F394774

General Info

Members Datasets Scaffolds Average Seq Length
299 145 580 332

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100130540|Ga0075430_1001305402
Length 365
Sequence MIDTLSQPLYTHVYLPLGMVAEGEEVFMSAQHVAGLSRRQFLTGVTLMGTSGLLSLRPVPVAAEPPPETTRIRLTHVSGICVAPQYMAEELLRSEGFTEVQYVKVGFTPYKAFSAGEVDMSMAFVAPFIMQVEMGDPIVLLAGVHVGCYELFGTDRVQAIRDLKGKRVAVPELGSPHHLFLSSIITYVGLRPQTDIHWLVHPSAEAMQLLAEGQIDALIGFPPVPQELRAKNVGHVIVNSALDRPWSQYFCCVVGANREFIRKHPVATKRAIRAILKATDVCALEPERAAQRLVSRGFTPNFDYGLQTMREIPYGHWREYSVEDAVRFYALRLHEAGMVKSTPQQIIAQGTDWRFLDELKRELKE

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
145 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.67
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0.33
Rhizoplane 7.02
Rhizosphere 90.3
Stem 0
Stem Tuber 0
Unclassified 13.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100130540 3300006846 Bacteria 2094
2 Ga0058859_11266254 3300004798 Bacteria 1977
3 Ga0058860_10585609 3300004801 Bacteria 1895
4 Ga0065707_10095942 3300005295 Unclassified 3321
5 Ga0065707_10149757 3300005295 Bacteria 1672
6 Ga0070670_100122596 3300005331 Bacteria 2242
7 Ga0070670_100199252 3300005331 Unclassified 1739
8 Ga0068869_100075807 3300005334 Bacteria 2500
9 Ga0068868_100249838 3300005338 Bacteria 1492
10 Ga0070689_100274955 3300005340 Bacteria 1396
11 Ga0070692_10011293 3300005345 Bacteria 4095
12 Ga0070669_100019174 3300005353 Bacteria 4887
13 Ga0070675_100102181 3300005354 Bacteria 2415
14 Ga0070675_100118816 3300005354 Bacteria 2245
15 Ga0070675_100211595 3300005354 Bacteria 1685
16 Ga0070671_100382234 3300005355 Bacteria 1203
17 Ga0070674_100060055 3300005356 Bacteria 2649
18 Ga0070673_100150611 3300005364 Bacteria 1970
19 Ga0070673_100211330 3300005364 Unclassified 1676
20 Ga0070688_100143043 3300005365 Bacteria 1627
21 Ga0070667_100384319 3300005367 Bacteria 1275
22 Ga0070710_10020432 3300005437 Bacteria 3436
23 Ga0070711_100181857 3300005439 Unclassified 1610
24 Ga0070700_100010618 3300005441 Bacteria 5085
25 Ga0070708_100084080 3300005445 Bacteria 2887
26 Ga0070708_100112339 3300005445 Bacteria 2505
27 Ga0068867_100060360 3300005459 Bacteria 2813
28 Ga0068867_100098977 3300005459 Bacteria 2224
29 Ga0070706_100008991 3300005467 Bacteria 9300
30 Ga0070706_100075362 3300005467 Bacteria 3122
31 Ga0070706_100090651 3300005467 Bacteria 2835
32 Ga0070706_100133995 3300005467 Unclassified 2313
33 Ga0070706_100294356 3300005467 Unclassified 1515
34 Ga0070707_100014083 3300005468 Bacteria 7494
35 Ga0070707_100049311 3300005468 Bacteria 4036
36 Ga0070707_100144129 3300005468 Bacteria 2318
37 Ga0070698_100041260 3300005471 Bacteria 4738
38 Ga0070698_100116833 3300005471 Unclassified 2630
39 Ga0070698_100125890 3300005471 Unclassified 2520
40 Ga0070699_100038895 3300005518 Bacteria 4118
41 Ga0070699_100067790 3300005518 Bacteria 3099
42 Ga0070699_100112814 3300005518 Bacteria 2388
43 Ga0070699_100273930 3300005518 Bacteria 1511
44 Ga0070697_100009366 3300005536 Bacteria 7652
45 Ga0070697_100130321 3300005536 Bacteria 2109
46 Ga0070697_100270400 3300005536 Bacteria 1457
47 Ga0070672_100111297 3300005543 Bacteria 2232
48 Ga0070672_100126882 3300005543 Bacteria 2093
49 Ga0070696_100010824 3300005546 Bacteria 6113
50 Ga0070696_100171591 3300005546 Bacteria 1604
51 Ga0070665_100330127 3300005548 Bacteria 1530
52 Ga0070702_100213400 3300005615 Bacteria 1286
53 Ga0068859_100273762 3300005617 Bacteria 1781
54 Ga0068864_100075806 3300005618 Bacteria 2937
55 Ga0068864_100272466 3300005618 Bacteria 1577
56 Ga0068861_100043566 3300005719 Unclassified 3370
57 Ga0068870_10012843 3300005840 Unclassified 3921
58 Ga0068863_100036113 3300005841 Bacteria 4706
59 Ga0068863_100110143 3300005841 Bacteria 2622
60 Ga0068860_100565549 3300005843 Bacteria 1140
61 Ga0068862_100071670 3300005844 Bacteria 2992
62 Ga0081455_10018138 3300005937 Bacteria 6717
63 Ga0081455_10081278 3300005937 Bacteria 2654
64 Ga0081538_10085008 3300005981 Bacteria 1664
65 Ga0081540_1006301 3300005983 Bacteria 8682
66 Ga0081539_10000083 3300005985 Bacteria 218881
67 Ga0070717_10098606 3300006028 Unclassified 2477
68 Ga0070717_10319710 3300006028 Bacteria 1383
69 Ga0075365_10003132 3300006038 Bacteria 8427
70 Ga0097621_100170196 3300006237 Bacteria 1877
71 Ga0068871_100361665 3300006358 Bacteria 1285
72 Ga0075428_100015968 3300006844 Bacteria 8307
73 Ga0075428_100023315 3300006844 Bacteria 6848
74 Ga0075428_100040063 3300006844 Bacteria 5156
75 Ga0075428_100141892 3300006844 Bacteria 2612
76 Ga0075428_100155318 3300006844 Bacteria 2486
77 Ga0075428_100326520 3300006844 Bacteria 1648
78 Ga0075428_100389497 3300006844 Bacteria 1494
79 Ga0075428_100423049 3300006844 Bacteria 1427
80 Ga0075430_100000064 3300006846 Bacteria 57146
81 Ga0075431_100023614 3300006847 Bacteria 6293
82 Ga0075431_100080051 3300006847 Bacteria 3373
83 Ga0075431_100083845 3300006847 Bacteria 3290
84 Ga0075431_100086869 3300006847 Bacteria 3227
85 Ga0075431_100119452 3300006847 Bacteria 2720
86 Ga0075431_100150712 3300006847 Bacteria 2394
87 Ga0075433_10226298 3300006852 Bacteria 1661
88 Ga0075433_10279087 3300006852 Bacteria 1480
89 Ga0075434_100143081 3300006871 Unclassified 2412
90 Ga0075434_100391272 3300006871 Unclassified 1411
91 Ga0075434_100554988 3300006871 Bacteria 1168
92 Ga0075429_100024440 3300006880 Bacteria 5242
93 Ga0075429_100032171 3300006880 Bacteria 4559
94 Ga0075429_100088137 3300006880 Bacteria 2705
95 Ga0068865_100170624 3300006881 Bacteria 1667
96 Ga0068865_100252252 3300006881 Bacteria 1393
97 Ga0097620_100273793 3300006931 Bacteria 1781
98 Ga0075435_100033982 3300007076 Bacteria 4037
99 Ga0075435_100087024 3300007076 Bacteria 2574
100 Ga0075435_100127936 3300007076 Bacteria 2124
101 Ga0111539_10028413 3300009094 Bacteria 6823
102 Ga0111539_10186553 3300009094 Bacteria 2422
103 Ga0111539_10196624 3300009094 Unclassified 2352
104 Ga0111539_10265363 3300009094 Bacteria 1999
105 Ga0111539_10433366 3300009094 Bacteria 1531
106 Ga0111539_10646368 3300009094 Bacteria 1232
107 Ga0111539_10647982 3300009094 Bacteria 1230
108 Ga0105247_10067629 3300009101 Bacteria 2226
109 Ga0114129_10011325 3300009147 Bacteria 12706
110 Ga0114129_10017637 3300009147 Bacteria 10163
111 Ga0114129_10037722 3300009147 Bacteria 6822
112 Ga0114129_10142853 3300009147 Unclassified 3279
113 Ga0114129_10181116 3300009147 Unclassified 2866
114 Ga0114129_10185798 3300009147 Bacteria 2825
115 Ga0114129_10301301 3300009147 Unclassified 2136
116 Ga0114129_10351407 3300009147 Bacteria 1953
117 Ga0114129_10394769 3300009147 Bacteria 1824
118 Ga0114129_10440261 3300009147 Bacteria 1711
119 Ga0114129_10654714 3300009147 Unclassified 1355
120 Ga0105242_10219208 3300009176 Bacteria 1699
121 Ga0105248_10063339 3300009177 Bacteria 4151
122 Ga0105249_10317611 3300009553 Bacteria 1568
123 Ga0105239_10152881 3300010375 Bacteria 2576
124 Ga0157378_10109591 3300013297 Bacteria 2529
125 Ga0163162_10046241 3300013306 Bacteria 4362
126 Ga0163162_10210829 3300013306 Bacteria 2072
127 Ga0163162_10343991 3300013306 Bacteria 1624
128 Ga0157375_10047884 3300013308 Bacteria 4178
129 Ga0157375_10295725 3300013308 Bacteria 1782
130 Ga0163163_10018155 3300014325 Bacteria 6577
131 Ga0157380_10107535 3300014326 Bacteria 2336
132 Ga0157379_10012716 3300014968 Bacteria 7358
133 Ga0207697_10014615 3300025315 Bacteria 3254
134 Ga0207692_10016119 3300025898 Bacteria 3301
135 Ga0207688_10040076 3300025901 Bacteria 2602
136 Ga0207643_10027239 3300025908 Bacteria 3167
137 Ga0207643_10174972 3300025908 Bacteria 1297
138 Ga0207684_10012887 3300025910 Bacteria 7240
139 Ga0207684_10025882 3300025910 Bacteria 5001
140 Ga0207684_10050874 3300025910 Bacteria 3515
141 Ga0207684_10056024 3300025910 Unclassified 3344
142 Ga0207684_10294743 3300025910 Bacteria 1398
143 Ga0207663_10088009 3300025916 Unclassified 2053
144 Ga0207646_10013921 3300025922 Bacteria 7667
145 Ga0207646_10065414 3300025922 Bacteria 3246
146 Ga0207681_10027745 3300025923 Bacteria 3663
147 Ga0207650_10076101 3300025925 Bacteria 2535
148 Ga0207659_10020595 3300025926 Bacteria 4362
149 Ga0207659_10116950 3300025926 Bacteria 2037
150 Ga0207644_10338073 3300025931 Bacteria 1220
151 Ga0207670_10024814 3300025936 Bacteria 3753
152 Ga0207669_10095984 3300025937 Bacteria 1945
153 Ga0207704_10099598 3300025938 Bacteria 1934
154 Ga0207691_10024919 3300025940 Bacteria 5622
155 Ga0207691_10129522 3300025940 Bacteria 2230
156 Ga0207651_10065537 3300025960 Bacteria 2548
157 Ga0207651_10184851 3300025960 Bacteria 1657
158 Ga0207712_10141117 3300025961 Bacteria 1849
159 Ga0207703_10078322 3300026035 Bacteria 2746
160 Ga0207708_10024903 3300026075 Bacteria 4527
161 Ga0207641_10111338 3300026088 Bacteria 2427
162 Ga0207648_10241877 3300026089 Bacteria 1607
163 Ga0207648_10310514 3300026089 Unclassified 1415
164 Ga0207676_10037223 3300026095 Bacteria 3707
165 Ga0207676_10072339 3300026095 Bacteria 2771
166 Ga0207675_100084093 3300026118 Unclassified 2986
167 Ga0268265_10122900 3300028380 Bacteria 2142
168 Ga0373935_0301770 3300035692 Bacteria 1132
169 Ga0373925_0094789 3300037068 Bacteria 2286
170 Ga0373925_0308110 3300037068 Bacteria 1280
171 Ga0395900_0013364 3300037418 Bacteria 8391
172 Ga0395898_0001814 3300037466 Bacteria 27572
173 Ga0395901_0000711 3300038443 Bacteria 38066
174 Ga0453683_0008086 3300044673 Bacteria 7078
175 Ga0453683_0017522 3300044673 Unclassified 4612
176 Ga0451576_0006484 3300045051 Bacteria 14340
177 Ga0495603_0136425 3300046455 Bacteria 1428
178 Ga0495670_0078730 3300046691 Bacteria 1677
179 Ga0496100_0077017 3300048903 Bacteria 2241
180 Ga0496100_0098786 3300048903 Bacteria 2007
181 Ga0496101_0005992 3300048904 Bacteria 7794
182 Ga0496102_0430769 3300048905 Bacteria 1238
183 Ga0496104_0010431 3300048907 Bacteria 8296
184 Ga0496104_0024168 3300048907 Bacteria 5590
185 Ga0496105_0023627 3300048908 Bacteria 4988
186 Ga0496106_0018372 3300048909 Bacteria 5167
187 Ga0496108_0008159 3300048911 Bacteria 8494
188 Ga0496108_0351795 3300048911 Unclassified 1286
189 Ga0496109_0107288 3300048912 Bacteria 2594
190 Ga0496109_0167114 3300048912 Bacteria 2063
191 Ga0496109_0240497 3300048912 Bacteria 1704
192 Ga0496110_0017755 3300048913 Bacteria 5953
193 Ga0496110_0463938 3300048913 Bacteria 1154
194 Ga0496112_0098308 3300048915 Bacteria 2896
195 Ga0496112_0103791 3300048915 Bacteria 2813
196 Ga0496112_0155328 3300048915 Bacteria 2255
197 Ga0496115_0096601 3300048918 Bacteria 2419
198 Ga0496115_0145997 3300048918 Bacteria 1952
199 Ga0496115_0349727 3300048918 Bacteria 1206
200 Ga0501031_0062543 3300049568 Bacteria 2426
201 Ga0501034_0250419 3300049571 Unclassified 1716
202 Ga0501036_0047044 3300049572 Bacteria 3653
203 Ga0501037_0016509 3300049573 Bacteria 5435
204 Ga0501038_0053241 3300049574 Bacteria 3485
205 Ga0501038_0066346 3300049574 Unclassified 3073
206 Ga0501039_0029340 3300049575 Bacteria 4237
207 Ga0501039_0193419 3300049575 Bacteria 1599
208 Ga0501040_0317127 3300049576 Unclassified 1115
209 Ga0501041_0020493 3300049577 Bacteria 3954
210 Ga0501043_0315120 3300049579 Bacteria 1193
211 Ga0501046_0060840 3300049580 Bacteria 2954
212 Ga0501046_0116143 3300049580 Bacteria 2040
213 Ga0501048_0041249 3300049582 Bacteria 3307
214 Ga0501048_0183352 3300049582 Bacteria 1484
215 Ga0501072_0017860 3300049588 Bacteria 5455
216 Ga0501072_0050146 3300049588 Bacteria 3287
217 Ga0501072_0213695 3300049588 Bacteria 1537
218 Ga0501072_0268354 3300049588 Bacteria 1358
219 Ga0501074_0004063 3300049590 Bacteria 10444
220 Ga0501074_0029577 3300049590 Bacteria 3968
221 Ga0501075_0037518 3300049591 Bacteria 3620
222 Ga0501075_0055730 3300049591 Bacteria 2975
223 Ga0501075_0113356 3300049591 Bacteria 2062
224 Ga0501075_0161336 3300049591 Bacteria 1710
225 Ga0501076_0005872 3300049592 Bacteria 8855
226 Ga0501076_0045811 3300049592 Plasmid 3454
227 Ga0501076_0145382 3300049592 Unclassified 1928
228 Ga0501076_0255544 3300049592 Bacteria 1434
229 Ga0501077_0013042 3300049593 Bacteria 5207
230 Ga0501077_0058518 3300049593 Unclassified 2446
231 Ga0501079_0048881 3300049741 Bacteria 3264
232 Ga0501079_0081516 3300049741 Bacteria 2502
233 Ga0501079_0164044 3300049741 Bacteria 1733
234 Ga0501080_0048794 3300049742 Bacteria 3939
235 Ga0501081_0012102 3300049743 Bacteria 5655
236 Ga0501081_0067679 3300049743 Unclassified 2486
237 Ga0501081_0110046 3300049743 Bacteria 1955
238 Ga0501081_0270564 3300049743 Unclassified 1243
239 Ga0501081_0301859 3300049743 Bacteria 1175
240 Ga0501035_0132246 3300049822 Unclassified 2174
241 Ga0501045_0048275 3300049824 Bacteria 3103
242 Ga0501045_0124257 3300049824 Unclassified 1916
243 nmdc:mga00v17_171927_c1 3300050491 Unclassified 1397
244 nmdc:mga0yw44_682_c1 3300050492 Bacteria 8213
245 nmdc:mga05p37_175985_c1 3300050507 Bacteria 2607
246 nmdc:mga05p37_200458_c1 3300050507 Bacteria 2418
247 nmdc:mga05p37_21902_c1 3300050507 Bacteria 7743
248 nmdc:mga05p37_24344_c1 3300050507 Bacteria 7357
249 nmdc:mga05p37_285559_c1 3300050507 Bacteria 1966
250 nmdc:mga05p37_31619_c1 3300050507 Bacteria 6466
251 nmdc:mga05p37_373261_c1 3300050507 Bacteria 1673
252 nmdc:mga05p37_515002_c1 3300050507 Unclassified 1370
253 nmdc:mga05p37_55552_c1 3300050507 Unclassified 4873
254 nmdc:mga05p37_58250_c1 3300050507 Bacteria 4758
255 nmdc:mga05p37_622822_c1 3300050507 Bacteria 1214
256 nmdc:mga09592_151594_c1 3300050508 Bacteria 2000
257 nmdc:mga09592_7004_c1 3300050508 Bacteria 9168
258 nmdc:mga0qj67_118_c1 3300050509 Bacteria 52561
259 nmdc:mga0qj67_213738_c1 3300050509 Unclassified 1566
260 nmdc:mga0qj67_34431_c1 3300050509 Bacteria 3956
261 nmdc:mga06r32_178313_c1 3300050510 Bacteria 2110
262 nmdc:mga06r32_22120_c1 3300050510 Bacteria 5875
263 nmdc:mga06r32_221451_c1 3300050510 Bacteria 1880
264 nmdc:mga06r32_30311_c1 3300050510 Bacteria 5076
265 nmdc:mga06r32_419357_c1 3300050510 Bacteria 1320
266 nmdc:mga06r32_65293_c1 3300050510 Plasmid 3510
267 nmdc:mga06r32_97398_c1 3300050510 Bacteria 2882
268 nmdc:mga08y16_1701_c1 3300050511 Bacteria 22306
269 nmdc:mga08y16_578303_c1 3300050511 Bacteria 1134
270 nmdc:mga0n895_142326_c1 3300050512 Unclassified 2427
271 nmdc:mga0n895_183057_c1 3300050512 Bacteria 2126
272 nmdc:mga0n895_203665_c1 3300050512 Bacteria 2009
273 nmdc:mga0n895_517964_c1 3300050512 Bacteria 1200
274 nmdc:mga0n895_777176_c1 3300050512 Unclassified 949
275 nmdc:mga0rr50_32376_c1 3300050513 Bacteria 3724
276 nmdc:mga0rr50_32576_c1 3300050513 Bacteria 3714
277 nmdc:mga0rr50_61816_c1 3300050513 Unclassified 2823
278 Ga0495655_0037003 3300053083 Bacteria 1223
279 Ga0501084_0040225 3300054114 Bacteria 3910
280 Ga0501084_0079911 3300054114 Bacteria 2741
281 Ga0501084_0258140 3300054114 Bacteria 1471
282 Ga0501082_0001646 3300060353 Bacteria 19690
283 Ga0501082_0071703 3300060353 Bacteria 2983
284 Ga0501082_0077120 3300060353 Bacteria 2873
285 Ga0501082_0093465 3300060353 Unclassified 2598
286 Ga0530510_0006907 3300061734 Bacteria 7914
287 Ga0530510_0040354 3300061734 Bacteria 3368
288 Ga0530510_0209513 3300061734 Bacteria 1448
289 Ga0530510_0275734 3300061734 Bacteria 1256
290 2841739597 2841734538 Bacteria 6784580
291 Ga0075430_100130540
292 Ga0058859_11266254
293 Ga0058860_10585609
294 Ga0065707_10095942
295 Ga0065707_10149757
296 Ga0070670_100122596
297 Ga0070670_100199252
298 Ga0068869_100075807
299 Ga0068868_100249838
300 Ga0070689_100274955
301 Ga0070692_10011293
302 Ga0070669_100019174
303 Ga0070675_100102181
304 Ga0070675_100118816
305 Ga0070675_100211595
306 Ga0070671_100382234
307 Ga0070674_100060055
308 Ga0070673_100150611
309 Ga0070673_100211330
310 Ga0070688_100143043
311 Ga0070667_100384319
312 Ga0070710_10020432
313 Ga0070711_100181857
314 Ga0070700_100010618
315 Ga0070708_100084080
316 Ga0070708_100112339
317 Ga0068867_100060360
318 Ga0068867_100098977
319 Ga0070706_100008991
320 Ga0070706_100075362
321 Ga0070706_100090651
322 Ga0070706_100133995
323 Ga0070706_100294356
324 Ga0070707_100014083
325 Ga0070707_100049311
326 Ga0070707_100144129
327 Ga0070698_100041260
328 Ga0070698_100116833
329 Ga0070698_100125890
330 Ga0070699_100038895
331 Ga0070699_100067790
332 Ga0070699_100112814
333 Ga0070699_100273930
334 Ga0070697_100009366
335 Ga0070697_100130321
336 Ga0070697_100270400
337 Ga0070672_100111297
338 Ga0070672_100126882
339 Ga0070696_100010824
340 Ga0070696_100171591
341 Ga0070665_100330127
342 Ga0070702_100213400
343 Ga0068859_100273762
344 Ga0068864_100075806
345 Ga0068864_100272466
346 Ga0068861_100043566
347 Ga0068870_10012843
348 Ga0068863_100036113
349 Ga0068863_100110143
350 Ga0068860_100565549
351 Ga0068862_100071670
352 Ga0081455_10018138
353 Ga0081455_10081278
354 Ga0081538_10085008
355 Ga0081540_1006301
356 Ga0081539_10000083
357 Ga0070717_10098606
358 Ga0070717_10319710
359 Ga0075365_10003132
360 Ga0097621_100170196
361 Ga0068871_100361665
362 Ga0075428_100015968
363 Ga0075428_100023315
364 Ga0075428_100040063
365 Ga0075428_100141892
366 Ga0075428_100155318
367 Ga0075428_100326520
368 Ga0075428_100389497
369 Ga0075428_100423049
370 Ga0075430_100000064
371 Ga0075431_100023614
372 Ga0075431_100080051
373 Ga0075431_100083845
374 Ga0075431_100086869
375 Ga0075431_100119452
376 Ga0075431_100150712
377 Ga0075433_10226298
378 Ga0075433_10279087
379 Ga0075434_100143081
380 Ga0075434_100391272
381 Ga0075434_100554988
382 Ga0075429_100024440
383 Ga0075429_100032171
384 Ga0075429_100088137
385 Ga0068865_100170624
386 Ga0068865_100252252
387 Ga0097620_100273793
388 Ga0075435_100033982
389 Ga0075435_100087024
390 Ga0075435_100127936
391 Ga0111539_10028413
392 Ga0111539_10186553
393 Ga0111539_10196624
394 Ga0111539_10265363
395 Ga0111539_10433366
396 Ga0111539_10646368
397 Ga0111539_10647982
398 Ga0105247_10067629
399 Ga0114129_10011325
400 Ga0114129_10017637
401 Ga0114129_10037722
402 Ga0114129_10142853
403 Ga0114129_10181116
404 Ga0114129_10185798
405 Ga0114129_10301301
406 Ga0114129_10351407
407 Ga0114129_10394769
408 Ga0114129_10440261
409 Ga0114129_10654714
410 Ga0105242_10219208
411 Ga0105248_10063339
412 Ga0105249_10317611
413 Ga0105239_10152881
414 Ga0157378_10109591
415 Ga0163162_10046241
416 Ga0163162_10210829
417 Ga0163162_10343991
418 Ga0157375_10047884
419 Ga0157375_10295725
420 Ga0163163_10018155
421 Ga0157380_10107535
422 Ga0157379_10012716
423 Ga0207697_10014615
424 Ga0207692_10016119
425 Ga0207688_10040076
426 Ga0207643_10027239
427 Ga0207643_10174972
428 Ga0207684_10012887
429 Ga0207684_10025882
430 Ga0207684_10050874
431 Ga0207684_10056024
432 Ga0207684_10294743
433 Ga0207663_10088009
434 Ga0207646_10013921
435 Ga0207646_10065414
436 Ga0207681_10027745
437 Ga0207650_10076101
438 Ga0207659_10020595
439 Ga0207659_10116950
440 Ga0207644_10338073
441 Ga0207670_10024814
442 Ga0207669_10095984
443 Ga0207704_10099598
444 Ga0207691_10024919
445 Ga0207691_10129522
446 Ga0207651_10065537
447 Ga0207651_10184851
448 Ga0207712_10141117
449 Ga0207703_10078322
450 Ga0207708_10024903
451 Ga0207641_10111338
452 Ga0207648_10241877
453 Ga0207648_10310514
454 Ga0207676_10037223
455 Ga0207676_10072339
456 Ga0207675_100084093
457 Ga0268265_10122900
458 Ga0373935_0301770
459 Ga0373925_0094789
460 Ga0373925_0308110
461 Ga0395900_0013364
462 Ga0395898_0001814
463 Ga0395901_0000711
464 Ga0453683_0008086
465 Ga0453683_0017522
466 Ga0451576_0006484
467 Ga0495603_0136425
468 Ga0495670_0078730
469 Ga0496100_0077017
470 Ga0496100_0098786
471 Ga0496101_0005992
472 Ga0496102_0430769
473 Ga0496104_0010431
474 Ga0496104_0024168
475 Ga0496105_0023627
476 Ga0496106_0018372
477 Ga0496108_0008159
478 Ga0496108_0351795
479 Ga0496109_0107288
480 Ga0496109_0167114
481 Ga0496109_0240497
482 Ga0496110_0017755
483 Ga0496110_0463938
484 Ga0496112_0098308
485 Ga0496112_0103791
486 Ga0496112_0155328
487 Ga0496115_0096601
488 Ga0496115_0145997
489 Ga0496115_0349727
490 Ga0501031_0062543
491 Ga0501034_0250419
492 Ga0501036_0047044
493 Ga0501037_0016509
494 Ga0501038_0053241
495 Ga0501038_0066346
496 Ga0501039_0029340
497 Ga0501039_0193419
498 Ga0501040_0317127
499 Ga0501041_0020493
500 Ga0501043_0315120
501 Ga0501046_0060840
502 Ga0501046_0116143
503 Ga0501048_0041249
504 Ga0501048_0183352
505 Ga0501072_0017860
506 Ga0501072_0050146
507 Ga0501072_0213695
508 Ga0501072_0268354
509 Ga0501074_0004063
510 Ga0501074_0029577
511 Ga0501075_0037518
512 Ga0501075_0055730
513 Ga0501075_0113356
514 Ga0501075_0161336
515 Ga0501076_0005872
516 Ga0501076_0045811
517 Ga0501076_0145382
518 Ga0501076_0255544
519 Ga0501077_0013042
520 Ga0501077_0058518
521 Ga0501079_0048881
522 Ga0501079_0081516
523 Ga0501079_0164044
524 Ga0501080_0048794
525 Ga0501081_0012102
526 Ga0501081_0067679
527 Ga0501081_0110046
528 Ga0501081_0270564
529 Ga0501081_0301859
530 Ga0501035_0132246
531 Ga0501045_0048275
532 Ga0501045_0124257
533 nmdc:mga00v17_171927_c1
534 nmdc:mga0yw44_682_c1
535 nmdc:mga05p37_175985_c1
536 nmdc:mga05p37_200458_c1
537 nmdc:mga05p37_21902_c1
538 nmdc:mga05p37_24344_c1
539 nmdc:mga05p37_285559_c1
540 nmdc:mga05p37_31619_c1
541 nmdc:mga05p37_373261_c1
542 nmdc:mga05p37_515002_c1
543 nmdc:mga05p37_55552_c1
544 nmdc:mga05p37_58250_c1
545 nmdc:mga05p37_622822_c1
546 nmdc:mga09592_151594_c1
547 nmdc:mga09592_7004_c1
548 nmdc:mga0qj67_118_c1
549 nmdc:mga0qj67_213738_c1
550 nmdc:mga0qj67_34431_c1
551 nmdc:mga06r32_178313_c1
552 nmdc:mga06r32_22120_c1
553 nmdc:mga06r32_221451_c1
554 nmdc:mga06r32_30311_c1
555 nmdc:mga06r32_419357_c1
556 nmdc:mga06r32_65293_c1
557 nmdc:mga06r32_97398_c1
558 nmdc:mga08y16_1701_c1
559 nmdc:mga08y16_578303_c1
560 nmdc:mga0n895_142326_c1
561 nmdc:mga0n895_183057_c1
562 nmdc:mga0n895_203665_c1
563 nmdc:mga0n895_517964_c1
564 nmdc:mga0n895_777176_c1
565 nmdc:mga0rr50_32376_c1
566 nmdc:mga0rr50_32576_c1
567 nmdc:mga0rr50_61816_c1
568 Ga0495655_0037003
569 Ga0501084_0040225
570 Ga0501084_0079911
571 Ga0501084_0258140
572 Ga0501082_0001646
573 Ga0501082_0071703
574 Ga0501082_0077120
575 Ga0501082_0093465
576 Ga0530510_0006907
577 Ga0530510_0040354
578 Ga0530510_0209513
579 Ga0530510_0275734
580 2841739597

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

65

295

0.91

PF09084

NMT1

NMT1/THI5 like

82

289

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.8231 40 336
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.8166 39 334
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8072 42 317
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7994 39 325
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.7989 44 317
ID Description Score Start End Superfamily
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8583 118 213 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8399 123 220 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8366 123 218 3.40.190.10
2g29A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8225 122 218 3.40.190.10
3l6hA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8121 42 97 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A441HUU6-F1-model_v4 ABC transporter substrate-binding protein 0.9447 18 337
AF-A0A534TRV2-F1-model_v4 ABC transporter substrate-binding protein 0.942 121 337
AF-A0A441HUU6-F1-model_v4 ABC transporter substrate-binding protein 0.936 18 337
AF-A0A534TRV2-F1-model_v4 ABC transporter substrate-binding protein 0.9334 121 337
AF-A0A3D4ABS5-F1-model_v4 Myristoyl transferase 0.9268 60 231 GO:0016740

Map