F394730

General Info

Members Datasets Scaffolds Average Seq Length
299 218 244 144

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000200|Ga0070665_100000200104
Length 153
Sequence MTETLAAKSIVVERTMPHPPEKVWRALTQAPLIAEWLMQNDFQPVVGHRFNFRATPIPNMWNGVTDCEVLVVEPAKRLVYSWNASGEEAKDGLKTTVTWTLTSVEGGTHVRMEQSGFRPQDEGGYQAMGGGWPRIVAGLERVAGELGRPAAPR

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
3 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
4 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
5 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
6 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
7 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
8 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
9 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
10 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
11 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
12 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
13 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
14 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
15 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
16 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
17 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
18 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
19 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
20 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
21 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
22 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
23 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
24 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
25 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
26 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
27 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
28 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
29 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
30 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
31 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
32 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
33 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
34 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
35 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
36 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
37 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
38 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
136 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
205 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
206 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
207 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
208 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
209 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
210 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
211 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
212 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
213 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
214 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
215 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
216 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
217 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
218 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.61
Metatranscriptomes 0.33
Isolates 18.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.01
Nodule 18.06
Rhizoplane 2.01
Rhizosphere 74.92
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10041650 3300003322 Bacteria 4600
2 JGI25404J52841_10017565 3300003659 Bacteria 1551
3 JGI25404J52841_10017688 3300003659 Bacteria 1545
4 JGI25404J52841_10056147 3300003659 Bacteria 826
5 Ga0055542_1010283 3300003762 Bacteria 1717
6 Ga0070683_101002204 3300005329 Bacteria 802
7 Ga0070677_10000281 3300005333 Bacteria 17846
8 Ga0070680_100042177 3300005336 Bacteria 3701
9 Ga0070680_100047427 3300005336 Bacteria 3498
10 Ga0068868_100000036 3300005338 Bacteria 74490
11 Ga0070660_100000347 3300005339 Bacteria 30909
12 Ga0070660_100047820 3300005339 Bacteria 3284
13 Ga0070660_100217346 3300005339 Bacteria 1553
14 Ga0070660_100431050 3300005339 Bacteria 1092
15 Ga0070689_100851551 3300005340 Bacteria 804
16 Ga0070675_100595209 3300005354 Bacteria 1003
17 Ga0070673_101339601 3300005364 Bacteria 673
18 Ga0070659_100000034 3300005366 Bacteria 115416
19 Ga0070659_100013135 3300005366 Bacteria 6158
20 Ga0070659_100023347 3300005366 Bacteria 4732
21 Ga0070681_10024191 3300005458 Bacteria 6114
22 Ga0070681_10316569 3300005458 Bacteria 1470
23 Ga0070681_11289667 3300005458 Bacteria 653
24 Ga0070685_10086167 3300005466 Bacteria 1893
25 Ga0070685_11330562 3300005466 Bacteria 549
26 Ga0070685_11478543 3300005466 Bacteria 523
27 Ga0070699_100587319 3300005518 Bacteria 1015
28 Ga0070679_100043013 3300005530 Bacteria 4499
29 Ga0070679_101218139 3300005530 Bacteria 698
30 Ga0070684_100184550 3300005535 Bacteria 1897
31 Ga0070684_101503114 3300005535 Bacteria 635
32 Ga0070697_100184995 3300005536 Bacteria 1767
33 Ga0068853_100034848 3300005539 Bacteria 4274
34 Ga0068853_100163561 3300005539 Bacteria 2009
35 Ga0070695_101444255 3300005545 Bacteria 571
36 Ga0070665_100000200 3300005548 Bacteria 105708
37 Ga0070665_100000413 3300005548 Bacteria 62505
38 Ga0070704_102161296 3300005549 Unclassified 517
39 Ga0068855_100135468 3300005563 Bacteria 2810
40 Ga0068855_100339941 3300005563 Bacteria 1655
41 Ga0068854_100442972 3300005578 Bacteria 1083
42 Ga0068856_100734269 3300005614 Bacteria 1007
43 Ga0068856_101247683 3300005614 Bacteria 759
44 Ga0068862_100417703 3300005844 Bacteria 1258
45 Ga0081455_10019068 3300005937 Bacteria 6504
46 Ga0081455_10248806 3300005937 Bacteria 1301
47 Ga0081455_10657452 3300005937 Bacteria 674
48 Ga0081540_1010579 3300005983 Bacteria 6232
49 Ga0081540_1052733 3300005983 Bacteria 2000
50 Ga0081540_1219479 3300005983 Bacteria 678
51 Ga0081539_10064173 3300005985 Bacteria 2000
52 Ga0081539_10248660 3300005985 Bacteria 791
53 Ga0068865_100001871 3300006881 Bacteria 12372
54 Ga0099794_10014799 3300007265 Bacteria 3428
55 Ga0099794_10318132 3300007265 Bacteria 807
56 Ga0105240_10000498 3300009093 Bacteria 72329
57 Ga0105240_10043695 3300009093 Bacteria 5699
58 Ga0105240_10093354 3300009093 Bacteria 3673
59 Ga0105240_10121343 3300009093 Bacteria 3147
60 Ga0105240_10146161 3300009093 Bacteria 2821
61 Ga0105240_11363577 3300009093 Bacteria 746
62 Ga0105245_10026256 3300009098 Bacteria 5125
63 Ga0105245_10597929 3300009098 Bacteria 1129
64 Ga0105241_12220599 3300009174 Bacteria 545
65 Ga0105248_10728209 3300009177 Bacteria 1119
66 Ga0105237_10291497 3300009545 Bacteria 1635
67 Ga0105238_10029306 3300009551 Bacteria 5608
68 Ga0105238_10280980 3300009551 Bacteria 1646
69 Ga0105238_10324849 3300009551 Bacteria 1525
70 Ga0105239_10105590 3300010375 Bacteria 3119
71 Ga0105239_10385617 3300010375 Bacteria 1585
72 Ga0105239_10991300 3300010375 Bacteria 966
73 Ga0157370_10804505 3300013104 Bacteria 855
74 Ga0157369_10347483 3300013105 Bacteria 1541
75 Ga0157369_10397671 3300013105 Bacteria 1429
76 Ga0163163_11589959 3300014325 Bacteria 715
77 Ga0157380_12613583 3300014326 Bacteria 571
78 Ga0157380_13142520 3300014326 Bacteria 527
79 Ga0206356_11022645 3300020070 Bacteria 1754
80 Ga0213872_10008439 3300021361 Bacteria 4988
81 Ga0213876_10041056 3300021384 Bacteria 2445
82 Ga0209148_1000465 3300025254 Bacteria 43292
83 Ga0209455_1000412 3300025272 Bacteria 34309
84 Ga0209050_1032177 3300025298 Bacteria 1619
85 Ga0209257_1049756 3300025304 Bacteria 1191
86 Ga0207682_10000508 3300025893 Bacteria 17882
87 Ga0207680_10959106 3300025903 Unclassified 613
88 Ga0207680_11136854 3300025903 Bacteria 558
89 Ga0207705_10013009 3300025909 Bacteria 6006
90 Ga0207705_10491637 3300025909 Bacteria 953
91 Ga0207707_10046301 3300025912 Bacteria 3788
92 Ga0207707_10113010 3300025912 Bacteria 2374
93 Ga0207707_10511081 3300025912 Bacteria 1024
94 Ga0207695_10000106 3300025913 Bacteria 253001
95 Ga0207695_10079834 3300025913 Bacteria 3314
96 Ga0207695_10151897 3300025913 Bacteria 2254
97 Ga0207660_10033004 3300025917 Bacteria 3577
98 Ga0207660_10044757 3300025917 Bacteria 3115
99 Ga0207657_10000839 3300025919 Bacteria 32505
100 Ga0207657_10019333 3300025919 Bacteria 6473
101 Ga0207657_10028056 3300025919 Bacteria 5144
102 Ga0207657_10040915 3300025919 Bacteria 4103
103 Ga0207652_10052602 3300025921 Bacteria 3496
104 Ga0207652_10177413 3300025921 Bacteria 1914
105 Ga0207646_10350292 3300025922 Bacteria 1334
106 Ga0207694_10028484 3300025924 Bacteria 4259
107 Ga0207694_10087056 3300025924 Bacteria 2460
108 Ga0207694_10172969 3300025924 Bacteria 1749
109 Ga0207694_10187682 3300025924 Bacteria 1678
110 Ga0207659_10653617 3300025926 Bacteria 899
111 Ga0207687_10051099 3300025927 Bacteria 2880
112 Ga0207687_10464566 3300025927 Bacteria 1051
113 Ga0207690_10000005 3300025932 Bacteria 581199
114 Ga0207690_10000092 3300025932 Bacteria 74832
115 Ga0207690_10081481 3300025932 Bacteria 2261
116 Ga0207709_10770029 3300025935 Bacteria 775
117 Ga0207704_10002011 3300025938 Bacteria 9122
118 Ga0207661_12072358 3300025944 Bacteria 515
119 Ga0207667_10009459 3300025949 Bacteria 11476
120 Ga0207667_10073757 3300025949 Unclassified 3546
121 Ga0207667_10405358 3300025949 Bacteria 1388
122 Ga0207712_11963193 3300025961 Bacteria 524
123 Ga0207640_10727601 3300025981 Bacteria 853
124 Ga0207677_10000044 3300026023 Bacteria 107614
125 Ga0207639_10254043 3300026041 Bacteria 1534
126 Ga0207639_10649230 3300026041 Bacteria 976
127 Ga0207708_10776523 3300026075 Bacteria 824
128 Ga0207702_10465302 3300026078 Bacteria 1229
129 Ga0207676_10461981 3300026095 Bacteria 1199
130 Ga0209588_1020916 3300027671 Bacteria 2050
131 Ga0268266_10000005 3300028379 Bacteria 1448194
132 Ga0268266_10006767 3300028379 Bacteria 10451
133 Ga0265325_10195809 3300031241 Bacteria 934
134 Ga0265340_10260779 3300031247 Bacteria 771
135 Ga0265339_10222482 3300031249 Bacteria 922
136 Ga0265331_10038616 3300031250 Bacteria 2333
137 Ga0265316_10021869 3300031344 Bacteria 5407
138 Ga0307508_10122543 3300031616 Bacteria 2203
139 Ga0316575_10117640 3300031665 Unclassified 1086
140 Ga0265314_10206961 3300031711 Bacteria 1155
141 Ga0265342_10437434 3300031712 Unclassified 672
142 Ga0373934_0073143 3300035086 Bacteria 1372
143 Ga0373953_0003987 3300035117 Bacteria 4659
144 Ga0373954_0002162 3300035118 Bacteria 8158
145 Ga0373956_0001820 3300035119 Bacteria 8808
146 Ga0373933_0003732 3300035724 Bacteria 8418
147 Ga0373937_0009343 3300036401 Bacteria 8515
148 Ga0395899_0080263 3300037312 Bacteria 2375
149 Ga0395899_0092001 3300037312 Bacteria 2197
150 Ga0395898_0490302 3300037466 Bacteria 1169
151 Ga0395905_0036952 3300037471 Bacteria 4588
152 Ga0395905_0418413 3300037471 Bacteria 1236
153 Ga0395905_1129555 3300037471 Bacteria 687
154 Ga0395905_1259903 3300037471 Bacteria 643
155 Ga0395901_0407537 3300038443 Bacteria 1396
156 Ga0436365_0533570 3300039437 Bacteria 34633
157 Ga0436361_0351327 3300039447 Bacteria 31675
158 Ga0436361_0998143 3300039447 Bacteria 2810
159 Ga0451793_1049502 3300041452 Bacteria 510
160 Ga0451797_0381420 3300041453 Bacteria 1565
161 Ga0451802_1347149 3300041460 Bacteria 1293
162 Ga0466972_0159542 3300044658 Bacteria 1060
163 Ga0466961_0103469 3300044693 Bacteria 1793
164 Ga0466961_0408299 3300044693 Bacteria 824
165 Ga0466957_0408690 3300044842 Bacteria 930
166 Ga0466960_0025382 3300044901 Bacteria 2682
167 Ga0466967_1701789 3300045976 Bacteria 628
168 Ga0495592_0009829 3300046454 Bacteria 7200
169 Ga0495629_0002134 3300046459 Bacteria 15342
170 Ga0495629_0204939 3300046459 Bacteria 1363
171 Ga0495651_0105550 3300046462 Bacteria 2089
172 Ga0495653_0000647 3300046463 Bacteria 26558
173 Ga0495664_0503252 3300046477 Bacteria 723
174 Ga0495584_0172241 3300046491 Bacteria 1100
175 Ga0495608_0004413 3300046511 Bacteria 10072
176 Ga0495618_0031454 3300046514 Bacteria 3320
177 Ga0495628_0042585 3300046516 Bacteria 3621
178 Ga0495652_0005561 3300046529 Bacteria 11853
179 Ga0495645_0020621 3300046543 Bacteria 4759
180 Ga0495645_0094355 3300046543 Bacteria 2134
181 Ga0495633_0207295 3300046558 Bacteria 899
182 Ga0495667_0001481 3300046559 Bacteria 15461
183 Ga0495668_0090244 3300046616 Bacteria 1679
184 Ga0495668_0228802 3300046616 Bacteria 1018
185 Ga0495668_0822042 3300046616 Bacteria 515
186 Ga0495634_0024763 3300046642 Bacteria 4207
187 Ga0495611_0203742 3300046648 Bacteria 922
188 Ga0495635_0003883 3300046663 Bacteria 10385
189 Ga0495659_0218456 3300046664 Bacteria 786
190 Ga0495657_0223879 3300046675 Bacteria 1139
191 Ga0495599_0002953 3300046678 Bacteria 9894
192 Ga0495646_0012783 3300046680 Bacteria 5335
193 Ga0495613_0094130 3300046689 Bacteria 2168
194 Ga0495613_0380433 3300046689 Bacteria 965
195 Ga0495600_0018780 3300046809 Bacteria 4410
196 Ga0495660_0358244 3300046810 Bacteria 647
197 Ga0495604_0013061 3300047317 Bacteria 6616
198 Ga0495672_0074945 3300047320 Bacteria 1904
199 Ga0495675_0001613 3300047444 Bacteria 13553
200 Ga0495684_0000481 3300047471 Bacteria 32605
201 Ga0495686_0163891 3300047472 Bacteria 1297
202 Ga0495593_0012206 3300047673 Bacteria 4911
203 Ga0495602_0021208 3300048088 Bacteria 6401
204 Ga0495602_0807911 3300048088 Bacteria 629
205 Ga0496100_1221884 3300048903 Unclassified 593
206 Ga0496112_0319886 3300048915 Bacteria 1496
207 Ga0496115_0023896 3300048918 Bacteria 4746
208 Ga0496126_0116609 3300048929 Bacteria 2321
209 Ga0496126_0727870 3300048929 Bacteria 768
210 Ga0501032_0269305 3300049569 Bacteria 1104
211 Ga0501034_0079515 3300049571 Bacteria 3282
212 Ga0501036_0688289 3300049572 Bacteria 845
213 Ga0501037_0606838 3300049573 Bacteria 734
214 Ga0501038_0450567 3300049574 Bacteria 989
215 Ga0501039_0061947 3300049575 Bacteria 2898
216 Ga0501043_0005885 3300049579 Bacteria 9865
217 Ga0501043_0751525 3300049579 Bacteria 709
218 Ga0501046_0750624 3300049580 Bacteria 685
219 Ga0501047_0026712 3300049581 Bacteria 5557
220 Ga0501047_0038742 3300049581 Bacteria 4611
221 Ga0501047_0149650 3300049581 Bacteria 2211
222 Ga0501048_0266723 3300049582 Bacteria 1217
223 Ga0501067_0020846 3300049583 Bacteria 3627
224 Ga0501067_0041024 3300049583 Bacteria 2570
225 Ga0501068_0068490 3300049584 Bacteria 2163
226 Ga0501069_0695481 3300049585 Bacteria 613
227 Ga0501073_0081735 3300049589 Bacteria 2247
228 Ga0501074_0309073 3300049590 Bacteria 1123
229 Ga0501249_013171 3300049679 Bacteria 1756
230 Ga0501080_0000625 3300049742 Bacteria 28031
231 Ga0501083_0046501 3300049744 Bacteria 2934
232 Ga0501083_0365925 3300049744 Bacteria 938
233 Ga0501035_0048282 3300049822 Bacteria 3818
234 Ga0501035_1154329 3300049822 Bacteria 603
235 Ga0501044_0057205 3300049823 Bacteria 4002
236 Ga0501044_0684124 3300049823 Bacteria 912
237 Ga0495601_0036802 3300053077 Bacteria 3058
238 Ga0495595_0003736 3300053084 Bacteria 6053
239 Ga0495619_0001635 3300053085 Bacteria 14776
240 Ga0500595_013307 3300053119 Bacteria 3155
241 Ga0500595_028777 3300053119 Bacteria 1892
242 Ga0500595_056196 3300053119 Bacteria 1203
243 Ga0500609_026625 3300053731 Bacteria 793
244 Ga0501082_0017632 3300060353 Bacteria 6150

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_1049502 Ga0451793_1049502_112_486 123
2 3300005336 Ga0070680_100042177 Ga0070680_1000421775 125
3 3300005339 Ga0070660_100431050 Ga0070660_1004310502 125
4 3300005366 Ga0070659_100023347 Ga0070659_1000233472 125
5 3300005458 Ga0070681_10024191 Ga0070681_100241913 125
6 3300005530 Ga0070679_100043013 Ga0070679_1000430132 125
7 3300005539 Ga0068853_100163561 Ga0068853_1001635614 125
8 3300025903 Ga0207680_11136854 Ga0207680_111368541 125
9 3300005329 Ga0070683_101002204 Ga0070683_1010022041 126
10 3300025909 Ga0207705_10013009 Ga0207705_100130096 126
11 3300025912 Ga0207707_10046301 Ga0207707_100463012 126
12 3300025917 Ga0207660_10033004 Ga0207660_100330045 126
13 3300025919 Ga0207657_10019333 Ga0207657_100193335 126
14 3300025921 Ga0207652_10052602 Ga0207652_100526022 126
15 3300025932 Ga0207690_10081481 Ga0207690_100814812 126
16 3300025944 Ga0207661_12072358 Ga0207661_120723581 126
17 3300025949 Ga0207667_10009459 Ga0207667_1000945910 126
18 3300014326 Ga0157380_12613583 Ga0157380_126135832 129
19 3300046616 Ga0495668_0090244 Ga0495668_0090244_654_1097 129
20 3300053119 Ga0500595_013307 Ga0500595_013307_1197_1634 129
21 3300053731 Ga0500609_026625 Ga0500609_026625_389_778 129
22 3300049581 Ga0501047_0149650 Ga0501047_0149650_12_404 130
23 3300041453 Ga0451797_0381420 Ga0451797_0381420_522_929 134
24 3300041460 Ga0451802_1347149 Ga0451802_1347149_675_1082 134
25 3300049679 Ga0501249_013171 Ga0501249_013171_549_962 135
26 3300039447 Ga0436361_0351327 Ga0436361_0351327_479_898 136
27 3300048915 Ga0496112_0319886 Ga0496112_0319886_1026_1445 137
28 iso_pu_bacteria 2508501123 2509115962 138
29 iso_pu_bacteria 2513237144 2513912499 138
30 iso_pu_bacteria 2856320880 2856325622 138
31 iso_pu_bacteria 2869278585 2869279246 138
32 iso_pu_bacteria 2878738818 2878745629 138
33 iso_pu_bacteria 2924718760 2924722372 138
34 iso_pu_bacteria 2924776078 2924783873 138
35 iso_pu_bacteria 2937877337 2937877405 138
36 iso_pu_bacteria 2937972304 2937975490 138
37 iso_pu_bacteria 2958034702 2958035387 138
38 iso_pu_bacteria 2958041894 2958043574 138
39 iso_pu_bacteria 2958084443 2958084511 138
40 iso_pu_bacteria 2958144490 2958147220 138
41 iso_pu_bacteria 2968016561 2968018067 138
42 iso_pu_bacteria 2970593180 2970593842 138
43 iso_pu_bacteria 2996348954 2996350543 138
44 iso_pu_bacteria 3004275668 3004277241 138
45 iso_pu_bacteria 8016622563 8016623008 138
46 iso_pu_bacteria 8019547302 8019550011 138
47 3300005354 Ga0070675_100595209 Ga0070675_1005952092 139
48 3300009098 Ga0105245_10026256 Ga0105245_100262566 139
49 3300009177 Ga0105248_10728209 Ga0105248_107282092 139
50 3300025926 Ga0207659_10653617 Ga0207659_106536171 139
51 3300025927 Ga0207687_10051099 Ga0207687_100510994 139
52 3300031344 Ga0265316_10021869 Ga0265316_100218693 139
53 3300031712 Ga0265342_10437434 Ga0265342_104374341 139
54 3300005535 Ga0070684_101503114 Ga0070684_1015031141 140
55 3300005548 Ga0070665_100000413 Ga0070665_10000041312 140
56 3300005563 Ga0068855_100339941 Ga0068855_1003399411 140
57 3300009093 Ga0105240_10121343 Ga0105240_101213434 140
58 3300009093 Ga0105240_11363577 Ga0105240_113635772 140
59 3300009545 Ga0105237_10291497 Ga0105237_102914973 140
60 3300009551 Ga0105238_10029306 Ga0105238_100293064 140
61 3300010375 Ga0105239_10385617 Ga0105239_103856172 140
62 3300010375 Ga0105239_10991300 Ga0105239_109913001 140
63 3300025924 Ga0207694_10087056 Ga0207694_100870563 140
64 3300028379 Ga0268266_10006767 Ga0268266_1000676711 140
65 3300044901 Ga0466960_0025382 Ga0466960_0025382_1450_1890 140
66 3300048929 Ga0496126_0116609 Ga0496126_0116609_1427_1867 140
67 3300053119 Ga0500595_028777 Ga0500595_028777_656_1078 140
68 iso_pu_bacteria 2935769743 2935772949 140
69 iso_pu_bacteria 2935777560 2935783260 140
70 iso_pu_bacteria 2935785616 2935788063 140
71 iso_pu_bacteria 2935793552 2935796361 140
72 iso_pu_bacteria 8016522445 8016526238 140
73 iso_pu_bacteria 8016530956 8016539856 140
74 iso_pu_bacteria 8016539877 8016544160 140
75 iso_pu_bacteria 8016548790 8016549147 140
76 iso_pu_bacteria 8016557553 8016557571 140
77 iso_pu_bacteria 8016566248 8016569565 140
78 iso_pu_bacteria 8016575299 8016582176 140
79 iso_pu_bacteria 8016595262 8016595611 140
80 iso_pu_bacteria 8016613128 8016618363 140
81 iso_pu_bacteria 8019530166 8019531133 140
82 iso_pu_bacteria 8019538911 8019540421 140
83 3300005364 Ga0070673_101339601 Ga0070673_1013396011 141
84 3300005530 Ga0070679_101218139 Ga0070679_1012181392 141
85 3300009093 Ga0105240_10000498 Ga0105240_1000049840 141
86 3300025913 Ga0207695_10000106 Ga0207695_1000010648 141
87 3300026075 Ga0207708_10776523 Ga0207708_107765232 141
88 3300037312 Ga0395899_0080263 Ga0395899_0080263_1886_2311 141
89 3300005338 Ga0068868_100000036 Ga0068868_10000003662 142
90 3300005339 Ga0070660_100000347 Ga0070660_10000034713 142
91 3300005366 Ga0070659_100000034 Ga0070659_100000034127 142
92 3300005466 Ga0070685_11330562 Ga0070685_113305621 142
93 3300005466 Ga0070685_11478543 Ga0070685_114785431 142
94 3300005985 Ga0081539_10248660 Ga0081539_102486601 142
95 3300006881 Ga0068865_100001871 Ga0068865_10000187111 142
96 3300009098 Ga0105245_10597929 Ga0105245_105979292 142
97 3300013105 Ga0157369_10347483 Ga0157369_103474832 142
98 3300014325 Ga0163163_11589959 Ga0163163_115899592 142
99 3300025919 Ga0207657_10000839 Ga0207657_1000083934 142
100 3300025927 Ga0207687_10464566 Ga0207687_104645662 142
101 3300025932 Ga0207690_10000005 Ga0207690_10000005335 142
102 3300025935 Ga0207709_10770029 Ga0207709_107700291 142
103 3300025938 Ga0207704_10002011 Ga0207704_1000201110 142
104 3300025961 Ga0207712_11963193 Ga0207712_119631931 142
105 3300026023 Ga0207677_10000044 Ga0207677_1000004429 142
106 3300026095 Ga0207676_10461981 Ga0207676_104619811 142
107 3300037312 Ga0395899_0092001 Ga0395899_0092001_1390_1830 142
108 3300037466 Ga0395898_0490302 Ga0395898_0490302_235_675 142
109 3300037471 Ga0395905_0036952 Ga0395905_0036952_3583_4023 142
110 3300038443 Ga0395901_0407537 Ga0395901_0407537_441_881 142
111 3300046543 Ga0495645_0094355 Ga0495645_0094355_146_583 142
112 3300046616 Ga0495668_0228802 Ga0495668_0228802_404_841 142
113 3300046689 Ga0495613_0380433 Ga0495613_0380433_474_911 142
114 3300048088 Ga0495602_0807911 Ga0495602_0807911_145_582 142
115 iso_pu_bacteria 2970469710 2970471758 142
116 3300005336 Ga0070680_100047427 Ga0070680_1000474275 143
117 3300005339 Ga0070660_100047820 Ga0070660_1000478201 143
118 3300005339 Ga0070660_100217346 Ga0070660_1002173462 143
119 3300005366 Ga0070659_100013135 Ga0070659_1000131354 143
120 3300005536 Ga0070697_100184995 Ga0070697_1001849953 143
121 3300005548 Ga0070665_100000200 Ga0070665_100000200104 143
122 3300005563 Ga0068855_100135468 Ga0068855_1001354684 143
123 3300005578 Ga0068854_100442972 Ga0068854_1004429722 143
124 3300005614 Ga0068856_100734269 Ga0068856_1007342692 143
125 3300005937 Ga0081455_10248806 Ga0081455_102488063 143
126 3300007265 Ga0099794_10014799 Ga0099794_100147992 143
127 3300009093 Ga0105240_10043695 Ga0105240_100436954 143
128 3300009093 Ga0105240_10093354 Ga0105240_100933542 143
129 3300009093 Ga0105240_10146161 Ga0105240_101461612 143
130 3300009174 Ga0105241_12220599 Ga0105241_122205991 143
131 3300009551 Ga0105238_10280980 Ga0105238_102809803 143
132 3300010375 Ga0105239_10105590 Ga0105239_101055904 143
133 3300013104 Ga0157370_10804505 Ga0157370_108045052 143
134 3300025903 Ga0207680_10959106 Ga0207680_109591061 143
135 3300025909 Ga0207705_10491637 Ga0207705_104916372 143
136 3300025913 Ga0207695_10079834 Ga0207695_100798343 143
137 3300025913 Ga0207695_10151897 Ga0207695_101518974 143
138 3300025917 Ga0207660_10044757 Ga0207660_100447575 143
139 3300025919 Ga0207657_10028056 Ga0207657_100280565 143
140 3300025919 Ga0207657_10040915 Ga0207657_100409153 143
141 3300025924 Ga0207694_10172969 Ga0207694_101729692 143
142 3300025932 Ga0207690_10000092 Ga0207690_1000009220 143
143 3300025949 Ga0207667_10073757 Ga0207667_100737575 143
144 3300025981 Ga0207640_10727601 Ga0207640_107276012 143
145 3300026041 Ga0207639_10649230 Ga0207639_106492302 143
146 3300026078 Ga0207702_10465302 Ga0207702_104653023 143
147 3300027671 Ga0209588_1020916 Ga0209588_10209162 143
148 3300028379 Ga0268266_10000005 Ga0268266_10000005371 143
149 3300031250 Ga0265331_10038616 Ga0265331_100386163 143
150 3300031711 Ga0265314_10206961 Ga0265314_102069612 143
151 3300035086 Ga0373934_0073143 Ga0373934_0073143_352_792 143
152 3300035117 Ga0373953_0003987 Ga0373953_0003987_2140_2580 143
153 3300035118 Ga0373954_0002162 Ga0373954_0002162_5495_5935 143
154 3300035119 Ga0373956_0001820 Ga0373956_0001820_4742_5182 143
155 3300035724 Ga0373933_0003732 Ga0373933_0003732_3625_4065 143
156 3300036401 Ga0373937_0009343 Ga0373937_0009343_3971_4411 143
157 3300037471 Ga0395905_1259903 Ga0395905_1259903_171_611 143
158 3300044658 Ga0466972_0159542 Ga0466972_0159542_239_682 143
159 3300044693 Ga0466961_0103469 Ga0466961_0103469_1335_1778 143
160 3300044693 Ga0466961_0408299 Ga0466961_0408299_133_573 143
161 3300044842 Ga0466957_0408690 Ga0466957_0408690_228_671 143
162 3300046454 Ga0495592_0009829 Ga0495592_0009829_4906_5346 143
163 3300046459 Ga0495629_0002134 Ga0495629_0002134_6669_7109 143
164 3300046462 Ga0495651_0105550 Ga0495651_0105550_357_797 143
165 3300046463 Ga0495653_0000647 Ga0495653_0000647_5520_5960 143
166 3300046477 Ga0495664_0503252 Ga0495664_0503252_125_565 143
167 3300046511 Ga0495608_0004413 Ga0495608_0004413_8389_8829 143
168 3300046514 Ga0495618_0031454 Ga0495618_0031454_2159_2599 143
169 3300046516 Ga0495628_0042585 Ga0495628_0042585_1265_1705 143
170 3300046529 Ga0495652_0005561 Ga0495652_0005561_5210_5650 143
171 3300046543 Ga0495645_0020621 Ga0495645_0020621_2209_2649 143
172 3300046559 Ga0495667_0001481 Ga0495667_0001481_6584_7024 143
173 3300046642 Ga0495634_0024763 Ga0495634_0024763_1932_2372 143
174 3300046663 Ga0495635_0003883 Ga0495635_0003883_3531_3971 143
175 3300046675 Ga0495657_0223879 Ga0495657_0223879_357_797 143
176 3300046678 Ga0495599_0002953 Ga0495599_0002953_8034_8474 143
177 3300046680 Ga0495646_0012783 Ga0495646_0012783_1269_1709 143
178 3300046689 Ga0495613_0094130 Ga0495613_0094130_102_656 143
179 3300046809 Ga0495600_0018780 Ga0495600_0018780_2088_2528 143
180 3300047317 Ga0495604_0013061 Ga0495604_0013061_5597_6037 143
181 3300047444 Ga0495675_0001613 Ga0495675_0001613_4771_5211 143
182 3300047471 Ga0495684_0000481 Ga0495684_0000481_30255_30695 143
183 3300047673 Ga0495593_0012206 Ga0495593_0012206_1301_1741 143
184 3300048088 Ga0495602_0021208 Ga0495602_0021208_3166_3606 143
185 3300048903 Ga0496100_1221884 Ga0496100_1221884_68_508 143
186 3300048918 Ga0496115_0023896 Ga0496115_0023896_1112_1573 143
187 3300049581 Ga0501047_0026712 Ga0501047_0026712_4376_4807 143
188 3300049582 Ga0501048_0266723 Ga0501048_0266723_315_752 143
189 3300049744 Ga0501083_0365925 Ga0501083_0365925_415_846 143
190 3300049822 Ga0501035_1154329 Ga0501035_1154329_41_472 143
191 3300049823 Ga0501044_0684124 Ga0501044_0684124_346_792 143
192 3300053077 Ga0495601_0036802 Ga0495601_0036802_863_1303 143
193 3300053084 Ga0495595_0003736 Ga0495595_0003736_3507_3947 143
194 3300053085 Ga0495619_0001635 Ga0495619_0001635_6670_7110 143
195 3300003659 JGI25404J52841_10017565 JGI25404J52841_100175652 144
196 3300003659 JGI25404J52841_10017688 JGI25404J52841_100176882 144
197 3300003659 JGI25404J52841_10056147 JGI25404J52841_100561472 144
198 3300003762 Ga0055542_1010283 Ga0055542_10102833 144
199 3300005333 Ga0070677_10000281 Ga0070677_100002816 144
200 3300005458 Ga0070681_10316569 Ga0070681_103165691 144
201 3300005458 Ga0070681_11289667 Ga0070681_112896672 144
202 3300005466 Ga0070685_10086167 Ga0070685_100861673 144
203 3300005518 Ga0070699_100587319 Ga0070699_1005873192 144
204 3300005535 Ga0070684_100184550 Ga0070684_1001845502 144
205 3300005539 Ga0068853_100034848 Ga0068853_1000348488 144
206 3300005545 Ga0070695_101444255 Ga0070695_1014442551 144
207 3300005614 Ga0068856_101247683 Ga0068856_1012476831 144
208 3300005844 Ga0068862_100417703 Ga0068862_1004177032 144
209 3300005937 Ga0081455_10019068 Ga0081455_100190686 144
210 3300005937 Ga0081455_10657452 Ga0081455_106574521 144
211 3300005983 Ga0081540_1010579 Ga0081540_10105797 144
212 3300005983 Ga0081540_1052733 Ga0081540_10527333 144
213 3300005983 Ga0081540_1219479 Ga0081540_12194791 144
214 3300005985 Ga0081539_10064173 Ga0081539_100641732 144
215 3300007265 Ga0099794_10318132 Ga0099794_103181321 144
216 3300009551 Ga0105238_10324849 Ga0105238_103248491 144
217 3300013105 Ga0157369_10397671 Ga0157369_103976712 144
218 3300014326 Ga0157380_13142520 Ga0157380_131425201 144
219 3300020070 Ga0206356_11022645 Ga0206356_110226453 144
220 3300021384 Ga0213876_10041056 Ga0213876_100410562 144
221 3300025254 Ga0209148_1000465 Ga0209148_100046540 144
222 3300025272 Ga0209455_1000412 Ga0209455_100041221 144
223 3300025298 Ga0209050_1032177 Ga0209050_10321773 144
224 3300025304 Ga0209257_1049756 Ga0209257_10497563 144
225 3300025893 Ga0207682_10000508 Ga0207682_100005086 144
226 3300025912 Ga0207707_10113010 Ga0207707_101130102 144
227 3300025912 Ga0207707_10511081 Ga0207707_105110813 144
228 3300025921 Ga0207652_10177413 Ga0207652_101774135 144
229 3300025922 Ga0207646_10350292 Ga0207646_103502923 144
230 3300025924 Ga0207694_10028484 Ga0207694_100284842 144
231 3300025924 Ga0207694_10187682 Ga0207694_101876823 144
232 3300025949 Ga0207667_10405358 Ga0207667_104053582 144
233 3300026041 Ga0207639_10254043 Ga0207639_102540432 144
234 3300031241 Ga0265325_10195809 Ga0265325_101958092 144
235 3300031249 Ga0265339_10222482 Ga0265339_102224822 144
236 3300031616 Ga0307508_10122543 Ga0307508_101225433 144
237 3300037471 Ga0395905_0418413 Ga0395905_0418413_628_1062 144
238 3300037471 Ga0395905_1129555 Ga0395905_1129555_233_667 144
239 3300039437 Ga0436365_0533570 Ga0436365_0533570_503_940 144
240 3300039447 Ga0436361_0998143 Ga0436361_0998143_64_507 144
241 3300046459 Ga0495629_0204939 Ga0495629_0204939_671_1105 144
242 3300046491 Ga0495584_0172241 Ga0495584_0172241_269_709 144
243 3300046558 Ga0495633_0207295 Ga0495633_0207295_42_482 144
244 3300046616 Ga0495668_0822042 Ga0495668_0822042_52_486 144
245 3300046648 Ga0495611_0203742 Ga0495611_0203742_194_634 144
246 3300046664 Ga0495659_0218456 Ga0495659_0218456_260_700 144
247 3300046810 Ga0495660_0358244 Ga0495660_0358244_63_503 144
248 3300047320 Ga0495672_0074945 Ga0495672_0074945_734_1174 144
249 3300047472 Ga0495686_0163891 Ga0495686_0163891_533_967 144
250 3300049569 Ga0501032_0269305 Ga0501032_0269305_407_844 144
251 3300049571 Ga0501034_0079515 Ga0501034_0079515_1247_1684 144
252 3300049572 Ga0501036_0688289 Ga0501036_0688289_100_537 144
253 3300049573 Ga0501037_0606838 Ga0501037_0606838_88_525 144
254 3300049574 Ga0501038_0450567 Ga0501038_0450567_373_810 144
255 3300049575 Ga0501039_0061947 Ga0501039_0061947_864_1301 144
256 3300049579 Ga0501043_0005885 Ga0501043_0005885_4440_4877 144
257 3300049579 Ga0501043_0751525 Ga0501043_0751525_105_569 144
258 3300049580 Ga0501046_0750624 Ga0501046_0750624_97_534 144
259 3300049581 Ga0501047_0038742 Ga0501047_0038742_525_962 144
260 3300049583 Ga0501067_0020846 Ga0501067_0020846_1811_2248 144
261 3300049584 Ga0501068_0068490 Ga0501068_0068490_611_1048 144
262 3300049585 Ga0501069_0695481 Ga0501069_0695481_42_506 144
263 3300049589 Ga0501073_0081735 Ga0501073_0081735_518_955 144
264 3300049590 Ga0501074_0309073 Ga0501074_0309073_29_466 144
265 3300049742 Ga0501080_0000625 Ga0501080_0000625_5216_5653 144
266 3300049744 Ga0501083_0046501 Ga0501083_0046501_619_1056 144
267 3300049822 Ga0501035_0048282 Ga0501035_0048282_1738_2175 144
268 3300049823 Ga0501044_0057205 Ga0501044_0057205_346_783 144
269 3300053119 Ga0500595_056196 Ga0500595_056196_603_1046 144
270 3300060353 Ga0501082_0017632 Ga0501082_0017632_4583_5020 144
271 3300005549 Ga0070704_102161296 Ga0070704_1021612961 145
272 3300044901 Ga0466960_0025382 Ga0466960_0025382_1887_2324 145
273 3300048929 Ga0496126_0727870 Ga0496126_0727870_308_757 145
274 3300003322 rootL2_10041650 rootL2_100416503 146
275 3300005340 Ga0070689_100851551 Ga0070689_1008515512 146
276 3300021361 Ga0213872_10008439 Ga0213872_100084396 146
277 3300031247 Ga0265340_10260779 Ga0265340_102607791 146
278 3300031665 Ga0316575_10117640 Ga0316575_101176401 146
279 3300045976 Ga0466967_1701789 Ga0466967_1701789_80_520 146
280 3300049583 Ga0501067_0041024 Ga0501067_0041024_252_698 146
281 iso_pu_bacteria 2856364286 2856370494 146
282 iso_pu_bacteria 2869285874 2869291779 146
283 iso_pu_bacteria 2871429161 2871434988 146
284 iso_pu_bacteria 2874146452 2874149379 146
285 iso_pu_bacteria 2874155637 2874157642 146
286 iso_pu_bacteria 2876413966 2876415845 146
287 iso_pu_bacteria 2878745973 2878752123 146
288 iso_pu_bacteria 2881147464 2881151888 146
289 iso_pu_bacteria 2903492973 2903493319 146
290 iso_pu_bacteria 2906308376 2906314517 146
291 iso_pu_bacteria 2906321335 2906327685 146
292 iso_pu_bacteria 2937813078 2937816180 146
293 iso_pu_bacteria 2958041894 2958043491 146
294 iso_pu_bacteria 2958130278 2958136177 146
295 iso_pu_bacteria 2958179912 2958185645 146
296 iso_pu_bacteria 2961077736 2961084022 146
297 iso_pu_bacteria 2977843712 2977846416 146
298 iso_pu_bacteria 8004387939 8004394495 146
299 iso_pu_bacteria 8004714634 8004720778 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

17

144

0.88

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

7

147

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.9286 9 146
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.9154 9 146
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8962 8 139
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8946 8 142
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8495 10 140
ID Description Score Start End Superfamily
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9193 6 146 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9064 6 146 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.847 9 142 3.30.530.20
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8272 7 141 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8236 8 141 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7Y6PZW1-F1-model_v4 SRPBCC domain-containing protein 1.002 6 143
AF-A0A7Y6PZW1-F1-model_v4 SRPBCC domain-containing protein 0.9803 6 143
AF-A0A5R2MWB8-F1-model_v4 SRPBCC domain-containing protein 0.9777 49 146
AF-A0A5R2MWB8-F1-model_v4 SRPBCC domain-containing protein 0.968 49 146
AF-A0A2K9EL50-F1-model_v4 ATPase 0.9652 10 144

Feature Viewer

pLDDT pTM Quality
94.31 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map