F394740

General Info

Members Datasets Scaffolds Average Seq Length
299 170 290 267

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100302120|Ga0068854_1003021202
Length 285
Sequence LSFLLIPDSYILTLIMKYMELFSLQGKTAIVTGALGLIGQKHCEALAMAGANVVAADMDEKKVEAFAANLGEQHGGLKIDVTSKHSLEVARDKITTRYGSIDILVNNAAINDMFENPAMAKELSAFENYPLAAFQQSLNVNVTGVFLCSQVFGTVMADQHSGSIINVASTYGMVGPDQSIYKNAQGEQDFYKSAAYPVTKGAVINFTRFLASYWGNKGVRVNTLSPGGVENNQNDFFVENYSAKTLLGRMAKANDYQGALIFLASDASAYMTGANLVVDGGWTAI

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
3 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
4 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
5 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
6 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
9 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
166 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
167 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
170 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.66
Metatranscriptomes 0
Isolates 3.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.37
Nodule 0
Rhizoplane 0.33
Rhizosphere 78.6
Stem 0
Stem Tuber 0
Unclassified 9.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008151 3300001979 Bacteria 4202
2 JGI24739J22299_10003490 3300001989 Bacteria 5997
3 JGI24739J22299_10003789 3300001989 Bacteria 5770
4 JGI24737J22298_10006835 3300001990 Bacteria 3876
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 JGI25162J39368_1000022 3300002737 Bacteria 239510
7 JGI25154J39366_1000065 3300002738 Bacteria 104126
8 JGI25165J46597_1006664 3300003214 Bacteria 2020
9 JGI25153J46596_10024957 3300003215 Unclassified 2145
10 rootH1_10003740 3300003316 Bacteria 21380
11 rootH1_10003740 3300003323 Bacteria 6583
12 rootH1_10038589 3300003316 Bacteria 3199
13 rootH2_10001891 3300003320 Bacteria 464318
14 rootH2_10188771 3300003320 Bacteria 3399
15 rootH2_10212390 3300003320 Bacteria 2296
16 rootL2_10100602 3300003322 Bacteria 17649
17 rootL2_10129275 3300003322 Bacteria 1304
18 rootL2_10137217 3300003322 Bacteria 2224
19 rootH1_10008609 3300003323 Bacteria 127787
20 rootH1_10045022 3300003323 Bacteria 11969
21 rootH1_10062657 3300003323 Bacteria 12665
22 rootH1_10296360 3300003323 Bacteria 1176
23 rootH1_10345465 3300003323 Unclassified 1071
24 JGI25160J50197_1000466 3300003354 Bacteria 25036
25 JGI25160J50197_1007202 3300003354 Bacteria 4382
26 Ga0055526_1011348 3300003771 Bacteria 4022
27 Ga0055526_1054104 3300003771 Bacteria 894
28 Ga0055528_1001114 3300003790 Bacteria 17623
29 Ga0055530_10001915 3300003791 Bacteria 14228
30 Ga0065165_1000328 3300005262 Bacteria 77624
31 Ga0065714_10003980 3300005288 Bacteria 6059
32 Ga0065714_10085016 3300005288 Bacteria 2168
33 Ga0070658_10000016 3300005327 Bacteria 228551
34 Ga0070658_10295314 3300005327 Bacteria 1381
35 Ga0068869_100573645 3300005334 Bacteria 950
36 Ga0070666_10006225 3300005335 Bacteria 7341
37 Ga0070680_100042670 3300005336 Bacteria 3681
38 Ga0068868_100037883 3300005338 Bacteria 3741
39 Ga0070660_100028712 3300005339 Bacteria 4164
40 Ga0070660_100042995 3300005339 Bacteria 3451
41 Ga0070671_100067002 3300005355 Bacteria 2993
42 Ga0070659_100000042 3300005366 Bacteria 103672
43 Ga0070659_100026396 3300005366 Bacteria 4470
44 Ga0070662_100000030 3300005457 Bacteria 81418
45 Ga0070681_10018416 3300005458 Bacteria 6979
46 Ga0070679_100037644 3300005530 Bacteria 4807
47 Ga0070684_100035107 3300005535 Bacteria 4290
48 Ga0068853_100147360 3300005539 Bacteria 2116
49 Ga0068853_100192311 3300005539 Bacteria 1854
50 Ga0068853_100525165 3300005539 Unclassified 1119
51 Ga0070665_100000001 3300005548 Bacteria 1083363
52 Ga0070665_100000267 3300005548 Bacteria 85526
53 Ga0068855_100000156 3300005563 Bacteria 86845
54 Ga0068855_100000426 3300005563 Bacteria 52084
55 Ga0068855_100013311 3300005563 Bacteria 9921
56 Ga0068855_100026098 3300005563 Bacteria 6989
57 Ga0068855_100156265 3300005563 Bacteria 2591
58 Ga0068855_100501425 3300005563 Bacteria 1319
59 Ga0068854_100302120 3300005578 Bacteria 1295
60 Ga0068856_100000030 3300005614 Bacteria 128494
61 Ga0068856_100145012 3300005614 Bacteria 2382
62 Ga0068856_100157348 3300005614 Bacteria 2282
63 Ga0068856_100216786 3300005614 Bacteria 1929
64 Ga0068856_100449072 3300005614 Bacteria 1310
65 Ga0068856_100752151 3300005614 Bacteria 995
66 Ga0068852_100168810 3300005616 Bacteria 2049
67 Ga0068852_100213158 3300005616 Bacteria 1833
68 Ga0068870_10218836 3300005840 Bacteria 1164
69 Ga0068858_100292748 3300005842 Bacteria 1552
70 Ga0068860_100000046 3300005843 Bacteria 214800
71 Ga0068860_100000880 3300005843 Bacteria 33319
72 Ga0075366_10000253 3300006195 Bacteria 23513
73 Ga0097621_100014452 3300006237 Bacteria 5907
74 Ga0068871_100000114 3300006358 Bacteria 49426
75 Ga0105240_10001726 3300009093 Bacteria 36894
76 Ga0105240_10009232 3300009093 Bacteria 13991
77 Ga0105240_10019752 3300009093 Bacteria 8999
78 Ga0105240_10069276 3300009093 Bacteria 4367
79 Ga0105240_10195249 3300009093 Bacteria 2377
80 Ga0105240_10196256 3300009093 Bacteria 2369
81 Ga0105240_10203995 3300009093 Bacteria 2315
82 Ga0105240_10232205 3300009093 Bacteria 2143
83 Ga0105240_10255065 3300009093 Bacteria 2026
84 Ga0105245_10165783 3300009098 Bacteria 2100
85 Ga0105241_10000611 3300009174 Bacteria 26865
86 Ga0105241_10111975 3300009174 Bacteria 2186
87 Ga0105241_10138375 3300009174 Bacteria 1980
88 Ga0105241_10422548 3300009174 Bacteria 1173
89 Ga0105237_10001092 3300009545 Bacteria 36314
90 Ga0105237_10016512 3300009545 Bacteria 7671
91 Ga0105237_10017951 3300009545 Bacteria 7331
92 Ga0105237_10076910 3300009545 Bacteria 3328
93 Ga0105238_10026482 3300009551 Bacteria 5913
94 Ga0105238_10615331 3300009551 Bacteria 1095
95 Ga0105239_10000002 3300010375 Bacteria 610298
96 Ga0105239_10000094 3300010375 Bacteria 124925
97 Ga0105239_10000908 3300010375 Bacteria 42116
98 Ga0105239_10001710 3300010375 Bacteria 28899
99 Ga0105239_10006661 3300010375 Bacteria 13357
100 Ga0105239_10017749 3300010375 Bacteria 7872
101 Ga0105239_10053273 3300010375 Bacteria 4438
102 Ga0105239_10154593 3300010375 Bacteria 2561
103 Ga0105239_10209975 3300010375 Bacteria 2182
104 Ga0157373_10000181 3300013100 Bacteria 51804
105 Ga0157371_10005955 3300013102 Bacteria 10178
106 Ga0157371_10021553 3300013102 Bacteria 4729
107 Ga0157371_10036743 3300013102 Bacteria 3508
108 Ga0157370_10563545 3300013104 Unclassified 1044
109 Ga0157370_10688530 3300013104 Unclassified 933
110 Ga0157369_10001695 3300013105 Bacteria 26849
111 Ga0157369_10067023 3300013105 Bacteria 3861
112 Ga0157374_10000203 3300013296 Bacteria 54699
113 Ga0157374_10445591 3300013296 Bacteria 1296
114 Ga0157378_10570096 3300013297 Unclassified 1140
115 Ga0163162_10000074 3300013306 Bacteria 91138
116 Ga0163162_10000674 3300013306 Bacteria 31727
117 Ga0163162_10001325 3300013306 Bacteria 23128
118 Ga0163162_10238631 3300013306 Bacteria 1948
119 Ga0157372_10000011 3300013307 Bacteria 277202
120 Ga0157372_10001233 3300013307 Bacteria 27695
121 Ga0157372_10009946 3300013307 Bacteria 10115
122 Ga0157372_10017266 3300013307 Bacteria 7748
123 Ga0157375_10003586 3300013308 Bacteria 13472
124 Ga0157375_10905343 3300013308 Bacteria 1026
125 Ga0157377_10010860 3300014745 Bacteria 4523
126 Ga0182007_10045537 3300015262 Bacteria 1454
127 Ga0213872_10078825 3300021361 Bacteria 1480
128 Ga0207427_100098 3300025231 Bacteria 122817
129 Ga0209437_100008 3300025233 Bacteria 921142
130 Ga0209437_100024 3300025233 Bacteria 592878
131 Ga0209646_1000002 3300025246 Bacteria 1425781
132 Ga0209026_1001366 3300025250 Bacteria 10894
133 Ga0209026_1001914 3300025250 Bacteria 8428
134 Ga0209233_1000024 3300025261 Bacteria 695418
135 Ga0209455_1000960 3300025272 Bacteria 14685
136 Ga0209455_1006159 3300025272 Bacteria 3587
137 Ga0209673_1000464 3300025273 Bacteria 68394
138 Ga0209564_1004557 3300025295 Bacteria 8409
139 Ga0209758_1001454 3300025297 Bacteria 27809
140 Ga0209758_1012321 3300025297 Bacteria 4799
141 Ga0209758_1039682 3300025297 Bacteria 1787
142 Ga0209050_1000591 3300025298 Bacteria 57888
143 Ga0207426_1001316 3300025302 Bacteria 21180
144 Ga0207426_1004769 3300025302 Bacteria 6452
145 Ga0207426_1005172 3300025302 Bacteria 6065
146 Ga0209257_1003580 3300025304 Bacteria 13155
147 Ga0207680_10063734 3300025903 Bacteria 2257
148 Ga0207647_10000247 3300025904 Bacteria 44109
149 Ga0207705_10000031 3300025909 Bacteria 228571
150 Ga0207705_10038651 3300025909 Bacteria 3418
151 Ga0207654_10002517 3300025911 Bacteria 9311
152 Ga0207707_10102543 3300025912 Bacteria 2501
153 Ga0207707_10518854 3300025912 Unclassified 1015
154 Ga0207695_10007617 3300025913 Bacteria 13720
155 Ga0207695_10016874 3300025913 Bacteria 8522
156 Ga0207695_10041846 3300025913 Unclassified 4900
157 Ga0207695_10147548 3300025913 Bacteria 2294
158 Ga0207695_10158617 3300025913 Bacteria 2195
159 Ga0207695_10244597 3300025913 Bacteria 1694
160 Ga0207695_10332626 3300025913 Bacteria 1407
161 Ga0207695_10412279 3300025913 Bacteria 1235
162 Ga0207671_10003164 3300025914 Bacteria 16641
163 Ga0207671_10003885 3300025914 Bacteria 14585
164 Ga0207671_10030069 3300025914 Bacteria 4052
165 Ga0207671_10114003 3300025914 Unclassified 2060
166 Ga0207671_10188485 3300025914 Bacteria 1607
167 Ga0207657_10047850 3300025919 Bacteria 3736
168 Ga0207652_10035917 3300025921 Bacteria 4187
169 Ga0207694_10041428 3300025924 Bacteria 3549
170 Ga0207687_10156202 3300025927 Bacteria 1745
171 Ga0207644_10086693 3300025931 Bacteria 2325
172 Ga0207690_10000289 3300025932 Bacteria 35735
173 Ga0207690_10098701 3300025932 Bacteria 2081
174 Ga0207706_10000129 3300025933 Bacteria 81280
175 Ga0207689_10643194 3300025942 Unclassified 893
176 Ga0207667_10000070 3300025949 Bacteria 180479
177 Ga0207667_10019861 3300025949 Bacteria 7486
178 Ga0207667_10063883 3300025949 Bacteria 3846
179 Ga0207667_10126176 3300025949 Bacteria 2636
180 Ga0207667_10142896 3300025949 Bacteria 2464
181 Ga0207667_10381199 3300025949 Bacteria 1437
182 Ga0207640_10324590 3300025981 Bacteria 1227
183 Ga0207677_10018574 3300026023 Bacteria 4175
184 Ga0207639_10005257 3300026041 Bacteria 8734
185 Ga0207639_10174264 3300026041 Bacteria 1824
186 Ga0207702_10119347 3300026078 Bacteria 2358
187 Ga0207702_10175942 3300026078 Unclassified 1966
188 Ga0207702_10178317 3300026078 Bacteria 1955
189 Ga0207698_10261205 3300026142 Bacteria 1591
190 Ga0268266_10000018 3300028379 Bacteria 569141
191 Ga0268266_10000049 3300028379 Bacteria 307763
192 Ga0268264_10000041 3300028381 Bacteria 372501
193 Ga0268264_10001773 3300028381 Bacteria 19737
194 Ga0307515_10000280 3300028794 Bacteria 125330
195 Ga0307515_10001599 3300028794 Bacteria 50542
196 Ga0265338_10099187 3300028800 Bacteria 2380
197 Ga0307513_10145592 3300031456 Bacteria 2287
198 Ga0307509_10048922 3300031507 Bacteria 4537
199 Ga0316576_10018963 3300031727 Bacteria 4706
200 Ga0316576_10112750 3300031727 Bacteria 2039
201 Ga0307411_10035293 3300032005 Bacteria 3121
202 Ga0316585_10078643 3300032137 Bacteria 1074
203 Ga0307507_10000362 3300033179 Bacteria 93053
204 Ga0316574_0004423 3300035398 Bacteria 7362
205 Ga0316584_0046811 3300036712 Unclassified 3231
206 Ga0316584_0091439 3300036712 Bacteria 2278
207 Ga0395899_0000001 3300037312 Bacteria 1750322
208 Ga0395899_0000188 3300037312 Bacteria 90869
209 Ga0395899_0000817 3300037312 Bacteria 30278
210 Ga0395899_0047288 3300037312 Bacteria 3204
211 Ga0395900_0000204 3300037418 Bacteria 92834
212 Ga0395900_0000231 3300037418 Bacteria 87314
213 Ga0395900_0003219 3300037418 Bacteria 17678
214 Ga0395900_0116573 3300037418 Bacteria 2741
215 Ga0395898_0031241 3300037466 Bacteria 5323
216 Ga0395905_0000261 3300037471 Bacteria 78643
217 Ga0395905_0002418 3300037471 Bacteria 20716
218 Ga0395901_0006103 3300038443 Bacteria 12209
219 Ga0395901_0013548 3300038443 Bacteria 8291
220 Ga0436361_1007234 3300039447 Bacteria 7324
221 Ga0466966_0003383 3300044684 Bacteria 10518
222 Ga0453684_0000912 3300044712 Bacteria 98180
223 Ga0466959_0050152 3300045049 Bacteria 3065
224 Ga0466959_0056181 3300045049 Bacteria 2873
225 Ga0466958_0022337 3300045836 Bacteria 3705
226 Ga0495638_0055154 3300046460 Bacteria 2469
227 Ga0495650_0000014 3300046471 Bacteria 581606
228 Ga0495585_0001470 3300046492 Bacteria 18428
229 Ga0495585_0009072 3300046492 Bacteria 5991
230 Ga0495606_0000096 3300046507 Bacteria 151500
231 Ga0495606_0034077 3300046507 Bacteria 3500
232 Ga0495606_0038982 3300046507 Bacteria 3209
233 Ga0495606_0065120 3300046507 Bacteria 2317
234 Ga0495610_0006961 3300046512 Bacteria 7655
235 Ga0495616_0003896 3300046513 Bacteria 9511
236 Ga0495616_0044520 3300046513 Bacteria 2250
237 Ga0495648_0000874 3300046524 Bacteria 31750
238 Ga0495648_0027243 3300046524 Bacteria 3830
239 Ga0495648_0027288 3300046524 Bacteria 3825
240 Ga0495663_0069430 3300046525 Bacteria 1120
241 Ga0495609_0045628 3300046538 Bacteria 1963
242 Ga0495622_0072600 3300046557 Bacteria 1588
243 Ga0495633_0000156 3300046558 Bacteria 89387
244 Ga0495633_0008651 3300046558 Bacteria 5715
245 Ga0495668_0000021 3300046616 Bacteria 381308
246 Ga0495668_0044204 3300046616 Bacteria 2476
247 Ga0495625_0000003 3300046660 Bacteria 686847
248 Ga0495625_0000222 3300046660 Bacteria 89536
249 Ga0495625_0001554 3300046660 Bacteria 27355
250 Ga0495625_0124633 3300046660 Bacteria 1750
251 Ga0495625_0210420 3300046660 Bacteria 1278
252 Ga0495625_0236271 3300046660 Bacteria 1192
253 Ga0495661_0004785 3300046665 Bacteria 9713
254 Ga0495661_0023020 3300046665 Bacteria 4049
255 Ga0495671_0231094 3300046692 Bacteria 894
256 Ga0495649_0000002 3300046694 Bacteria 1093458
257 Ga0495660_0250990 3300046810 Bacteria 820
258 Ga0495687_000001 3300047443 Bacteria 1215582
259 Ga0495687_003262 3300047443 Bacteria 11964
260 Ga0495673_0094277 3300047469 Bacteria 1219
261 Ga0495686_0000098 3300047472 Bacteria 183131
262 Ga0495686_0001302 3300047472 Bacteria 28111
263 Ga0495686_0048148 3300047472 Bacteria 2689
264 Ga0495686_0061886 3300047472 Bacteria 2323
265 Ga0495678_009352 3300049459 Bacteria 4856
266 Ga0501031_0106598 3300049568 Bacteria 1829
267 Ga0501032_0078355 3300049569 Bacteria 2200
268 Ga0501037_0200113 3300049573 Bacteria 1412
269 Ga0501038_0133540 3300049574 Bacteria 2035
270 Ga0501039_0034058 3300049575 Bacteria 3930
271 Ga0501040_0020552 3300049576 Bacteria 4401
272 Ga0501042_0047252 3300049578 Bacteria 3069
273 Ga0501043_0119170 3300049579 Bacteria 2070
274 Ga0501048_0028494 3300049582 Bacteria 4054
275 Ga0501071_0007930 3300049587 Bacteria 7004
276 Ga0501072_0027087 3300049588 Bacteria 4472
277 Ga0501075_0105060 3300049591 Bacteria 2146
278 Ga0501076_0039172 3300049592 Bacteria 3721
279 Ga0501079_0061471 3300049741 Bacteria 2897
280 Ga0501081_0010442 3300049743 Bacteria 6058
281 Ga0501045_0017215 3300049824 Bacteria 5130
282 nmdc:mga0k408_331_c2 3300050493 Bacteria 18506
283 Ga0500608_053421 3300053122 Bacteria 1940
284 Ga0500618_000023 3300053125 Bacteria 152444
285 Ga0500618_049056 3300053125 Bacteria 958
286 Ga0500579_093217 3300053143 Bacteria 1613
287 Ga0500619_090367 3300053154 Bacteria 1034
288 Ga0500624_001418 3300053157 Bacteria 3930
289 Ga0501084_0013774 3300054114 Bacteria 6692
290 Ga0530510_0009433 3300061734 Bacteria 6845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046810 Ga0495660_0250990 Ga0495660_0250990_33_800 242
2 3300049592 Ga0501076_0039172 Ga0501076_0039172_142_996 246
3 3300013104 Ga0157370_10563545 Ga0157370_105635452 250
4 3300044684 Ga0466966_0003383 Ga0466966_0003383_8291_9100 250
5 3300045049 Ga0466959_0056181 Ga0466959_0056181_671_1480 250
6 3300045836 Ga0466958_0022337 Ga0466958_0022337_121_930 250
7 3300003323 rootH1_10296360 rootH1_102963601 252
8 iso_pu_bacteria 2925326138 2925330645 252
9 iso_pu_bacteria 2980182181 2980183221 252
10 3300028794 Ga0307515_10000280 Ga0307515_1000028082 255
11 3300033179 Ga0307507_10000362 Ga0307507_1000036240 255
12 3300009093 Ga0105240_10203995 Ga0105240_102039952 256
13 3300025913 Ga0207695_10332626 Ga0207695_103326262 256
14 3300028794 Ga0307515_10001599 Ga0307515_100015997 256
15 3300046492 Ga0495585_0001470 Ga0495585_0001470_8538_9344 256
16 3300046524 Ga0495648_0000874 Ga0495648_0000874_25016_25822 256
17 3300046524 Ga0495648_0027288 Ga0495648_0027288_90_896 256
18 3300046525 Ga0495663_0069430 Ga0495663_0069430_193_999 256
19 3300046538 Ga0495609_0045628 Ga0495609_0045628_78_884 256
20 3300046557 Ga0495622_0072600 Ga0495622_0072600_74_880 256
21 3300046616 Ga0495668_0000021 Ga0495668_0000021_33811_34617 256
22 3300046660 Ga0495625_0000222 Ga0495625_0000222_33104_33910 256
23 3300053154 Ga0500619_090367 Ga0500619_090367_142_948 256
24 3300003323 rootH1_10008609 rootH1_1000860952 257
25 3300002738 JGI25154J39366_1000065 JGI25154J39366_100006528 258
26 3300003215 JGI25153J46596_10024957 JGI25153J46596_100249573 258
27 3300003354 JGI25160J50197_1007202 JGI25160J50197_10072024 258
28 3300005614 Ga0068856_100216786 Ga0068856_1002167863 258
29 3300025246 Ga0209646_1000002 Ga0209646_10000021153 258
30 3300025250 Ga0209026_1001914 Ga0209026_10019143 258
31 3300025297 Ga0209758_1012321 Ga0209758_10123216 258
32 3300025302 Ga0207426_1004769 Ga0207426_10047696 258
33 3300026078 Ga0207702_10178317 Ga0207702_101783173 258
34 3300049568 Ga0501031_0106598 Ga0501031_0106598_835_1689 258
35 3300049569 Ga0501032_0078355 Ga0501032_0078355_1016_1870 258
36 3300049573 Ga0501037_0200113 Ga0501037_0200113_418_1272 258
37 3300049574 Ga0501038_0133540 Ga0501038_0133540_522_1376 258
38 3300049575 Ga0501039_0034058 Ga0501039_0034058_2285_3139 258
39 3300049576 Ga0501040_0020552 Ga0501040_0020552_957_1811 258
40 3300049578 Ga0501042_0047252 Ga0501042_0047252_1463_2317 258
41 3300049579 Ga0501043_0119170 Ga0501043_0119170_159_1013 258
42 3300049582 Ga0501048_0028494 Ga0501048_0028494_1244_2098 258
43 3300049587 Ga0501071_0007930 Ga0501071_0007930_2351_3205 258
44 3300049588 Ga0501072_0027087 Ga0501072_0027087_45_899 258
45 3300049591 Ga0501075_0105060 Ga0501075_0105060_140_994 258
46 3300049741 Ga0501079_0061471 Ga0501079_0061471_799_1653 258
47 3300049824 Ga0501045_0017215 Ga0501045_0017215_3996_4850 258
48 3300054114 Ga0501084_0013774 Ga0501084_0013774_1907_2761 258
49 3300061734 Ga0530510_0009433 Ga0530510_0009433_4747_5601 258
50 3300003320 rootH2_10188771 rootH2_101887714 262
51 3300010375 Ga0105239_10154593 Ga0105239_101545933 262
52 3300031727 Ga0316576_10018963 Ga0316576_100189634 262
53 iso_pu_bacteria 2599185184 2599478494 263
54 iso_pu_bacteria 2919437846 2919442124 263
55 iso_pu_bacteria 2928078545 2928080454 263
56 iso_pu_bacteria 2928147474 2928149374 263
57 iso_pu_bacteria 2929921140 2929923829 263
58 iso_pu_bacteria 2932082852 2932083203 263
59 iso_pu_bacteria 8003151029 8003153534 263
60 3300031727 Ga0316576_10112750 Ga0316576_101127503 264
61 3300035398 Ga0316574_0004423 Ga0316574_0004423_1295_2089 264
62 iso_pu_bacteria 2977232053 2977236745 264
63 3300010375 Ga0105239_10209975 Ga0105239_102099753 265
64 3300032005 Ga0307411_10035293 Ga0307411_100352934 265
65 3300044712 Ga0453684_0000912 Ga0453684_0000912_7699_8496 265
66 3300049743 Ga0501081_0010442 Ga0501081_0010442_1041_1895 265
67 3300001989 JGI24739J22299_10003490 JGI24739J22299_100034902 267
68 3300001989 JGI24739J22299_10003789 JGI24739J22299_100037898 267
69 3300001990 JGI24737J22298_10006835 JGI24737J22298_100068354 267
70 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002461 267
71 3300002737 JGI25162J39368_1000022 JGI25162J39368_100002243 267
72 3300003214 JGI25165J46597_1006664 JGI25165J46597_10066642 267
73 3300003316 rootH1_10003740 rootH1_1000374010 267
74 3300003320 rootH2_10001891 rootH2_10001891378 267
75 3300003320 rootH2_10212390 rootH2_102123903 267
76 3300003322 rootL2_10100602 rootL2_101006023 267
77 3300003322 rootL2_10137217 rootL2_101372172 267
78 3300003323 rootH1_10045022 rootH1_100450229 267
79 3300003323 rootH1_10062657 rootH1_100626572 267
80 3300003323 rootH1_10345465 rootH1_103454652 267
81 3300003354 JGI25160J50197_1000466 JGI25160J50197_100046619 267
82 3300003771 Ga0055526_1011348 Ga0055526_10113481 267
83 3300003771 Ga0055526_1054104 Ga0055526_10541041 267
84 3300003790 Ga0055528_1001114 Ga0055528_10011148 267
85 3300003791 Ga0055530_10001915 Ga0055530_1000191514 267
86 3300005262 Ga0065165_1000328 Ga0065165_100032811 267
87 3300005288 Ga0065714_10085016 Ga0065714_100850162 267
88 3300005327 Ga0070658_10000016 Ga0070658_10000016168 267
89 3300005327 Ga0070658_10295314 Ga0070658_102953141 267
90 3300005334 Ga0068869_100573645 Ga0068869_1005736452 267
91 3300005335 Ga0070666_10006225 Ga0070666_100062252 267
92 3300005336 Ga0070680_100042670 Ga0070680_1000426703 267
93 3300005338 Ga0068868_100037883 Ga0068868_1000378832 267
94 3300005339 Ga0070660_100028712 Ga0070660_1000287122 267
95 3300005339 Ga0070660_100042995 Ga0070660_1000429952 267
96 3300005355 Ga0070671_100067002 Ga0070671_1000670022 267
97 3300005366 Ga0070659_100000042 Ga0070659_10000004239 267
98 3300005366 Ga0070659_100026396 Ga0070659_1000263962 267
99 3300005457 Ga0070662_100000030 Ga0070662_10000003086 267
100 3300005458 Ga0070681_10018416 Ga0070681_100184162 267
101 3300005530 Ga0070679_100037644 Ga0070679_1000376445 267
102 3300005535 Ga0070684_100035107 Ga0070684_1000351072 267
103 3300005539 Ga0068853_100147360 Ga0068853_1001473602 267
104 3300005539 Ga0068853_100192311 Ga0068853_1001923112 267
105 3300005539 Ga0068853_100525165 Ga0068853_1005251652 267
106 3300005548 Ga0070665_100000001 Ga0070665_100000001827 267
107 3300005548 Ga0070665_100000267 Ga0070665_10000026746 267
108 3300005563 Ga0068855_100000156 Ga0068855_10000015641 267
109 3300005563 Ga0068855_100000426 Ga0068855_10000042623 267
110 3300005563 Ga0068855_100013311 Ga0068855_1000133112 267
111 3300005563 Ga0068855_100026098 Ga0068855_1000260985 267
112 3300005563 Ga0068855_100156265 Ga0068855_1001562652 267
113 3300005563 Ga0068855_100501425 Ga0068855_1005014251 267
114 3300005614 Ga0068856_100000030 Ga0068856_100000030124 267
115 3300005614 Ga0068856_100145012 Ga0068856_1001450121 267
116 3300005614 Ga0068856_100157348 Ga0068856_1001573482 267
117 3300005614 Ga0068856_100449072 Ga0068856_1004490722 267
118 3300005614 Ga0068856_100752151 Ga0068856_1007521511 267
119 3300005616 Ga0068852_100168810 Ga0068852_1001688102 267
120 3300005840 Ga0068870_10218836 Ga0068870_102188362 267
121 3300005842 Ga0068858_100292748 Ga0068858_1002927482 267
122 3300005843 Ga0068860_100000046 Ga0068860_100000046135 267
123 3300005843 Ga0068860_100000880 Ga0068860_10000088011 267
124 3300006237 Ga0097621_100014452 Ga0097621_1000144522 267
125 3300006358 Ga0068871_100000114 Ga0068871_10000011430 267
126 3300009093 Ga0105240_10001726 Ga0105240_1000172637 267
127 3300009093 Ga0105240_10009232 Ga0105240_100092323 267
128 3300009093 Ga0105240_10019752 Ga0105240_100197526 267
129 3300009093 Ga0105240_10069276 Ga0105240_100692762 267
130 3300009093 Ga0105240_10195249 Ga0105240_101952492 267
131 3300009093 Ga0105240_10196256 Ga0105240_101962562 267
132 3300009093 Ga0105240_10232205 Ga0105240_102322052 267
133 3300009093 Ga0105240_10255065 Ga0105240_102550652 267
134 3300009098 Ga0105245_10165783 Ga0105245_101657832 267
135 3300009174 Ga0105241_10000611 Ga0105241_100006117 267
136 3300009174 Ga0105241_10138375 Ga0105241_101383752 267
137 3300009174 Ga0105241_10422548 Ga0105241_104225482 267
138 3300009545 Ga0105237_10001092 Ga0105237_100010925 267
139 3300009545 Ga0105237_10017951 Ga0105237_100179517 267
140 3300009545 Ga0105237_10076910 Ga0105237_100769102 267
141 3300009551 Ga0105238_10026482 Ga0105238_100264822 267
142 3300010375 Ga0105239_10000002 Ga0105239_10000002538 267
143 3300010375 Ga0105239_10000094 Ga0105239_1000009443 267
144 3300010375 Ga0105239_10000908 Ga0105239_1000090823 267
145 3300010375 Ga0105239_10001710 Ga0105239_100017108 267
146 3300010375 Ga0105239_10006661 Ga0105239_100066616 267
147 3300010375 Ga0105239_10017749 Ga0105239_100177497 267
148 3300010375 Ga0105239_10053273 Ga0105239_100532732 267
149 3300013100 Ga0157373_10000181 Ga0157373_100001819 267
150 3300013102 Ga0157371_10021553 Ga0157371_100215533 267
151 3300013102 Ga0157371_10036743 Ga0157371_100367433 267
152 3300013104 Ga0157370_10688530 Ga0157370_106885301 267
153 3300013105 Ga0157369_10067023 Ga0157369_100670233 267
154 3300013296 Ga0157374_10000203 Ga0157374_1000020354 267
155 3300013296 Ga0157374_10445591 Ga0157374_104455912 267
156 3300013297 Ga0157378_10570096 Ga0157378_105700962 267
157 3300013306 Ga0163162_10000074 Ga0163162_1000007427 267
158 3300013306 Ga0163162_10000674 Ga0163162_1000067418 267
159 3300013306 Ga0163162_10001325 Ga0163162_1000132513 267
160 3300013306 Ga0163162_10238631 Ga0163162_102386312 267
161 3300013307 Ga0157372_10001233 Ga0157372_1000123314 267
162 3300013307 Ga0157372_10009946 Ga0157372_100099464 267
163 3300013307 Ga0157372_10017266 Ga0157372_100172667 267
164 3300013308 Ga0157375_10003586 Ga0157375_100035865 267
165 3300013308 Ga0157375_10905343 Ga0157375_109053431 267
166 3300014745 Ga0157377_10010860 Ga0157377_100108602 267
167 3300015262 Ga0182007_10045537 Ga0182007_100455372 267
168 3300021361 Ga0213872_10078825 Ga0213872_100788251 267
169 3300025231 Ga0207427_100098 Ga0207427_10009874 267
170 3300025233 Ga0209437_100008 Ga0209437_100008246 267
171 3300025233 Ga0209437_100024 Ga0209437_100024356 267
172 3300025250 Ga0209026_1001366 Ga0209026_10013668 267
173 3300025261 Ga0209233_1000024 Ga0209233_1000024413 267
174 3300025272 Ga0209455_1006159 Ga0209455_10061594 267
175 3300025273 Ga0209673_1000464 Ga0209673_100046445 267
176 3300025295 Ga0209564_1004557 Ga0209564_10045575 267
177 3300025297 Ga0209758_1001454 Ga0209758_100145410 267
178 3300025297 Ga0209758_1039682 Ga0209758_10396822 267
179 3300025298 Ga0209050_1000591 Ga0209050_100059112 267
180 3300025302 Ga0207426_1001316 Ga0207426_100131617 267
181 3300025302 Ga0207426_1005172 Ga0207426_10051724 267
182 3300025304 Ga0209257_1003580 Ga0209257_100358014 267
183 3300025903 Ga0207680_10063734 Ga0207680_100637343 267
184 3300025904 Ga0207647_10000247 Ga0207647_1000024749 267
185 3300025909 Ga0207705_10000031 Ga0207705_10000031170 267
186 3300025909 Ga0207705_10038651 Ga0207705_100386513 267
187 3300025911 Ga0207654_10002517 Ga0207654_100025173 267
188 3300025912 Ga0207707_10102543 Ga0207707_101025432 267
189 3300025912 Ga0207707_10518854 Ga0207707_105188541 267
190 3300025913 Ga0207695_10007617 Ga0207695_100076173 267
191 3300025913 Ga0207695_10016874 Ga0207695_100168747 267
192 3300025913 Ga0207695_10041846 Ga0207695_100418462 267
193 3300025913 Ga0207695_10147548 Ga0207695_101475482 267
194 3300025913 Ga0207695_10158617 Ga0207695_101586172 267
195 3300025913 Ga0207695_10244597 Ga0207695_102445972 267
196 3300025914 Ga0207671_10003885 Ga0207671_1000388513 267
197 3300025914 Ga0207671_10030069 Ga0207671_100300692 267
198 3300025914 Ga0207671_10114003 Ga0207671_101140032 267
199 3300025914 Ga0207671_10188485 Ga0207671_101884852 267
200 3300025919 Ga0207657_10047850 Ga0207657_100478503 267
201 3300025921 Ga0207652_10035917 Ga0207652_100359173 267
202 3300025924 Ga0207694_10041428 Ga0207694_100414283 267
203 3300025927 Ga0207687_10156202 Ga0207687_101562022 267
204 3300025931 Ga0207644_10086693 Ga0207644_100866932 267
205 3300025932 Ga0207690_10000289 Ga0207690_100002892 267
206 3300025932 Ga0207690_10098701 Ga0207690_100987012 267
207 3300025933 Ga0207706_10000129 Ga0207706_100001295 267
208 3300025942 Ga0207689_10643194 Ga0207689_106431941 267
209 3300025949 Ga0207667_10000070 Ga0207667_1000007040 267
210 3300025949 Ga0207667_10019861 Ga0207667_100198615 267
211 3300025949 Ga0207667_10063883 Ga0207667_100638833 267
212 3300025949 Ga0207667_10126176 Ga0207667_101261762 267
213 3300025949 Ga0207667_10142896 Ga0207667_101428962 267
214 3300026023 Ga0207677_10018574 Ga0207677_100185742 267
215 3300026041 Ga0207639_10005257 Ga0207639_100052579 267
216 3300026041 Ga0207639_10174264 Ga0207639_101742642 267
217 3300026078 Ga0207702_10119347 Ga0207702_101193471 267
218 3300026078 Ga0207702_10175942 Ga0207702_101759422 267
219 3300028379 Ga0268266_10000018 Ga0268266_10000018451 267
220 3300028379 Ga0268266_10000049 Ga0268266_10000049188 267
221 3300028381 Ga0268264_10000041 Ga0268264_10000041192 267
222 3300028381 Ga0268264_10001773 Ga0268264_1000177319 267
223 3300028800 Ga0265338_10099187 Ga0265338_100991872 267
224 3300031456 Ga0307513_10145592 Ga0307513_101455923 267
225 3300031507 Ga0307509_10048922 Ga0307509_100489222 267
226 3300032137 Ga0316585_10078643 Ga0316585_100786432 267
227 3300036712 Ga0316584_0046811 Ga0316584_0046811_1088_1897 267
228 3300036712 Ga0316584_0091439 Ga0316584_0091439_1236_2060 267
229 3300037312 Ga0395899_0000001 Ga0395899_0000001_740007_740810 267
230 3300037312 Ga0395899_0000817 Ga0395899_0000817_18921_19724 267
231 3300037312 Ga0395899_0047288 Ga0395899_0047288_912_1715 267
232 3300037418 Ga0395900_0000204 Ga0395900_0000204_41598_42401 267
233 3300037418 Ga0395900_0000231 Ga0395900_0000231_76249_77052 267
234 3300037418 Ga0395900_0003219 Ga0395900_0003219_14067_14870 267
235 3300037418 Ga0395900_0116573 Ga0395900_0116573_1731_2534 267
236 3300037466 Ga0395898_0031241 Ga0395898_0031241_575_1378 267
237 3300037471 Ga0395905_0000261 Ga0395905_0000261_76243_77046 267
238 3300037471 Ga0395905_0002418 Ga0395905_0002418_17919_18722 267
239 3300038443 Ga0395901_0006103 Ga0395901_0006103_3053_3856 267
240 3300038443 Ga0395901_0013548 Ga0395901_0013548_6274_7077 267
241 3300039447 Ga0436361_1007234 Ga0436361_1007234_5850_6653 267
242 3300045049 Ga0466959_0050152 Ga0466959_0050152_1915_2718 267
243 3300046460 Ga0495638_0055154 Ga0495638_0055154_45_848 267
244 3300046471 Ga0495650_0000014 Ga0495650_0000014_164824_165627 267
245 3300046492 Ga0495585_0009072 Ga0495585_0009072_2336_3139 267
246 3300046507 Ga0495606_0000096 Ga0495606_0000096_66263_67066 267
247 3300046507 Ga0495606_0034077 Ga0495606_0034077_1029_1832 267
248 3300046507 Ga0495606_0038982 Ga0495606_0038982_320_1123 267
249 3300046507 Ga0495606_0065120 Ga0495606_0065120_892_1695 267
250 3300046512 Ga0495610_0006961 Ga0495610_0006961_4608_5411 267
251 3300046513 Ga0495616_0003896 Ga0495616_0003896_5187_5990 267
252 3300046513 Ga0495616_0044520 Ga0495616_0044520_16_819 267
253 3300046558 Ga0495633_0008651 Ga0495633_0008651_3319_4122 267
254 3300046616 Ga0495668_0044204 Ga0495668_0044204_697_1500 267
255 3300046660 Ga0495625_0000003 Ga0495625_0000003_69912_70715 267
256 3300046660 Ga0495625_0124633 Ga0495625_0124633_234_1037 267
257 3300046660 Ga0495625_0210420 Ga0495625_0210420_28_831 267
258 3300046660 Ga0495625_0236271 Ga0495625_0236271_47_850 267
259 3300046665 Ga0495661_0004785 Ga0495661_0004785_204_1007 267
260 3300046665 Ga0495661_0023020 Ga0495661_0023020_3158_3961 267
261 3300046692 Ga0495671_0231094 Ga0495671_0231094_46_849 267
262 3300046694 Ga0495649_0000002 Ga0495649_0000002_936249_937052 267
263 3300047443 Ga0495687_000001 Ga0495687_000001_229717_230520 267
264 3300047443 Ga0495687_003262 Ga0495687_003262_2851_3654 267
265 3300047469 Ga0495673_0094277 Ga0495673_0094277_13_816 267
266 3300047472 Ga0495686_0000098 Ga0495686_0000098_177292_178095 267
267 3300047472 Ga0495686_0001302 Ga0495686_0001302_1366_2169 267
268 3300047472 Ga0495686_0048148 Ga0495686_0048148_298_1101 267
269 3300047472 Ga0495686_0061886 Ga0495686_0061886_12_815 267
270 3300049459 Ga0495678_009352 Ga0495678_009352_3802_4605 267
271 3300053125 Ga0500618_049056 Ga0500618_049056_26_829 267
272 3300053143 Ga0500579_093217 Ga0500579_093217_327_1130 267
273 3300053157 Ga0500624_001418 Ga0500624_001418_157_960 267
274 3300003322 rootL2_10129275 rootL2_101292751 268
275 3300005288 Ga0065714_10003980 Ga0065714_100039803 268
276 3300005616 Ga0068852_100213158 Ga0068852_1002131582 268
277 3300006195 Ga0075366_10000253 Ga0075366_100002534 268
278 3300009551 Ga0105238_10615331 Ga0105238_106153311 268
279 3300026142 Ga0207698_10261205 Ga0207698_102612051 268
280 3300046524 Ga0495648_0027243 Ga0495648_0027243_1457_2263 268
281 3300046558 Ga0495633_0000156 Ga0495633_0000156_18415_19221 268
282 3300046660 Ga0495625_0001554 Ga0495625_0001554_6418_7224 268
283 3300050493 nmdc:mga0k408_331_c2 nmdc:mga0k408_331_c2_2778_3584 268
284 3300053122 Ga0500608_053421 Ga0500608_053421_376_1182 268
285 3300053125 Ga0500618_000023 Ga0500618_000023_83876_84682 268
286 3300001979 JGI24740J21852_10008151 JGI24740J21852_100081512 269
287 3300003316 rootH1_10038589 rootH1_100385893 269
288 3300005578 Ga0068854_100302120 Ga0068854_1003021202 269
289 3300009174 Ga0105241_10111975 Ga0105241_101119752 269
290 3300009545 Ga0105237_10016512 Ga0105237_100165128 269
291 3300013102 Ga0157371_10005955 Ga0157371_100059559 269
292 3300013105 Ga0157369_10001695 Ga0157369_100016954 269
293 3300013307 Ga0157372_10000011 Ga0157372_10000011133 269
294 3300025272 Ga0209455_1000960 Ga0209455_100096012 269
295 3300025913 Ga0207695_10412279 Ga0207695_104122792 269
296 3300025914 Ga0207671_10003164 Ga0207671_1000316410 269
297 3300025949 Ga0207667_10381199 Ga0207667_103811992 269
298 3300025981 Ga0207640_10324590 Ga0207640_103245901 269
299 3300037312 Ga0395899_0000188 Ga0395899_0000188_73792_74601 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

27

242

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

33

283

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cqm-assembly2.cif.gz_C crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.954 11 265
4cqm-assembly4.cif.gz_G crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9526 14 269
4cqm-assembly3.cif.gz_N crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9507 8 267
4cql-assembly4.cif.gz_J crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.95 10 269
1uls-assembly1.cif.gz_C crystal structure of tt0140 from thermus thermophilus hb8 0.9487 8 268
ID Description Score Start End Superfamily
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9469 8 268 3.40.50.720
1nfrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9422 6 269 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9404 5 269 3.40.50.720
3ennB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9383 5 269 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9376 8 269 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y4R3X7-F1-model_v4 SDR family oxidoreductase 0.9927 4 269 GO:0016616
AF-A0A2P8D2N7-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9913 15 269 GO:0016616
AF-A0A7Y8L0F3-F1-model_v4 SDR family oxidoreductase 0.989 5 269 GO:0016616
AF-A0A419F691-F1-model_v4 SDR family oxidoreductase 0.9879 3 267 GO:0016616
AF-A0A519TDG9-F1-model_v4 SDR family oxidoreductase 0.9864 90 269 GO:0016616

Feature Viewer

pLDDT pTM Quality
93.08 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map