ga0495687_164376 | Ga0495687_164376_63_656 | 184 |
| 273 | 3300047444 | Ga0495675_0009994 | Ga0495675_0009994_5090_5665 | 184 |
| 274 | 3300047446 | Ga0495679_000955 | Ga0495679_000955_2443_3018 | 184 |
| 275 | 3300047471 | Ga0495684_0036880 | Ga0495684_0036880_101_676 | 184 |
| 276 | 3300047471 | Ga0495684_0471476 | Ga0495684_0471476_255_830 | 184 |
| 277 | 3300047673 | Ga0495593_0003322 | Ga0495593_0003322_8940_9515 | 184 |
| 278 | 3300048088 | Ga0495602_0005930 | Ga0495602_0005930_3276_3851 | 184 |
| 279 | 3300048089 | Ga0495614_0000420 | Ga0495614_0000420_139_714 | 184 |
| 280 | 3300048089 | Ga0495614_0008201 | Ga0495614_0008201_2767_3342 | 184 |
| 281 | 3300048905 | Ga0496102_0263311 | Ga0496102_0263311_183_776 | 184 |
| 282 | 3300048906 | Ga0496103_0089623 | Ga0496103_0089623_1124_1717 | 184 |
| 283 | 3300048911 | Ga0496108_0125310 | Ga0496108_0125310_809_1402 | 184 |
| 284 | 3300048915 | Ga0496112_0060321 | Ga0496112_0060321_1988_2581 | 184 |
| 285 | 3300048921 | Ga0496118_0147782 | Ga0496118_0147782_847_1440 | 184 |
| 286 | 3300048922 | Ga0496119_0051129 | Ga0496119_0051129_752_1345 | 184 |
| 287 | 3300048924 | Ga0496121_0436373 | Ga0496121_0436373_177_770 | 184 |
| 288 | 3300048927 | Ga0496124_0260032 | Ga0496124_0260032_594_1187 | 184 |
| 289 | 3300048928 | Ga0496125_0062009 | Ga0496125_0062009_1973_2566 | 184 |
| 290 | 3300049570 | Ga0501033_0246570 | Ga0501033_0246570_398_973 | 184 |
| 291 | 3300049571 | Ga0501034_0135785 | Ga0501034_0135785_175_750 | 184 |
| 292 | 3300049822 | Ga0501035_0039815 | Ga0501035_0039815_2475_3050 | 184 |
| 293 | 3300049823 | Ga0501044_0460408 | Ga0501044_0460408_99_674 | 184 |
| 294 | 3300050489 | nmdc:mga03683_80967_c1 | nmdc:mga03683_80967_c1_644_1237 | 184 |
| 295 | 3300050491 | nmdc:mga00v17_66966_c1 | nmdc:mga00v17_66966_c1_1316_1909 | 184 |
| 296 | 3300050492 | nmdc:mga0yw44_114003_c1 | nmdc:mga0yw44_114003_c1_311_904 | 184 |
| 297 | 3300050493 | nmdc:mga0k408_250505_c1 | nmdc:mga0k408_250505_c1_310_903 | 184 |
| 298 | 3300050495 | nmdc:mga04h51_43697_c1 | nmdc:mga04h51_43697_c1_772_1365 | 184 |
| 299 | 3300050496 | nmdc:mga07m45_285087_c1 | nmdc:mga07m45_285087_c1_141_734 | 184 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d3u-assembly1.cif.gz_G | structure of mrp complex from dietzia sp. dq12-45-1b | 0.6314 | 90 | 170 |
| 7d3u-assembly1.cif.gz_G | structure of mrp complex from dietzia sp. dq12-45-1b | 0.468 | 90 | 170 |
| 5zug-assembly1.cif.gz_F | structure of the bacterial acetate channel satp | 0.4679 | 17 | 172 |
| 7q3g-assembly1.cif.gz_B | pentameric ligand-gated ion channel, declic at ph 7 with 10 mm ca2+ | 0.4591 | 84 | 180 |
| 6s1k-assembly1.cif.gz_I | e. coli core signaling unit, carrying qqqq receptor mutation | 0.4249 | 69 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qpkA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain | 0.7267 | 95 | 141 | 1.10.287.130 |
| af_Q06551_170_290_3.30.70.270 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.7009 | 98 | 146 | 3.30.70.270 |
| af_Q55GU3_26_131_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.6809 | 82 | 146 | 1.20.1280.290 |
| af_A0A0B4JCU6_1_139_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.651 | 92 | 179 | 1.20.140.150 |
| 5jdnA01 | Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region | 0.6016 | 92 | 172 | 6.10.280.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H6IW99-F1-model_v4 | Uncharacterized membrane protein HdeD, DUF308 family | 0.8308 | 13 | 182 |
GO:0016020
|
| AF-A0A1V1T255-F1-model_v4 | DUF308 domain-containing protein | 0.8213 | 10 | 181 |
GO:0016020
|
| AF-A0A1X0GDY7-F1-model_v4 | deleted | 0.8172 | 13 | 182 |
|
| AF-A0A543M1T9-F1-model_v4 | deleted | 0.813 | 14 | 183 |
|
| AF-A0A1W9Z4M6-F1-model_v4 | DUF308 domain-containing protein | 0.8015 | 4 | 182 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar