F394730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 218 | 244 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100000200|Ga0070665_100000200104 |
| Length | 153 |
| Sequence | MTETLAAKSIVVERTMPHPPEKVWRALTQAPLIAEWLMQNDFQPVVGHRFNFRATPIPNMWNGVTDCEVLVVEPAKRLVYSWNASGEEAKDGLKTTVTWTLTSVEGGTHVRMEQSGFRPQDEGGYQAMGGGWPRIVAGLERVAGELGRPAAPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 2 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 3 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 4 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 5 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 6 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 7 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 8 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 9 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 10 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 11 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 12 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 13 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 14 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 15 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 16 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 17 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 18 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 19 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 20 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 21 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 22 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 23 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 24 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 25 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 26 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 27 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 28 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 29 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 30 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 31 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 32 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 33 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 34 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 35 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 36 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 37 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 38 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 39 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 40 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 116 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 120 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 121 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 125 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 126 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 133 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 134 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 135 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 136 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 138 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 143 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 178 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 194 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 202 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 203 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 205 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 206 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 207 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 208 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 209 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 210 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 211 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 212 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 213 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 214 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 215 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 216 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 217 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 218 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.61 |
| Metatranscriptomes | 0.33 |
| Isolates | 18.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.01 |
| Nodule | 18.06 |
| Rhizoplane | 2.01 |
| Rhizosphere | 74.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10041650 | 3300003322 | Bacteria | 4600 |
| 2 | JGI25404J52841_10017565 | 3300003659 | Bacteria | 1551 |
| 3 | JGI25404J52841_10017688 | 3300003659 | Bacteria | 1545 |
| 4 | JGI25404J52841_10056147 | 3300003659 | Bacteria | 826 |
| 5 | Ga0055542_1010283 | 3300003762 | Bacteria | 1717 |
| 6 | Ga0070683_101002204 | 3300005329 | Bacteria | 802 |
| 7 | Ga0070677_10000281 | 3300005333 | Bacteria | 17846 |
| 8 | Ga0070680_100042177 | 3300005336 | Bacteria | 3701 |
| 9 | Ga0070680_100047427 | 3300005336 | Bacteria | 3498 |
| 10 | Ga0068868_100000036 | 3300005338 | Bacteria | 74490 |
| 11 | Ga0070660_100000347 | 3300005339 | Bacteria | 30909 |
| 12 | Ga0070660_100047820 | 3300005339 | Bacteria | 3284 |
| 13 | Ga0070660_100217346 | 3300005339 | Bacteria | 1553 |
| 14 | Ga0070660_100431050 | 3300005339 | Bacteria | 1092 |
| 15 | Ga0070689_100851551 | 3300005340 | Bacteria | 804 |
| 16 | Ga0070675_100595209 | 3300005354 | Bacteria | 1003 |
| 17 | Ga0070673_101339601 | 3300005364 | Bacteria | 673 |
| 18 | Ga0070659_100000034 | 3300005366 | Bacteria | 115416 |
| 19 | Ga0070659_100013135 | 3300005366 | Bacteria | 6158 |
| 20 | Ga0070659_100023347 | 3300005366 | Bacteria | 4732 |
| 21 | Ga0070681_10024191 | 3300005458 | Bacteria | 6114 |
| 22 | Ga0070681_10316569 | 3300005458 | Bacteria | 1470 |
| 23 | Ga0070681_11289667 | 3300005458 | Bacteria | 653 |
| 24 | Ga0070685_10086167 | 3300005466 | Bacteria | 1893 |
| 25 | Ga0070685_11330562 | 3300005466 | Bacteria | 549 |
| 26 | Ga0070685_11478543 | 3300005466 | Bacteria | 523 |
| 27 | Ga0070699_100587319 | 3300005518 | Bacteria | 1015 |
| 28 | Ga0070679_100043013 | 3300005530 | Bacteria | 4499 |
| 29 | Ga0070679_101218139 | 3300005530 | Bacteria | 698 |
| 30 | Ga0070684_100184550 | 3300005535 | Bacteria | 1897 |
| 31 | Ga0070684_101503114 | 3300005535 | Bacteria | 635 |
| 32 | Ga0070697_100184995 | 3300005536 | Bacteria | 1767 |
| 33 | Ga0068853_100034848 | 3300005539 | Bacteria | 4274 |
| 34 | Ga0068853_100163561 | 3300005539 | Bacteria | 2009 |
| 35 | Ga0070695_101444255 | 3300005545 | Bacteria | 571 |
| 36 | Ga0070665_100000200 | 3300005548 | Bacteria | 105708 |
| 37 | Ga0070665_100000413 | 3300005548 | Bacteria | 62505 |
| 38 | Ga0070704_102161296 | 3300005549 | Unclassified | 517 |
| 39 | Ga0068855_100135468 | 3300005563 | Bacteria | 2810 |
| 40 | Ga0068855_100339941 | 3300005563 | Bacteria | 1655 |
| 41 | Ga0068854_100442972 | 3300005578 | Bacteria | 1083 |
| 42 | Ga0068856_100734269 | 3300005614 | Bacteria | 1007 |
| 43 | Ga0068856_101247683 | 3300005614 | Bacteria | 759 |
| 44 | Ga0068862_100417703 | 3300005844 | Bacteria | 1258 |
| 45 | Ga0081455_10019068 | 3300005937 | Bacteria | 6504 |
| 46 | Ga0081455_10248806 | 3300005937 | Bacteria | 1301 |
| 47 | Ga0081455_10657452 | 3300005937 | Bacteria | 674 |
| 48 | Ga0081540_1010579 | 3300005983 | Bacteria | 6232 |
| 49 | Ga0081540_1052733 | 3300005983 | Bacteria | 2000 |
| 50 | Ga0081540_1219479 | 3300005983 | Bacteria | 678 |
| 51 | Ga0081539_10064173 | 3300005985 | Bacteria | 2000 |
| 52 | Ga0081539_10248660 | 3300005985 | Bacteria | 791 |
| 53 | Ga0068865_100001871 | 3300006881 | Bacteria | 12372 |
| 54 | Ga0099794_10014799 | 3300007265 | Bacteria | 3428 |
| 55 | Ga0099794_10318132 | 3300007265 | Bacteria | 807 |
| 56 | Ga0105240_10000498 | 3300009093 | Bacteria | 72329 |
| 57 | Ga0105240_10043695 | 3300009093 | Bacteria | 5699 |
| 58 | Ga0105240_10093354 | 3300009093 | Bacteria | 3673 |
| 59 | Ga0105240_10121343 | 3300009093 | Bacteria | 3147 |
| 60 | Ga0105240_10146161 | 3300009093 | Bacteria | 2821 |
| 61 | Ga0105240_11363577 | 3300009093 | Bacteria | 746 |
| 62 | Ga0105245_10026256 | 3300009098 | Bacteria | 5125 |
| 63 | Ga0105245_10597929 | 3300009098 | Bacteria | 1129 |
| 64 | Ga0105241_12220599 | 3300009174 | Bacteria | 545 |
| 65 | Ga0105248_10728209 | 3300009177 | Bacteria | 1119 |
| 66 | Ga0105237_10291497 | 3300009545 | Bacteria | 1635 |
| 67 | Ga0105238_10029306 | 3300009551 | Bacteria | 5608 |
| 68 | Ga0105238_10280980 | 3300009551 | Bacteria | 1646 |
| 69 | Ga0105238_10324849 | 3300009551 | Bacteria | 1525 |
| 70 | Ga0105239_10105590 | 3300010375 | Bacteria | 3119 |
| 71 | Ga0105239_10385617 | 3300010375 | Bacteria | 1585 |
| 72 | Ga0105239_10991300 | 3300010375 | Bacteria | 966 |
| 73 | Ga0157370_10804505 | 3300013104 | Bacteria | 855 |
| 74 | Ga0157369_10347483 | 3300013105 | Bacteria | 1541 |
| 75 | Ga0157369_10397671 | 3300013105 | Bacteria | 1429 |
| 76 | Ga0163163_11589959 | 3300014325 | Bacteria | 715 |
| 77 | Ga0157380_12613583 | 3300014326 | Bacteria | 571 |
| 78 | Ga0157380_13142520 | 3300014326 | Bacteria | 527 |
| 79 | Ga0206356_11022645 | 3300020070 | Bacteria | 1754 |
| 80 | Ga0213872_10008439 | 3300021361 | Bacteria | 4988 |
| 81 | Ga0213876_10041056 | 3300021384 | Bacteria | 2445 |
| 82 | Ga0209148_1000465 | 3300025254 | Bacteria | 43292 |
| 83 | Ga0209455_1000412 | 3300025272 | Bacteria | 34309 |
| 84 | Ga0209050_1032177 | 3300025298 | Bacteria | 1619 |
| 85 | Ga0209257_1049756 | 3300025304 | Bacteria | 1191 |
| 86 | Ga0207682_10000508 | 3300025893 | Bacteria | 17882 |
| 87 | Ga0207680_10959106 | 3300025903 | Unclassified | 613 |
| 88 | Ga0207680_11136854 | 3300025903 | Bacteria | 558 |
| 89 | Ga0207705_10013009 | 3300025909 | Bacteria | 6006 |
| 90 | Ga0207705_10491637 | 3300025909 | Bacteria | 953 |
| 91 | Ga0207707_10046301 | 3300025912 | Bacteria | 3788 |
| 92 | Ga0207707_10113010 | 3300025912 | Bacteria | 2374 |
| 93 | Ga0207707_10511081 | 3300025912 | Bacteria | 1024 |
| 94 | Ga0207695_10000106 | 3300025913 | Bacteria | 253001 |
| 95 | Ga0207695_10079834 | 3300025913 | Bacteria | 3314 |
| 96 | Ga0207695_10151897 | 3300025913 | Bacteria | 2254 |
| 97 | Ga0207660_10033004 | 3300025917 | Bacteria | 3577 |
| 98 | Ga0207660_10044757 | 3300025917 | Bacteria | 3115 |
| 99 | Ga0207657_10000839 | 3300025919 | Bacteria | 32505 |
| 100 | Ga0207657_10019333 | 3300025919 | Bacteria | 6473 |
| 101 | Ga0207657_10028056 | 3300025919 | Bacteria | 5144 |
| 102 | Ga0207657_10040915 | 3300025919 | Bacteria | 4103 |
| 103 | Ga0207652_10052602 | 3300025921 | Bacteria | 3496 |
| 104 | Ga0207652_10177413 | 3300025921 | Bacteria | 1914 |
| 105 | Ga0207646_10350292 | 3300025922 | Bacteria | 1334 |
| 106 | Ga0207694_10028484 | 3300025924 | Bacteria | 4259 |
| 107 | Ga0207694_10087056 | 3300025924 | Bacteria | 2460 |
| 108 | Ga0207694_10172969 | 3300025924 | Bacteria | 1749 |
| 109 | Ga0207694_10187682 | 3300025924 | Bacteria | 1678 |
| 110 | Ga0207659_10653617 | 3300025926 | Bacteria | 899 |
| 111 | Ga0207687_10051099 | 3300025927 | Bacteria | 2880 |
| 112 | Ga0207687_10464566 | 3300025927 | Bacteria | 1051 |
| 113 | Ga0207690_10000005 | 3300025932 | Bacteria | 581199 |
| 114 | Ga0207690_10000092 | 3300025932 | Bacteria | 74832 |
| 115 | Ga0207690_10081481 | 3300025932 | Bacteria | 2261 |
| 116 | Ga0207709_10770029 | 3300025935 | Bacteria | 775 |
| 117 | Ga0207704_10002011 | 3300025938 | Bacteria | 9122 |
| 118 | Ga0207661_12072358 | 3300025944 | Bacteria | 515 |
| 119 | Ga0207667_10009459 | 3300025949 | Bacteria | 11476 |
| 120 | Ga0207667_10073757 | 3300025949 | Unclassified | 3546 |
| 121 | Ga0207667_10405358 | 3300025949 | Bacteria | 1388 |
| 122 | Ga0207712_11963193 | 3300025961 | Bacteria | 524 |
| 123 | Ga0207640_10727601 | 3300025981 | Bacteria | 853 |
| 124 | Ga0207677_10000044 | 3300026023 | Bacteria | 107614 |
| 125 | Ga0207639_10254043 | 3300026041 | Bacteria | 1534 |
| 126 | Ga0207639_10649230 | 3300026041 | Bacteria | 976 |
| 127 | Ga0207708_10776523 | 3300026075 | Bacteria | 824 |
| 128 | Ga0207702_10465302 | 3300026078 | Bacteria | 1229 |
| 129 | Ga0207676_10461981 | 3300026095 | Bacteria | 1199 |
| 130 | Ga0209588_1020916 | 3300027671 | Bacteria | 2050 |
| 131 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 132 | Ga0268266_10006767 | 3300028379 | Bacteria | 10451 |
| 133 | Ga0265325_10195809 | 3300031241 | Bacteria | 934 |
| 134 | Ga0265340_10260779 | 3300031247 | Bacteria | 771 |
| 135 | Ga0265339_10222482 | 3300031249 | Bacteria | 922 |
| 136 | Ga0265331_10038616 | 3300031250 | Bacteria | 2333 |
| 137 | Ga0265316_10021869 | 3300031344 | Bacteria | 5407 |
| 138 | Ga0307508_10122543 | 3300031616 | Bacteria | 2203 |
| 139 | Ga0316575_10117640 | 3300031665 | Unclassified | 1086 |
| 140 | Ga0265314_10206961 | 3300031711 | Bacteria | 1155 |
| 141 | Ga0265342_10437434 | 3300031712 | Unclassified | 672 |
| 142 | Ga0373934_0073143 | 3300035086 | Bacteria | 1372 |
| 143 | Ga0373953_0003987 | 3300035117 | Bacteria | 4659 |
| 144 | Ga0373954_0002162 | 3300035118 | Bacteria | 8158 |
| 145 | Ga0373956_0001820 | 3300035119 | Bacteria | 8808 |
| 146 | Ga0373933_0003732 | 3300035724 | Bacteria | 8418 |
| 147 | Ga0373937_0009343 | 3300036401 | Bacteria | 8515 |
| 148 | Ga0395899_0080263 | 3300037312 | Bacteria | 2375 |
| 149 | Ga0395899_0092001 | 3300037312 | Bacteria | 2197 |
| 150 | Ga0395898_0490302 | 3300037466 | Bacteria | 1169 |
| 151 | Ga0395905_0036952 | 3300037471 | Bacteria | 4588 |
| 152 | Ga0395905_0418413 | 3300037471 | Bacteria | 1236 |
| 153 | Ga0395905_1129555 | 3300037471 | Bacteria | 687 |
| 154 | Ga0395905_1259903 | 3300037471 | Bacteria | 643 |
| 155 | Ga0395901_0407537 | 3300038443 | Bacteria | 1396 |
| 156 | Ga0436365_0533570 | 3300039437 | Bacteria | 34633 |
| 157 | Ga0436361_0351327 | 3300039447 | Bacteria | 31675 |
| 158 | Ga0436361_0998143 | 3300039447 | Bacteria | 2810 |
| 159 | Ga0451793_1049502 | 3300041452 | Bacteria | 510 |
| 160 | Ga0451797_0381420 | 3300041453 | Bacteria | 1565 |
| 161 | Ga0451802_1347149 | 3300041460 | Bacteria | 1293 |
| 162 | Ga0466972_0159542 | 3300044658 | Bacteria | 1060 |
| 163 | Ga0466961_0103469 | 3300044693 | Bacteria | 1793 |
| 164 | Ga0466961_0408299 | 3300044693 | Bacteria | 824 |
| 165 | Ga0466957_0408690 | 3300044842 | Bacteria | 930 |
| 166 | Ga0466960_0025382 | 3300044901 | Bacteria | 2682 |
| 167 | Ga0466967_1701789 | 3300045976 | Bacteria | 628 |
| 168 | Ga0495592_0009829 | 3300046454 | Bacteria | 7200 |
| 169 | Ga0495629_0002134 | 3300046459 | Bacteria | 15342 |
| 170 | Ga0495629_0204939 | 3300046459 | Bacteria | 1363 |
| 171 | Ga0495651_0105550 | 3300046462 | Bacteria | 2089 |
| 172 | Ga0495653_0000647 | 3300046463 | Bacteria | 26558 |
| 173 | Ga0495664_0503252 | 3300046477 | Bacteria | 723 |
| 174 | Ga0495584_0172241 | 3300046491 | Bacteria | 1100 |
| 175 | Ga0495608_0004413 | 3300046511 | Bacteria | 10072 |
| 176 | Ga0495618_0031454 | 3300046514 | Bacteria | 3320 |
| 177 | Ga0495628_0042585 | 3300046516 | Bacteria | 3621 |
| 178 | Ga0495652_0005561 | 3300046529 | Bacteria | 11853 |
| 179 | Ga0495645_0020621 | 3300046543 | Bacteria | 4759 |
| 180 | Ga0495645_0094355 | 3300046543 | Bacteria | 2134 |
| 181 | Ga0495633_0207295 | 3300046558 | Bacteria | 899 |
| 182 | Ga0495667_0001481 | 3300046559 | Bacteria | 15461 |
| 183 | Ga0495668_0090244 | 3300046616 | Bacteria | 1679 |
| 184 | Ga0495668_0228802 | 3300046616 | Bacteria | 1018 |
| 185 | Ga0495668_0822042 | 3300046616 | Bacteria | 515 |
| 186 | Ga0495634_0024763 | 3300046642 | Bacteria | 4207 |
| 187 | Ga0495611_0203742 | 3300046648 | Bacteria | 922 |
| 188 | Ga0495635_0003883 | 3300046663 | Bacteria | 10385 |
| 189 | Ga0495659_0218456 | 3300046664 | Bacteria | 786 |
| 190 | Ga0495657_0223879 | 3300046675 | Bacteria | 1139 |
| 191 | Ga0495599_0002953 | 3300046678 | Bacteria | 9894 |
| 192 | Ga0495646_0012783 | 3300046680 | Bacteria | 5335 |
| 193 | Ga0495613_0094130 | 3300046689 | Bacteria | 2168 |
| 194 | Ga0495613_0380433 | 3300046689 | Bacteria | 965 |
| 195 | Ga0495600_0018780 | 3300046809 | Bacteria | 4410 |
| 196 | Ga0495660_0358244 | 3300046810 | Bacteria | 647 |
| 197 | Ga0495604_0013061 | 3300047317 | Bacteria | 6616 |
| 198 | Ga0495672_0074945 | 3300047320 | Bacteria | 1904 |
| 199 | Ga0495675_0001613 | 3300047444 | Bacteria | 13553 |
| 200 | Ga0495684_0000481 | 3300047471 | Bacteria | 32605 |
| 201 | Ga0495686_0163891 | 3300047472 | Bacteria | 1297 |
| 202 | Ga0495593_0012206 | 3300047673 | Bacteria | 4911 |
| 203 | Ga0495602_0021208 | 3300048088 | Bacteria | 6401 |
| 204 | Ga0495602_0807911 | 3300048088 | Bacteria | 629 |
| 205 | Ga0496100_1221884 | 3300048903 | Unclassified | 593 |
| 206 | Ga0496112_0319886 | 3300048915 | Bacteria | 1496 |
| 207 | Ga0496115_0023896 | 3300048918 | Bacteria | 4746 |
| 208 | Ga0496126_0116609 | 3300048929 | Bacteria | 2321 |
| 209 | Ga0496126_0727870 | 3300048929 | Bacteria | 768 |
| 210 | Ga0501032_0269305 | 3300049569 | Bacteria | 1104 |
| 211 | Ga0501034_0079515 | 3300049571 | Bacteria | 3282 |
| 212 | Ga0501036_0688289 | 3300049572 | Bacteria | 845 |
| 213 | Ga0501037_0606838 | 3300049573 | Bacteria | 734 |
| 214 | Ga0501038_0450567 | 3300049574 | Bacteria | 989 |
| 215 | Ga0501039_0061947 | 3300049575 | Bacteria | 2898 |
| 216 | Ga0501043_0005885 | 3300049579 | Bacteria | 9865 |
| 217 | Ga0501043_0751525 | 3300049579 | Bacteria | 709 |
| 218 | Ga0501046_0750624 | 3300049580 | Bacteria | 685 |
| 219 | Ga0501047_0026712 | 3300049581 | Bacteria | 5557 |
| 220 | Ga0501047_0038742 | 3300049581 | Bacteria | 4611 |
| 221 | Ga0501047_0149650 | 3300049581 | Bacteria | 2211 |
| 222 | Ga0501048_0266723 | 3300049582 | Bacteria | 1217 |
| 223 | Ga0501067_0020846 | 3300049583 | Bacteria | 3627 |
| 224 | Ga0501067_0041024 | 3300049583 | Bacteria | 2570 |
| 225 | Ga0501068_0068490 | 3300049584 | Bacteria | 2163 |
| 226 | Ga0501069_0695481 | 3300049585 | Bacteria | 613 |
| 227 | Ga0501073_0081735 | 3300049589 | Bacteria | 2247 |
| 228 | Ga0501074_0309073 | 3300049590 | Bacteria | 1123 |
| 229 | Ga0501249_013171 | 3300049679 | Bacteria | 1756 |
| 230 | Ga0501080_0000625 | 3300049742 | Bacteria | 28031 |
| 231 | Ga0501083_0046501 | 3300049744 | Bacteria | 2934 |
| 232 | Ga0501083_0365925 | 3300049744 | Bacteria | 938 |
| 233 | Ga0501035_0048282 | 3300049822 | Bacteria | 3818 |
| 234 | Ga0501035_1154329 | 3300049822 | Bacteria | 603 |
| 235 | Ga0501044_0057205 | 3300049823 | Bacteria | 4002 |
| 236 | Ga0501044_0684124 | 3300049823 | Bacteria | 912 |
| 237 | Ga0495601_0036802 | 3300053077 | Bacteria | 3058 |
| 238 | Ga0495595_0003736 | 3300053084 | Bacteria | 6053 |
| 239 | Ga0495619_0001635 | 3300053085 | Bacteria | 14776 |
| 240 | Ga0500595_013307 | 3300053119 | Bacteria | 3155 |
| 241 | Ga0500595_028777 | 3300053119 | Bacteria | 1892 |
| 242 | Ga0500595_056196 | 3300053119 | Bacteria | 1203 |
| 243 | Ga0500609_026625 | 3300053731 | Bacteria | 793 |
| 244 | Ga0501082_0017632 | 3300060353 | Bacteria | 6150 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041452 | Ga0451793_1049502 | Ga0451793_1049502_112_486 | 123 |
| 2 | 3300005336 | Ga0070680_100042177 | Ga0070680_1000421775 | 125 |
| 3 | 3300005339 | Ga0070660_100431050 | Ga0070660_1004310502 | 125 |
| 4 | 3300005366 | Ga0070659_100023347 | Ga0070659_1000233472 | 125 |
| 5 | 3300005458 | Ga0070681_10024191 | Ga0070681_100241913 | 125 |
| 6 | 3300005530 | Ga0070679_100043013 | Ga0070679_1000430132 | 125 |
| 7 | 3300005539 | Ga0068853_100163561 | Ga0068853_1001635614 | 125 |
| 8 | 3300025903 | Ga0207680_11136854 | Ga0207680_111368541 | 125 |
| 9 | 3300005329 | Ga0070683_101002204 | Ga0070683_1010022041 | 126 |
| 10 | 3300025909 | Ga0207705_10013009 | Ga0207705_100130096 | 126 |
| 11 | 3300025912 | Ga0207707_10046301 | Ga0207707_100463012 | 126 |
| 12 | 3300025917 | Ga0207660_10033004 | Ga0207660_100330045 | 126 |
| 13 | 3300025919 | Ga0207657_10019333 | Ga0207657_100193335 | 126 |
| 14 | 3300025921 | Ga0207652_10052602 | Ga0207652_100526022 | 126 |
| 15 | 3300025932 | Ga0207690_10081481 | Ga0207690_100814812 | 126 |
| 16 | 3300025944 | Ga0207661_12072358 | Ga0207661_120723581 | 126 |
| 17 | 3300025949 | Ga0207667_10009459 | Ga0207667_1000945910 | 126 |
| 18 | 3300014326 | Ga0157380_12613583 | Ga0157380_126135832 | 129 |
| 19 | 3300046616 | Ga0495668_0090244 | Ga0495668_0090244_654_1097 | 129 |
| 20 | 3300053119 | Ga0500595_013307 | Ga0500595_013307_1197_1634 | 129 |
| 21 | 3300053731 | Ga0500609_026625 | Ga0500609_026625_389_778 | 129 |
| 22 | 3300049581 | Ga0501047_0149650 | Ga0501047_0149650_12_404 | 130 |
| 23 | 3300041453 | Ga0451797_0381420 | Ga0451797_0381420_522_929 | 134 |
| 24 | 3300041460 | Ga0451802_1347149 | Ga0451802_1347149_675_1082 | 134 |
| 25 | 3300049679 | Ga0501249_013171 | Ga0501249_013171_549_962 | 135 |
| 26 | 3300039447 | Ga0436361_0351327 | Ga0436361_0351327_479_898 | 136 |
| 27 | 3300048915 | Ga0496112_0319886 | Ga0496112_0319886_1026_1445 | 137 |
| 28 | iso_pu_bacteria | 2508501123 | 2509115962 | 138 |
| 29 | iso_pu_bacteria | 2513237144 | 2513912499 | 138 |
| 30 | iso_pu_bacteria | 2856320880 | 2856325622 | 138 |
| 31 | iso_pu_bacteria | 2869278585 | 2869279246 | 138 |
| 32 | iso_pu_bacteria | 2878738818 | 2878745629 | 138 |
| 33 | iso_pu_bacteria | 2924718760 | 2924722372 | 138 |
| 34 | iso_pu_bacteria | 2924776078 | 2924783873 | 138 |
| 35 | iso_pu_bacteria | 2937877337 | 2937877405 | 138 |
| 36 | iso_pu_bacteria | 2937972304 | 2937975490 | 138 |
| 37 | iso_pu_bacteria | 2958034702 | 2958035387 | 138 |
| 38 | iso_pu_bacteria | 2958041894 | 2958043574 | 138 |
| 39 | iso_pu_bacteria | 2958084443 | 2958084511 | 138 |
| 40 | iso_pu_bacteria | 2958144490 | 2958147220 | 138 |
| 41 | iso_pu_bacteria | 2968016561 | 2968018067 | 138 |
| 42 | iso_pu_bacteria | 2970593180 | 2970593842 | 138 |
| 43 | iso_pu_bacteria | 2996348954 | 2996350543 | 138 |
| 44 | iso_pu_bacteria | 3004275668 | 3004277241 | 138 |
| 45 | iso_pu_bacteria | 8016622563 | 8016623008 | 138 |
| 46 | iso_pu_bacteria | 8019547302 | 8019550011 | 138 |
| 47 | 3300005354 | Ga0070675_100595209 | Ga0070675_1005952092 | 139 |
| 48 | 3300009098 | Ga0105245_10026256 | Ga0105245_100262566 | 139 |
| 49 | 3300009177 | Ga0105248_10728209 | Ga0105248_107282092 | 139 |
| 50 | 3300025926 | Ga0207659_10653617 | Ga0207659_106536171 | 139 |
| 51 | 3300025927 | Ga0207687_10051099 | Ga0207687_100510994 | 139 |
| 52 | 3300031344 | Ga0265316_10021869 | Ga0265316_100218693 | 139 |
| 53 | 3300031712 | Ga0265342_10437434 | Ga0265342_104374341 | 139 |
| 54 | 3300005535 | Ga0070684_101503114 | Ga0070684_1015031141 | 140 |
| 55 | 3300005548 | Ga0070665_100000413 | Ga0070665_10000041312 | 140 |
| 56 | 3300005563 | Ga0068855_100339941 | Ga0068855_1003399411 | 140 |
| 57 | 3300009093 | Ga0105240_10121343 | Ga0105240_101213434 | 140 |
| 58 | 3300009093 | Ga0105240_11363577 | Ga0105240_113635772 | 140 |
| 59 | 3300009545 | Ga0105237_10291497 | Ga0105237_102914973 | 140 |
| 60 | 3300009551 | Ga0105238_10029306 | Ga0105238_100293064 | 140 |
| 61 | 3300010375 | Ga0105239_10385617 | Ga0105239_103856172 | 140 |
| 62 | 3300010375 | Ga0105239_10991300 | Ga0105239_109913001 | 140 |
| 63 | 3300025924 | Ga0207694_10087056 | Ga0207694_100870563 | 140 |
| 64 | 3300028379 | Ga0268266_10006767 | Ga0268266_1000676711 | 140 |
| 65 | 3300044901 | Ga0466960_0025382 | Ga0466960_0025382_1450_1890 | 140 |
| 66 | 3300048929 | Ga0496126_0116609 | Ga0496126_0116609_1427_1867 | 140 |
| 67 | 3300053119 | Ga0500595_028777 | Ga0500595_028777_656_1078 | 140 |
| 68 | iso_pu_bacteria | 2935769743 | 2935772949 | 140 |
| 69 | iso_pu_bacteria | 2935777560 | 2935783260 | 140 |
| 70 | iso_pu_bacteria | 2935785616 | 2935788063 | 140 |
| 71 | iso_pu_bacteria | 2935793552 | 2935796361 | 140 |
| 72 | iso_pu_bacteria | 8016522445 | 8016526238 | 140 |
| 73 | iso_pu_bacteria | 8016530956 | 8016539856 | 140 |
| 74 | iso_pu_bacteria | 8016539877 | 8016544160 | 140 |
| 75 | iso_pu_bacteria | 8016548790 | 8016549147 | 140 |
| 76 | iso_pu_bacteria | 8016557553 | 8016557571 | 140 |
| 77 | iso_pu_bacteria | 8016566248 | 8016569565 | 140 |
| 78 | iso_pu_bacteria | 8016575299 | 8016582176 | 140 |
| 79 | iso_pu_bacteria | 8016595262 | 8016595611 | 140 |
| 80 | iso_pu_bacteria | 8016613128 | 8016618363 | 140 |
| 81 | iso_pu_bacteria | 8019530166 | 8019531133 | 140 |
| 82 | iso_pu_bacteria | 8019538911 | 8019540421 | 140 |
| 83 | 3300005364 | Ga0070673_101339601 | Ga0070673_1013396011 | 141 |
| 84 | 3300005530 | Ga0070679_101218139 | Ga0070679_1012181392 | 141 |
| 85 | 3300009093 | Ga0105240_10000498 | Ga0105240_1000049840 | 141 |
| 86 | 3300025913 | Ga0207695_10000106 | Ga0207695_1000010648 | 141 |
| 87 | 3300026075 | Ga0207708_10776523 | Ga0207708_107765232 | 141 |
| 88 | 3300037312 | Ga0395899_0080263 | Ga0395899_0080263_1886_2311 | 141 |
| 89 | 3300005338 | Ga0068868_100000036 | Ga0068868_10000003662 | 142 |
| 90 | 3300005339 | Ga0070660_100000347 | Ga0070660_10000034713 | 142 |
| 91 | 3300005366 | Ga0070659_100000034 | Ga0070659_100000034127 | 142 |
| 92 | 3300005466 | Ga0070685_11330562 | Ga0070685_113305621 | 142 |
| 93 | 3300005466 | Ga0070685_11478543 | Ga0070685_114785431 | 142 |
| 94 | 3300005985 | Ga0081539_10248660 | Ga0081539_102486601 | 142 |
| 95 | 3300006881 | Ga0068865_100001871 | Ga0068865_10000187111 | 142 |
| 96 | 3300009098 | Ga0105245_10597929 | Ga0105245_105979292 | 142 |
| 97 | 3300013105 | Ga0157369_10347483 | Ga0157369_103474832 | 142 |
| 98 | 3300014325 | Ga0163163_11589959 | Ga0163163_115899592 | 142 |
| 99 | 3300025919 | Ga0207657_10000839 | Ga0207657_1000083934 | 142 |
| 100 | 3300025927 | Ga0207687_10464566 | Ga0207687_104645662 | 142 |
| 101 | 3300025932 | Ga0207690_10000005 | Ga0207690_10000005335 | 142 |
| 102 | 3300025935 | Ga0207709_10770029 | Ga0207709_107700291 | 142 |
| 103 | 3300025938 | Ga0207704_10002011 | Ga0207704_1000201110 | 142 |
| 104 | 3300025961 | Ga0207712_11963193 | Ga0207712_119631931 | 142 |
| 105 | 3300026023 | Ga0207677_10000044 | Ga0207677_1000004429 | 142 |
| 106 | 3300026095 | Ga0207676_10461981 | Ga0207676_104619811 | 142 |
| 107 | 3300037312 | Ga0395899_0092001 | Ga0395899_0092001_1390_1830 | 142 |
| 108 | 3300037466 | Ga0395898_0490302 | Ga0395898_0490302_235_675 | 142 |
| 109 | 3300037471 | Ga0395905_0036952 | Ga0395905_0036952_3583_4023 | 142 |
| 110 | 3300038443 | Ga0395901_0407537 | Ga0395901_0407537_441_881 | 142 |
| 111 | 3300046543 | Ga0495645_0094355 | Ga0495645_0094355_146_583 | 142 |
| 112 | 3300046616 | Ga0495668_0228802 | Ga0495668_0228802_404_841 | 142 |
| 113 | 3300046689 | Ga0495613_0380433 | Ga0495613_0380433_474_911 | 142 |
| 114 | 3300048088 | Ga0495602_0807911 | Ga0495602_0807911_145_582 | 142 |
| 115 | iso_pu_bacteria | 2970469710 | 2970471758 | 142 |
| 116 | 3300005336 | Ga0070680_100047427 | Ga0070680_1000474275 | 143 |
| 117 | 3300005339 | Ga0070660_100047820 | Ga0070660_1000478201 | 143 |
| 118 | 3300005339 | Ga0070660_100217346 | Ga0070660_1002173462 | 143 |
| 119 | 3300005366 | Ga0070659_100013135 | Ga0070659_1000131354 | 143 |
| 120 | 3300005536 | Ga0070697_100184995 | Ga0070697_1001849953 | 143 |
| 121 | 3300005548 | Ga0070665_100000200 | Ga0070665_100000200104 | 143 |
| 122 | 3300005563 | Ga0068855_100135468 | Ga0068855_1001354684 | 143 |
| 123 | 3300005578 | Ga0068854_100442972 | Ga0068854_1004429722 | 143 |
| 124 | 3300005614 | Ga0068856_100734269 | Ga0068856_1007342692 | 143 |
| 125 | 3300005937 | Ga0081455_10248806 | Ga0081455_102488063 | 143 |
| 126 | 3300007265 | Ga0099794_10014799 | Ga0099794_100147992 | 143 |
| 127 | 3300009093 | Ga0105240_10043695 | Ga0105240_100436954 | 143 |
| 128 | 3300009093 | Ga0105240_10093354 | Ga0105240_100933542 | 143 |
| 129 | 3300009093 | Ga0105240_10146161 | Ga0105240_101461612 | 143 |
| 130 | 3300009174 | Ga0105241_12220599 | Ga0105241_122205991 | 143 |
| 131 | 3300009551 | Ga0105238_10280980 | Ga0105238_102809803 | 143 |
| 132 | 3300010375 | Ga0105239_10105590 | Ga0105239_101055904 | 143 |
| 133 | 3300013104 | Ga0157370_10804505 | Ga0157370_108045052 | 143 |
| 134 | 3300025903 | Ga0207680_10959106 | Ga0207680_109591061 | 143 |
| 135 | 3300025909 | Ga0207705_10491637 | Ga0207705_104916372 | 143 |
| 136 | 3300025913 | Ga0207695_10079834 | Ga0207695_100798343 | 143 |
| 137 | 3300025913 | Ga0207695_10151897 | Ga0207695_101518974 | 143 |
| 138 | 3300025917 | Ga0207660_10044757 | Ga0207660_100447575 | 143 |
| 139 | 3300025919 | Ga0207657_10028056 | Ga0207657_100280565 | 143 |
| 140 | 3300025919 | Ga0207657_10040915 | Ga0207657_100409153 | 143 |
| 141 | 3300025924 | Ga0207694_10172969 | Ga0207694_101729692 | 143 |
| 142 | 3300025932 | Ga0207690_10000092 | Ga0207690_1000009220 | 143 |
| 143 | 3300025949 | Ga0207667_10073757 | Ga0207667_100737575 | 143 |
| 144 | 3300025981 | Ga0207640_10727601 | Ga0207640_107276012 | 143 |
| 145 | 3300026041 | Ga0207639_10649230 | Ga0207639_106492302 | 143 |
| 146 | 3300026078 | Ga0207702_10465302 | Ga0207702_104653023 | 143 |
| 147 | 3300027671 | Ga0209588_1020916 | Ga0209588_10209162 | 143 |
| 148 | 3300028379 | Ga0268266_10000005 | Ga0268266_10000005371 | 143 |
| 149 | 3300031250 | Ga0265331_10038616 | Ga0265331_100386163 | 143 |
| 150 | 3300031711 | Ga0265314_10206961 | Ga0265314_102069612 | 143 |
| 151 | 3300035086 | Ga0373934_0073143 | Ga0373934_0073143_352_792 | 143 |
| 152 | 3300035117 | Ga0373953_0003987 | Ga0373953_0003987_2140_2580 | 143 |
| 153 | 3300035118 | Ga0373954_0002162 | Ga0373954_0002162_5495_5935 | 143 |
| 154 | 3300035119 | Ga0373956_0001820 | Ga0373956_0001820_4742_5182 | 143 |
| 155 | 3300035724 | Ga0373933_0003732 | Ga0373933_0003732_3625_4065 | 143 |
| 156 | 3300036401 | Ga0373937_0009343 | Ga0373937_0009343_3971_4411 | 143 |
| 157 | 3300037471 | Ga0395905_1259903 | Ga0395905_1259903_171_611 | 143 |
| 158 | 3300044658 | Ga0466972_0159542 | Ga0466972_0159542_239_682 | 143 |
| 159 | 3300044693 | Ga0466961_0103469 | Ga0466961_0103469_1335_1778 | 143 |
| 160 | 3300044693 | Ga0466961_0408299 | Ga0466961_0408299_133_573 | 143 |
| 161 | 3300044842 | Ga0466957_0408690 | Ga0466957_0408690_228_671 | 143 |
| 162 | 3300046454 | Ga0495592_0009829 | Ga0495592_0009829_4906_5346 | 143 |
| 163 | 3300046459 | Ga0495629_0002134 | Ga0495629_0002134_6669_7109 | 143 |
| 164 | 3300046462 | Ga0495651_0105550 | Ga0495651_0105550_357_797 | 143 |
| 165 | 3300046463 | Ga0495653_0000647 | Ga0495653_0000647_5520_5960 | 143 |
| 166 | 3300046477 | Ga0495664_0503252 | Ga0495664_0503252_125_565 | 143 |
| 167 | 3300046511 | Ga0495608_0004413 | Ga0495608_0004413_8389_8829 | 143 |
| 168 | 3300046514 | Ga0495618_0031454 | Ga0495618_0031454_2159_2599 | 143 |
| 169 | 3300046516 | Ga0495628_0042585 | Ga0495628_0042585_1265_1705 | 143 |
| 170 | 3300046529 | Ga0495652_0005561 | Ga0495652_0005561_5210_5650 | 143 |
| 171 | 3300046543 | Ga0495645_0020621 | Ga0495645_0020621_2209_2649 | 143 |
| 172 | 3300046559 | Ga0495667_0001481 | Ga0495667_0001481_6584_7024 | 143 |
| 173 | 3300046642 | Ga0495634_0024763 | Ga0495634_0024763_1932_2372 | 143 |
| 174 | 3300046663 | Ga0495635_0003883 | Ga0495635_0003883_3531_3971 | 143 |
| 175 | 3300046675 | Ga0495657_0223879 | Ga0495657_0223879_357_797 | 143 |
| 176 | 3300046678 | Ga0495599_0002953 | Ga0495599_0002953_8034_8474 | 143 |
| 177 | 3300046680 | Ga0495646_0012783 | Ga0495646_0012783_1269_1709 | 143 |
| 178 | 3300046689 | Ga0495613_0094130 | Ga0495613_0094130_102_656 | 143 |
| 179 | 3300046809 | Ga0495600_0018780 | Ga0495600_0018780_2088_2528 | 143 |
| 180 | 3300047317 | Ga0495604_0013061 | Ga0495604_0013061_5597_6037 | 143 |
| 181 | 3300047444 | Ga0495675_0001613 | Ga0495675_0001613_4771_5211 | 143 |
| 182 | 3300047471 | Ga0495684_0000481 | Ga0495684_0000481_30255_30695 | 143 |
| 183 | 3300047673 | Ga0495593_0012206 | Ga0495593_0012206_1301_1741 | 143 |
| 184 | 3300048088 | Ga0495602_0021208 | Ga0495602_0021208_3166_3606 | 143 |
| 185 | 3300048903 | Ga0496100_1221884 | Ga0496100_1221884_68_508 | 143 |
| 186 | 3300048918 | Ga0496115_0023896 | Ga0496115_0023896_1112_1573 | 143 |
| 187 | 3300049581 | Ga0501047_0026712 | Ga0501047_0026712_4376_4807 | 143 |
| 188 | 3300049582 | Ga0501048_0266723 | Ga0501048_0266723_315_752 | 143 |
| 189 | 3300049744 | Ga0501083_0365925 | Ga0501083_0365925_415_846 | 143 |
| 190 | 3300049822 | Ga0501035_1154329 | Ga0501035_1154329_41_472 | 143 |
| 191 | 3300049823 | Ga0501044_0684124 | Ga0501044_0684124_346_792 | 143 |
| 192 | 3300053077 | Ga0495601_0036802 | Ga0495601_0036802_863_1303 | 143 |
| 193 | 3300053084 | Ga0495595_0003736 | Ga0495595_0003736_3507_3947 | 143 |
| 194 | 3300053085 | Ga0495619_0001635 | Ga0495619_0001635_6670_7110 | 143 |
| 195 | 3300003659 | JGI25404J52841_10017565 | JGI25404J52841_100175652 | 144 |
| 196 | 3300003659 | JGI25404J52841_10017688 | JGI25404J52841_100176882 | 144 |
| 197 | 3300003659 | JGI25404J52841_10056147 | JGI25404J52841_100561472 | 144 |
| 198 | 3300003762 | Ga0055542_1010283 | Ga0055542_10102833 | 144 |
| 199 | 3300005333 | Ga0070677_10000281 | Ga0070677_100002816 | 144 |
| 200 | 3300005458 | Ga0070681_10316569 | Ga0070681_103165691 | 144 |
| 201 | 3300005458 | Ga0070681_11289667 | Ga0070681_112896672 | 144 |
| 202 | 3300005466 | Ga0070685_10086167 | Ga0070685_100861673 | 144 |
| 203 | 3300005518 | Ga0070699_100587319 | Ga0070699_1005873192 | 144 |
| 204 | 3300005535 | Ga0070684_100184550 | Ga0070684_1001845502 | 144 |
| 205 | 3300005539 | Ga0068853_100034848 | Ga0068853_1000348488 | 144 |
| 206 | 3300005545 | Ga0070695_101444255 | Ga0070695_1014442551 | 144 |
| 207 | 3300005614 | Ga0068856_101247683 | Ga0068856_1012476831 | 144 |
| 208 | 3300005844 | Ga0068862_100417703 | Ga0068862_1004177032 | 144 |
| 209 | 3300005937 | Ga0081455_10019068 | Ga0081455_100190686 | 144 |
| 210 | 3300005937 | Ga0081455_10657452 | Ga0081455_106574521 | 144 |
| 211 | 3300005983 | Ga0081540_1010579 | Ga0081540_10105797 | 144 |
| 212 | 3300005983 | Ga0081540_1052733 | Ga0081540_10527333 | 144 |
| 213 | 3300005983 | Ga0081540_1219479 | Ga0081540_12194791 | 144 |
| 214 | 3300005985 | Ga0081539_10064173 | Ga0081539_100641732 | 144 |
| 215 | 3300007265 | Ga0099794_10318132 | Ga0099794_103181321 | 144 |
| 216 | 3300009551 | Ga0105238_10324849 | Ga0105238_103248491 | 144 |
| 217 | 3300013105 | Ga0157369_10397671 | Ga0157369_103976712 | 144 |
| 218 | 3300014326 | Ga0157380_13142520 | Ga0157380_131425201 | 144 |
| 219 | 3300020070 | Ga0206356_11022645 | Ga0206356_110226453 | 144 |
| 220 | 3300021384 | Ga0213876_10041056 | Ga0213876_100410562 | 144 |
| 221 | 3300025254 | Ga0209148_1000465 | Ga0209148_100046540 | 144 |
| 222 | 3300025272 | Ga0209455_1000412 | Ga0209455_100041221 | 144 |
| 223 | 3300025298 | Ga0209050_1032177 | Ga0209050_10321773 | 144 |
| 224 | 3300025304 | Ga0209257_1049756 | Ga0209257_10497563 | 144 |
| 225 | 3300025893 | Ga0207682_10000508 | Ga0207682_100005086 | 144 |
| 226 | 3300025912 | Ga0207707_10113010 | Ga0207707_101130102 | 144 |
| 227 | 3300025912 | Ga0207707_10511081 | Ga0207707_105110813 | 144 |
| 228 | 3300025921 | Ga0207652_10177413 | Ga0207652_101774135 | 144 |
| 229 | 3300025922 | Ga0207646_10350292 | Ga0207646_103502923 | 144 |
| 230 | 3300025924 | Ga0207694_10028484 | Ga0207694_100284842 | 144 |
| 231 | 3300025924 | Ga0207694_10187682 | Ga0207694_101876823 | 144 |
| 232 | 3300025949 | Ga0207667_10405358 | Ga0207667_104053582 | 144 |
| 233 | 3300026041 | Ga0207639_10254043 | Ga0207639_102540432 | 144 |
| 234 | 3300031241 | Ga0265325_10195809 | Ga0265325_101958092 | 144 |
| 235 | 3300031249 | Ga0265339_10222482 | Ga0265339_102224822 | 144 |
| 236 | 3300031616 | Ga0307508_10122543 | Ga0307508_101225433 | 144 |
| 237 | 3300037471 | Ga0395905_0418413 | Ga0395905_0418413_628_1062 | 144 |
| 238 | 3300037471 | Ga0395905_1129555 | Ga0395905_1129555_233_667 | 144 |
| 239 | 3300039437 | Ga0436365_0533570 | Ga0436365_0533570_503_940 | 144 |
| 240 | 3300039447 | Ga0436361_0998143 | Ga0436361_0998143_64_507 | 144 |
| 241 | 3300046459 | Ga0495629_0204939 | Ga0495629_0204939_671_1105 | 144 |
| 242 | 3300046491 | Ga0495584_0172241 | Ga0495584_0172241_269_709 | 144 |
| 243 | 3300046558 | Ga0495633_0207295 | Ga0495633_0207295_42_482 | 144 |
| 244 | 3300046616 | Ga0495668_0822042 | Ga0495668_0822042_52_486 | 144 |
| 245 | 3300046648 | Ga0495611_0203742 | Ga0495611_0203742_194_634 | 144 |
| 246 | 3300046664 | Ga0495659_0218456 | Ga0495659_0218456_260_700 | 144 |
| 247 | 3300046810 | Ga0495660_0358244 | Ga0495660_0358244_63_503 | 144 |
| 248 | 3300047320 | Ga0495672_0074945 | Ga0495672_0074945_734_1174 | 144 |
| 249 | 3300047472 | Ga0495686_0163891 | Ga0495686_0163891_533_967 | 144 |
| 250 | 3300049569 | Ga0501032_0269305 | Ga0501032_0269305_407_844 | 144 |
| 251 | 3300049571 | Ga0501034_0079515 | Ga0501034_0079515_1247_1684 | 144 |
| 252 | 3300049572 | Ga0501036_0688289 | Ga0501036_0688289_100_537 | 144 |
| 253 | 3300049573 | Ga0501037_0606838 | Ga0501037_0606838_88_525 | 144 |
| 254 | 3300049574 | Ga0501038_0450567 | Ga0501038_0450567_373_810 | 144 |
| 255 | 3300049575 | Ga0501039_0061947 | Ga0501039_0061947_864_1301 | 144 |
| 256 | 3300049579 | Ga0501043_0005885 | Ga0501043_0005885_4440_4877 | 144 |
| 257 | 3300049579 | Ga0501043_0751525 | Ga0501043_0751525_105_569 | 144 |
| 258 | 3300049580 | Ga0501046_0750624 | Ga0501046_0750624_97_534 | 144 |
| 259 | 3300049581 | Ga0501047_0038742 | Ga0501047_0038742_525_962 | 144 |
| 260 | 3300049583 | Ga0501067_0020846 | Ga0501067_0020846_1811_2248 | 144 |
| 261 | 3300049584 | Ga0501068_0068490 | Ga0501068_0068490_611_1048 | 144 |
| 262 | 3300049585 | Ga0501069_0695481 | Ga0501069_0695481_42_506 | 144 |
| 263 | 3300049589 | Ga0501073_0081735 | Ga0501073_0081735_518_955 | 144 |
| 264 | 3300049590 | Ga0501074_0309073 | Ga0501074_0309073_29_466 | 144 |
| 265 | 3300049742 | Ga0501080_0000625 | Ga0501080_0000625_5216_5653 | 144 |
| 266 | 3300049744 | Ga0501083_0046501 | Ga0501083_0046501_619_1056 | 144 |
| 267 | 3300049822 | Ga0501035_0048282 | Ga0501035_0048282_1738_2175 | 144 |
| 268 | 3300049823 | Ga0501044_0057205 | Ga0501044_0057205_346_783 | 144 |
| 269 | 3300053119 | Ga0500595_056196 | Ga0500595_056196_603_1046 | 144 |
| 270 | 3300060353 | Ga0501082_0017632 | Ga0501082_0017632_4583_5020 | 144 |
| 271 | 3300005549 | Ga0070704_102161296 | Ga0070704_1021612961 | 145 |
| 272 | 3300044901 | Ga0466960_0025382 | Ga0466960_0025382_1887_2324 | 145 |
| 273 | 3300048929 | Ga0496126_0727870 | Ga0496126_0727870_308_757 | 145 |
| 274 | 3300003322 | rootL2_10041650 | rootL2_100416503 | 146 |
| 275 | 3300005340 | Ga0070689_100851551 | Ga0070689_1008515512 | 146 |
| 276 | 3300021361 | Ga0213872_10008439 | Ga0213872_100084396 | 146 |
| 277 | 3300031247 | Ga0265340_10260779 | Ga0265340_102607791 | 146 |
| 278 | 3300031665 | Ga0316575_10117640 | Ga0316575_101176401 | 146 |
| 279 | 3300045976 | Ga0466967_1701789 | Ga0466967_1701789_80_520 | 146 |
| 280 | 3300049583 | Ga0501067_0041024 | Ga0501067_0041024_252_698 | 146 |
| 281 | iso_pu_bacteria | 2856364286 | 2856370494 | 146 |
| 282 | iso_pu_bacteria | 2869285874 | 2869291779 | 146 |
| 283 | iso_pu_bacteria | 2871429161 | 2871434988 | 146 |
| 284 | iso_pu_bacteria | 2874146452 | 2874149379 | 146 |
| 285 | iso_pu_bacteria | 2874155637 | 2874157642 | 146 |
| 286 | iso_pu_bacteria | 2876413966 | 2876415845 | 146 |
| 287 | iso_pu_bacteria | 2878745973 | 2878752123 | 146 |
| 288 | iso_pu_bacteria | 2881147464 | 2881151888 | 146 |
| 289 | iso_pu_bacteria | 2903492973 | 2903493319 | 146 |
| 290 | iso_pu_bacteria | 2906308376 | 2906314517 | 146 |
| 291 | iso_pu_bacteria | 2906321335 | 2906327685 | 146 |
| 292 | iso_pu_bacteria | 2937813078 | 2937816180 | 146 |
| 293 | iso_pu_bacteria | 2958041894 | 2958043491 | 146 |
| 294 | iso_pu_bacteria | 2958130278 | 2958136177 | 146 |
| 295 | iso_pu_bacteria | 2958179912 | 2958185645 | 146 |
| 296 | iso_pu_bacteria | 2961077736 | 2961084022 | 146 |
| 297 | iso_pu_bacteria | 2977843712 | 2977846416 | 146 |
| 298 | iso_pu_bacteria | 8004387939 | 8004394495 | 146 |
| 299 | iso_pu_bacteria | 8004714634 | 8004720778 | 146 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3q63-assembly2.cif.gz_D | x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. | 0.9286 | 9 | 146 |
| 3q63-assembly2.cif.gz_D | x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. | 0.9154 | 9 | 146 |
| 4fpw-assembly3.cif.gz_B | crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. | 0.8962 | 8 | 139 |
| 4fpw-assembly3.cif.gz_A | crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. | 0.8946 | 8 | 142 |
| 6v04-assembly1.cif.gz_A | dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus | 0.8495 | 10 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q63F00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9193 | 6 | 146 | 3.30.530.20 |
| 3q63F00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9064 | 6 | 146 | 3.30.530.20 |
| 2m89B00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.847 | 9 | 142 | 3.30.530.20 |
| af_Q9V9Q4_218_347_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8272 | 7 | 141 | 3.30.530.20 |
| af_Q8N9S3_197_326_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8236 | 8 | 141 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y6PZW1-F1-model_v4 | SRPBCC domain-containing protein | 1.002 | 6 | 143 |
|
| AF-A0A7Y6PZW1-F1-model_v4 | SRPBCC domain-containing protein | 0.9803 | 6 | 143 |
|
| AF-A0A5R2MWB8-F1-model_v4 | SRPBCC domain-containing protein | 0.9777 | 49 | 146 |
|
| AF-A0A5R2MWB8-F1-model_v4 | SRPBCC domain-containing protein | 0.968 | 49 | 146 |
|
| AF-A0A2K9EL50-F1-model_v4 | ATPase | 0.9652 | 10 | 144 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar