F394696

General Info

Members Datasets Scaffolds Average Seq Length
299 230 298 69

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100352877|Ga0070714_1003528773
Length 75
Sequence VKGTKPSDLRSRSEDELNEQIDTLGKEIFNLRFQRASGQLENTARVRQVRRDIARIKTILGERRRGQAAGAAGAR

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
105 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
123 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
124 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
125 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
132 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
133 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
134 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
135 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.3
Metatranscriptomes 8.36
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0
Rhizoplane 2.01
Rhizosphere 89.3
Stem 0
Stem Tuber 0
Unclassified 3.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC10445_g1 2010549000 Bacteria 776
2 JGI25151J46595_10000624 3300003187 Bacteria 30772
3 JGI25160J50197_1036456 3300003354 Bacteria 1192
4 Ga0007429J51699_1067287 3300003579 Bacteria 1140
5 JGI25404J52841_10139395 3300003659 Bacteria 514
6 Ga0070676_10747938 3300005328 Bacteria 717
7 Ga0070690_101747335 3300005330 Unclassified 506
8 Ga0070666_10414492 3300005335 Bacteria 969
9 Ga0068868_100564894 3300005338 Bacteria 1004
10 Ga0070668_100018845 3300005347 Bacteria 5184
11 Ga0070669_100836773 3300005353 Bacteria 784
12 Ga0070669_101226162 3300005353 Bacteria 648
13 Ga0070675_100610656 3300005354 Bacteria 989
14 Ga0070674_100917230 3300005356 Bacteria 764
15 Ga0070674_100990442 3300005356 Bacteria 737
16 Ga0070667_100026034 3300005367 Bacteria 4864
17 Ga0070667_100513791 3300005367 Bacteria 1099
18 Ga0070709_10266128 3300005434 Bacteria 1240
19 Ga0070709_10840726 3300005434 Bacteria 723
20 Ga0070714_100352877 3300005435 Bacteria 1382
21 Ga0070714_100860466 3300005435 Bacteria 879
22 Ga0070714_101009384 3300005435 Bacteria 810
23 Ga0070713_100315402 3300005436 Bacteria 1443
24 Ga0070713_100760308 3300005436 Bacteria 927
25 Ga0070713_100766838 3300005436 Bacteria 923
26 Ga0070713_101238061 3300005436 Bacteria 723
27 Ga0070710_10096459 3300005437 Bacteria 1753
28 Ga0070711_100496450 3300005439 Bacteria 1005
29 Ga0070663_100704860 3300005455 Bacteria 858
30 Ga0070663_101772085 3300005455 Bacteria 553
31 Ga0068867_100287201 3300005459 Bacteria 1351
32 Ga0070706_100061175 3300005467 Bacteria 3477
33 Ga0070707_100033707 3300005468 Bacteria 4883
34 Ga0070698_100065506 3300005471 Bacteria 3658
35 Ga0070699_100036064 3300005518 Bacteria 4277
36 Ga0070697_100595433 3300005536 Bacteria 971
37 Ga0068853_100709018 3300005539 Bacteria 960
38 Ga0070665_100029959 3300005548 Bacteria 5477
39 Ga0070665_100598287 3300005548 Bacteria 1116
40 Ga0070664_100490429 3300005564 Bacteria 1131
41 Ga0068857_100560610 3300005577 Bacteria 1077
42 Ga0068857_101002556 3300005577 Bacteria 804
43 Ga0068856_100194610 3300005614 Bacteria 2041
44 Ga0068852_101139088 3300005616 Bacteria 801
45 Ga0068859_100406184 3300005617 Bacteria 1458
46 Ga0068859_101129201 3300005617 Bacteria 862
47 Ga0068864_100000263 3300005618 Bacteria 47003
48 Ga0068864_100419719 3300005618 Bacteria 1275
49 Ga0068851_10621967 3300005834 Bacteria 659
50 Ga0068863_100036803 3300005841 Bacteria 4661
51 Ga0068863_100200103 3300005841 Bacteria 1921
52 Ga0068863_101385406 3300005841 Bacteria 711
53 Ga0068858_100091786 3300005842 Bacteria 2826
54 Ga0068860_100001684 3300005843 Bacteria 23610
55 Ga0068860_100406402 3300005843 Bacteria 1348
56 Ga0068862_100031082 3300005844 Bacteria 4504
57 Ga0068862_100038406 3300005844 Bacteria 4060
58 Ga0081455_10071811 3300005937 Bacteria 2868
59 Ga0081538_10199388 3300005981 Bacteria 825
60 Ga0081540_1006324 3300005983 Bacteria 8652
61 Ga0070717_10053359 3300006028 Bacteria 3332
62 Ga0070717_10520824 3300006028 Bacteria 1076
63 Ga0075364_10155236 3300006051 Bacteria 1544
64 Ga0070716_100133122 3300006173 Bacteria 1575
65 Ga0070716_100440956 3300006173 Bacteria 947
66 Ga0070716_101678130 3300006173 Bacteria 524
67 Ga0070712_101021421 3300006175 Bacteria 716
68 Ga0075362_10259021 3300006177 Bacteria 857
69 Ga0075369_10223816 3300006186 Bacteria 871
70 Ga0075428_102747409 3300006844 Unclassified 501
71 Ga0075434_100833692 3300006871 Bacteria 938
72 Ga0075436_100228491 3300006914 Bacteria 1321
73 Ga0097620_100406189 3300006931 Bacteria 1458
74 Ga0097620_101129196 3300006931 Bacteria 862
75 Ga0075435_100065482 3300007076 Bacteria 2954
76 Ga0111539_10460054 3300009094 Bacteria 1482
77 Ga0105245_10731578 3300009098 Bacteria 1024
78 Ga0105245_12751507 3300009098 Bacteria 545
79 Ga0105247_10131614 3300009101 Bacteria 1631
80 Ga0105248_13047485 3300009177 Bacteria 533
81 Ga0105249_10478945 3300009553 Bacteria 1287
82 Ga0105249_11168345 3300009553 Bacteria 840
83 Ga0105249_11645009 3300009553 Bacteria 715
84 Ga0099796_10055928 3300010159 Bacteria 1383
85 Ga0105239_11324313 3300010375 Bacteria 831
86 Ga0157370_11448615 3300013104 Bacteria 618
87 Ga0157369_11241166 3300013105 Bacteria 760
88 Ga0157369_12448785 3300013105 Bacteria 529
89 Ga0163162_10962972 3300013306 Bacteria 964
90 Ga0157372_12426953 3300013307 Bacteria 602
91 Ga0163163_10074299 3300014325 Bacteria 3391
92 Ga0163163_11830703 3300014325 Bacteria 667
93 Ga0157380_10416789 3300014326 Bacteria 1279
94 Ga0157380_11414454 3300014326 Bacteria 746
95 Ga0182008_10674639 3300014497 Bacteria 588
96 Ga0182008_10801793 3300014497 Bacteria 547
97 Ga0157376_10896364 3300014969 Bacteria 905
98 Ga0157376_12452376 3300014969 Bacteria 561
99 Ga0206351_10920011 3300020077 Bacteria 517
100 Ga0213873_10005677 3300021358 Bacteria 2408
101 Ga0213872_10018614 3300021361 Bacteria 3201
102 Ga0213872_10065019 3300021361 Bacteria 1647
103 Ga0213872_10188126 3300021361 Bacteria 889
104 Ga0213876_10183275 3300021384 Bacteria 1113
105 Ga0209130_1000706 3300025284 Bacteria 29893
106 Ga0209025_1000750 3300025294 Bacteria 54523
107 Ga0209758_1009034 3300025297 Bacteria 6297
108 Ga0207426_1000336 3300025302 Bacteria 88370
109 Ga0207692_10848504 3300025898 Bacteria 599
110 Ga0207699_11468660 3300025906 Bacteria 504
111 Ga0207684_10019216 3300025910 Bacteria 5845
112 Ga0207693_10113345 3300025915 Bacteria 2127
113 Ga0207693_10124956 3300025915 Bacteria 2021
114 Ga0207663_10050583 3300025916 Bacteria 2583
115 Ga0207646_10071444 3300025922 Bacteria 3100
116 Ga0207700_10500477 3300025928 Bacteria 1075
117 Ga0207664_10217971 3300025929 Bacteria 1654
118 Ga0207664_10269792 3300025929 Bacteria 1490
119 Ga0207664_10324705 3300025929 Bacteria 1358
120 Ga0207644_10632681 3300025931 Bacteria 890
121 Ga0207665_10007579 3300025939 Bacteria 7172
122 Ga0207665_10129885 3300025939 Bacteria 1787
123 Ga0207668_11155388 3300025972 Bacteria 695
124 Ga0207677_12260120 3300026023 Bacteria 506
125 Ga0207639_10604222 3300026041 Bacteria 1012
126 Ga0207702_10196753 3300026078 Bacteria 1866
127 Ga0207641_11484933 3300026088 Bacteria 679
128 Ga0207674_10570739 3300026116 Bacteria 1093
129 Ga0207698_11599176 3300026142 Bacteria 667
130 Ga0209179_1001257 3300027512 Bacteria 3037
131 Ga0265769_108088 3300030888 Bacteria 687
132 Ga0316576_10238957 3300031727 Bacteria 1365
133 Ga0316578_10009841 3300031728 Bacteria 4935
134 Ga0307405_11495788 3300031731 Unclassified 593
135 Ga0316577_10141621 3300031733 Bacteria 1355
136 Ga0307406_11351701 3300031901 Bacteria 623
137 Ga0307412_10576484 3300031911 Unclassified 949
138 Ga0316593_10000032 3300032168 Bacteria 14610
139 Ga0316596_1054892 3300033541 Bacteria 1057
140 Ga0316596_1120920 3300033541 Bacteria 713
141 Ga0373929_0106034 3300035085 Bacteria 714
142 Ga0373932_0019729 3300035112 Bacteria 1760
143 Ga0373941_0175316 3300035115 Bacteria 801
144 Ga0373945_0242983 3300035116 Bacteria 758
145 Ga0373954_0585144 3300035118 Bacteria 553
146 Ga0373956_0027855 3300035119 Bacteria 2456
147 Ga0373957_0258871 3300035120 Bacteria 733
148 Ga0373960_0048102 3300035121 Bacteria 1257
149 Ga0373943_0582455 3300035170 Bacteria 658
150 Ga0373955_0104944 3300035172 Bacteria 1627
151 Ga0316574_0161677 3300035398 Bacteria 1442
152 Ga0316574_0546947 3300035398 Bacteria 719
153 Ga0316574_0792545 3300035398 Bacteria 577
154 Ga0373931_0020821 3300035691 Bacteria 3284
155 Ga0373927_1059713 3300035695 Bacteria 535
156 Ga0373933_0484192 3300035724 Bacteria 810
157 Ga0373937_0158163 3300036401 Bacteria 2124
158 Ga0316582_0034174 3300036647 Bacteria 3129
159 Ga0316582_0281247 3300036647 Bacteria 1142
160 Ga0316584_0013113 3300036712 Bacteria 5859
161 Ga0395905_0672089 3300037471 Bacteria 938
162 Ga0400490_39901 3300038726 Bacteria 15663
163 Ga0400491_08805 3300038727 Bacteria 1576
164 Ga0400488_49024 3300038741 Bacteria 3498
165 Ga0400487_29008 3300039110 Bacteria 14273
166 Ga0436365_0441459 3300039437 Bacteria 7457
167 Ga0436360_0353163 3300039438 Bacteria 689
168 Ga0436360_0361359 3300039438 Bacteria 1700
169 Ga0436360_0458798 3300039438 Bacteria 919
170 Ga0436360_1303757 3300039438 Bacteria 3138
171 Ga0436361_0030247 3300039447 Bacteria 1658
172 Ga0436361_0431627 3300039447 Bacteria 2515
173 Ga0436361_1179814 3300039447 Bacteria 3236
174 Ga0436363_0030844 3300039450 Bacteria 1148
175 Ga0436362_0316600 3300039453 Bacteria 4165
176 Ga0436362_0462667 3300039453 Bacteria 1670
177 Ga0439447_018070 3300041407 Bacteria 1909
178 Ga0439466_0242808 3300041411 Bacteria 546
179 Ga0439465_0025742 3300041413 Bacteria 1858
180 Ga0439458_0022320 3300042157 Bacteria 1470
181 Ga0450909_039289 3300042185 Bacteria 727
182 Ga0439434_0087816 3300042435 Bacteria 992
183 Ga0439444_0073030 3300042437 Bacteria 738
184 Ga0466963_0386967 3300044694 Bacteria 986
185 Ga0466964_0841632 3300044706 Bacteria 521
186 Ga0466957_0407091 3300044842 Bacteria 931
187 Ga0466957_0918809 3300044842 Bacteria 626
188 Ga0466960_0980941 3300044901 Bacteria 518
189 Ga0466958_0176744 3300045836 Bacteria 1354
190 Ga0466967_0851845 3300045976 Bacteria 906
191 Ga0495629_0432484 3300046459 Bacteria 892
192 Ga0495651_0410063 3300046462 Bacteria 883
193 Ga0495664_0712064 3300046477 Bacteria 593
194 Ga0495594_0095334 3300046499 Bacteria 1671
195 Ga0495594_0164738 3300046499 Bacteria 1261
196 Ga0495583_0423502 3300046506 Bacteria 522
197 Ga0495608_0580789 3300046511 Bacteria 674
198 Ga0495610_0026115 3300046512 Bacteria 3122
199 Ga0495628_0222648 3300046516 Bacteria 1417
200 Ga0495652_1069876 3300046529 Bacteria 525
201 Ga0495586_0133613 3300046535 Bacteria 1390
202 Ga0495667_0106171 3300046559 Bacteria 1815
203 Ga0495668_0735007 3300046616 Bacteria 546
204 Ga0495634_0193577 3300046642 Bacteria 1267
205 Ga0495635_0018858 3300046663 Bacteria 4814
206 Ga0495649_0338877 3300046694 Bacteria 761
207 Ga0495600_0145489 3300046809 Bacteria 1536
208 Ga0495680_0067338 3300047322 Bacteria 2738
209 Ga0495673_0196452 3300047469 Bacteria 757
210 Ga0495684_0847892 3300047471 Bacteria 593
211 Ga0496104_0147796 3300048907 Bacteria 2257
212 Ga0496109_1091818 3300048912 Bacteria 735
213 Ga0496110_0326196 3300048913 Bacteria 1398
214 Ga0496112_0040118 3300048915 Bacteria 4577
215 Ga0496112_0196206 3300048915 Bacteria 1979
216 Ga0496113_0221932 3300048916 Bacteria 1506
217 Ga0496119_0365215 3300048922 Bacteria 696
218 Ga0496123_0330982 3300048926 Bacteria 715
219 Ga0501317_002279 3300049533 Bacteria 1793
220 Ga0501325_040950 3300049541 Bacteria 564
221 Ga0501032_0186675 3300049569 Bacteria 1356
222 Ga0501033_0337674 3300049570 Bacteria 1057
223 Ga0501034_0307949 3300049571 Bacteria 1519
224 Ga0501036_1443203 3300049572 Bacteria 557
225 Ga0501037_0133346 3300049573 Bacteria 1780
226 Ga0501037_0574196 3300049573 Bacteria 759
227 Ga0501038_0241573 3300049574 Bacteria 1434
228 Ga0501038_0874658 3300049574 Bacteria 664
229 Ga0501039_0195812 3300049575 Bacteria 1589
230 Ga0501039_0813102 3300049575 Bacteria 729
231 Ga0501039_1337815 3300049575 Bacteria 552
232 Ga0501040_0080605 3300049576 Bacteria 2255
233 Ga0501041_0615809 3300049577 Bacteria 693
234 Ga0501042_0168103 3300049578 Bacteria 1582
235 Ga0501043_0653620 3300049579 Bacteria 772
236 Ga0501043_0667602 3300049579 Bacteria 762
237 Ga0501043_1117080 3300049579 Bacteria 556
238 Ga0501043_1182134 3300049579 Bacteria 538
239 Ga0501047_0002319 3300049581 Bacteria 18206
240 Ga0501047_1139632 3300049581 Bacteria 593
241 Ga0501048_0208760 3300049582 Bacteria 1385
242 Ga0501048_0274210 3300049582 Bacteria 1199
243 Ga0501068_0790627 3300049584 Bacteria 622
244 Ga0501070_0393203 3300049586 Bacteria 1122
245 Ga0501071_0090066 3300049587 Bacteria 2252
246 Ga0501072_0437979 3300049588 Bacteria 1035
247 Ga0501072_1129391 3300049588 Bacteria 609
248 Ga0501073_0649819 3300049589 Bacteria 728
249 Ga0501074_0350131 3300049590 Bacteria 1048
250 Ga0501074_1048323 3300049590 Bacteria 573
251 Ga0501075_0269444 3300049591 Bacteria 1298
252 Ga0501075_0341685 3300049591 Bacteria 1141
253 Ga0501076_0828499 3300049592 Bacteria 763
254 Ga0501077_0893308 3300049593 Bacteria 571
255 Ga0501079_0845969 3300049741 Bacteria 720
256 Ga0501080_0889263 3300049742 Bacteria 777
257 Ga0501080_1389941 3300049742 Bacteria 599
258 Ga0501081_0192349 3300049743 Bacteria 1478
259 Ga0501081_0365335 3300049743 Bacteria 1065
260 Ga0501081_0470034 3300049743 Bacteria 935
261 Ga0501083_0528052 3300049744 Bacteria 768
262 Ga0501035_0163352 3300049822 Bacteria 1927
263 Ga0501035_0473640 3300049822 Bacteria 1034
264 Ga0501044_0854523 3300049823 Bacteria 787
265 Ga0501044_1045559 3300049823 Bacteria 687
266 Ga0501045_0722685 3300049824 Bacteria 734
267 nmdc:mga03683_330400_c1 3300050489 Bacteria 719
268 nmdc:mga03n38_913118_c1 3300050490 Bacteria 516
269 nmdc:mga00v17_662547_c1 3300050491 Bacteria 671
270 nmdc:mga0k408_111990_c1 3300050493 Bacteria 1613
271 nmdc:mga0n895_324758_c1 3300050512 Bacteria 1559
272 nmdc:mga0n895_415235_c1 3300050512 Bacteria 1360
273 nmdc:mga0rr50_88314_c1 3300050513 Bacteria 2408
274 nmdc:mga08x19_408733_c1 3300050514 Bacteria 953
275 Ga0495601_0018046 3300053077 Bacteria 4290
276 Ga0495612_0317042 3300053078 Bacteria 701
277 Ga0495595_0113889 3300053084 Bacteria 1313
278 Ga0495619_0004308 3300053085 Bacteria 9078
279 Ga0500643_001398 3300053087 Bacteria 13944
280 Ga0500568_0047087 3300053139 Bacteria 1709
281 Ga0587084_085271 3300059477 Bacteria 618
282 Ga0587084_124041 3300059477 Bacteria 546
283 Ga0587077_057363 3300059493 Bacteria 833
284 Ga0587080_104205 3300059503 Bacteria 611
285 Ga0587085_107167 3300059506 Bacteria 598
286 Ga0587086_048237 3300059507 Bacteria 679
287 Ga0587090_000239 3300059510 Bacteria 4051
288 Ga0587098_009070 3300059604 Bacteria 1072
289 Ga0587101_000303 3300059623 Bacteria 3204
290 Ga0587062_111297 3300059639 Bacteria 544
291 Ga0587068_001246 3300059641 Bacteria 2782
292 Ga0587072_161028 3300059643 Bacteria 548
293 Ga0587076_016276 3300059645 Bacteria 1171
294 Ga0587078_000387 3300059646 Bacteria 3211
295 Ga0587071_084340 3300060344 Bacteria 712
296 Ga0587071_194805 3300060344 Bacteria 527
297 Ga0587111_0000079 3300060346 Bacteria 5946
298 Ga0501082_1013276 3300060353 Bacteria 726

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10747938 Ga0070676_107479381 62
2 3300005330 Ga0070690_101747335 Ga0070690_1017473352 62
3 3300005335 Ga0070666_10414492 Ga0070666_104144923 62
4 3300005338 Ga0068868_100564894 Ga0068868_1005648942 62
5 3300005347 Ga0070668_100018845 Ga0070668_1000188459 62
6 3300005353 Ga0070669_100836773 Ga0070669_1008367732 62
7 3300005353 Ga0070669_101226162 Ga0070669_1012261622 62
8 3300005354 Ga0070675_100610656 Ga0070675_1006106562 62
9 3300005356 Ga0070674_100990442 Ga0070674_1009904423 62
10 3300005367 Ga0070667_100026034 Ga0070667_1000260341 62
11 3300005367 Ga0070667_100513791 Ga0070667_1005137913 62
12 3300005455 Ga0070663_100704860 Ga0070663_1007048603 62
13 3300005459 Ga0068867_100287201 Ga0068867_1002872013 62
14 3300005548 Ga0070665_100029959 Ga0070665_10002995912 62
15 3300005548 Ga0070665_100598287 Ga0070665_1005982873 62
16 3300005577 Ga0068857_101002556 Ga0068857_1010025563 62
17 3300005617 Ga0068859_100406184 Ga0068859_1004061843 62
18 3300005617 Ga0068859_101129201 Ga0068859_1011292012 62
19 3300005618 Ga0068864_100000263 Ga0068864_10000026358 62
20 3300005618 Ga0068864_100419719 Ga0068864_1004197193 62
21 3300005841 Ga0068863_100036803 Ga0068863_10003680312 62
22 3300005841 Ga0068863_100200103 Ga0068863_1002001033 62
23 3300005842 Ga0068858_100091786 Ga0068858_1000917866 62
24 3300005843 Ga0068860_100001684 Ga0068860_1000016848 62
25 3300005843 Ga0068860_100406402 Ga0068860_1004064022 62
26 3300005844 Ga0068862_100031082 Ga0068862_1000310828 62
27 3300005844 Ga0068862_100038406 Ga0068862_1000384068 62
28 3300006931 Ga0097620_100406189 Ga0097620_1004061893 62
29 3300006931 Ga0097620_101129196 Ga0097620_1011291963 62
30 3300009094 Ga0111539_10460054 Ga0111539_104600542 62
31 3300009098 Ga0105245_12751507 Ga0105245_127515072 62
32 3300009101 Ga0105247_10131614 Ga0105247_101316145 62
33 3300009177 Ga0105248_13047485 Ga0105248_130474852 62
34 3300009553 Ga0105249_10478945 Ga0105249_104789453 62
35 3300009553 Ga0105249_11168345 Ga0105249_111683453 62
36 3300009553 Ga0105249_11645009 Ga0105249_116450091 62
37 3300013105 Ga0157369_11241166 Ga0157369_112411662 62
38 3300013306 Ga0163162_10962972 Ga0163162_109629723 62
39 3300013307 Ga0157372_12426953 Ga0157372_124269532 62
40 3300014325 Ga0163163_10074299 Ga0163163_100742993 62
41 3300014326 Ga0157380_10416789 Ga0157380_104167892 62
42 3300014326 Ga0157380_11414454 Ga0157380_114144543 62
43 3300014497 Ga0182008_10801793 Ga0182008_108017932 62
44 3300014969 Ga0157376_10896364 Ga0157376_108963643 62
45 3300020077 Ga0206351_10920011 Ga0206351_109200111 63
46 3300021361 Ga0213872_10065019 Ga0213872_100650192 63
47 3300031731 Ga0307405_11495788 Ga0307405_114957881 63
48 3300031911 Ga0307412_10576484 Ga0307412_105764842 63
49 3300032168 Ga0316593_10000032 Ga0316593_100000329 63
50 3300033541 Ga0316596_1054892 Ga0316596_10548922 63
51 3300033541 Ga0316596_1120920 Ga0316596_11209202 63
52 3300036647 Ga0316582_0034174 Ga0316582_0034174_1793_1990 63
53 3300037471 Ga0395905_0672089 Ga0395905_0672089_256_453 63
54 3300039438 Ga0436360_1303757 Ga0436360_1303757_2236_2433 63
55 3300039447 Ga0436361_0030247 Ga0436361_0030247_1245_1442 63
56 3300042437 Ga0439444_0073030 Ga0439444_0073030_41_238 63
57 3300044706 Ga0466964_0841632 Ga0466964_0841632_190_387 63
58 3300049570 Ga0501033_0337674 Ga0501033_0337674_541_738 63
59 3300049573 Ga0501037_0133346 Ga0501037_0133346_644_841 63
60 3300049573 Ga0501037_0574196 Ga0501037_0574196_418_615 63
61 3300049575 Ga0501039_0195812 Ga0501039_0195812_421_618 63
62 3300049575 Ga0501039_0813102 Ga0501039_0813102_480_677 63
63 3300049576 Ga0501040_0080605 Ga0501040_0080605_577_774 63
64 3300049577 Ga0501041_0615809 Ga0501041_0615809_351_548 63
65 3300049578 Ga0501042_0168103 Ga0501042_0168103_90_287 63
66 3300049579 Ga0501043_0667602 Ga0501043_0667602_442_639 63
67 3300049579 Ga0501043_1182134 Ga0501043_1182134_77_274 63
68 3300049582 Ga0501048_0274210 Ga0501048_0274210_406_603 63
69 3300049587 Ga0501071_0090066 Ga0501071_0090066_81_278 63
70 3300049588 Ga0501072_0437979 Ga0501072_0437979_11_208 63
71 3300049588 Ga0501072_1129391 Ga0501072_1129391_263_460 63
72 3300049590 Ga0501074_0350131 Ga0501074_0350131_475_672 63
73 3300049590 Ga0501074_1048323 Ga0501074_1048323_249_446 63
74 3300049591 Ga0501075_0269444 Ga0501075_0269444_1047_1244 63
75 3300049591 Ga0501075_0341685 Ga0501075_0341685_745_942 63
76 3300049592 Ga0501076_0828499 Ga0501076_0828499_335_532 63
77 3300049593 Ga0501077_0893308 Ga0501077_0893308_301_498 63
78 3300049741 Ga0501079_0845969 Ga0501079_0845969_289_486 63
79 3300049742 Ga0501080_0889263 Ga0501080_0889263_157_354 63
80 3300049743 Ga0501081_0192349 Ga0501081_0192349_1173_1370 63
81 3300049743 Ga0501081_0365335 Ga0501081_0365335_724_921 63
82 3300049743 Ga0501081_0470034 Ga0501081_0470034_242_439 63
83 3300049744 Ga0501083_0528052 Ga0501083_0528052_204_401 63
84 3300049822 Ga0501035_0163352 Ga0501035_0163352_107_304 63
85 3300049822 Ga0501035_0473640 Ga0501035_0473640_431_628 63
86 3300049824 Ga0501045_0722685 Ga0501045_0722685_140_337 63
87 3300050512 nmdc:mga0n895_415235_c1 nmdc:mga0n895_415235_c1_751_948 63
88 3300053087 Ga0500643_001398 Ga0500643_001398_2334_2531 63
89 3300060353 Ga0501082_1013276 Ga0501082_1013276_465_662 63
90 iso_pu_bacteria 8054563764 8054566748 63
91 3300005434 Ga0070709_10840726 Ga0070709_108407263 64
92 3300005435 Ga0070714_101009384 Ga0070714_1010093842 64
93 3300005436 Ga0070713_101238061 Ga0070713_1012380611 64
94 3300006051 Ga0075364_10155236 Ga0075364_101552362 64
95 3300006173 Ga0070716_100440956 Ga0070716_1004409563 64
96 3300006173 Ga0070716_101678130 Ga0070716_1016781301 64
97 3300006175 Ga0070712_101021421 Ga0070712_1010214212 64
98 3300025929 Ga0207664_10217971 Ga0207664_102179715 64
99 3300025939 Ga0207665_10129885 Ga0207665_101298852 64
100 3300035398 Ga0316574_0161677 Ga0316574_0161677_806_1006 64
101 3300035695 Ga0373927_1059713 Ga0373927_1059713_81_281 64
102 3300038726 Ga0400490_39901 Ga0400490_39901_4702_4902 64
103 3300038727 Ga0400491_08805 Ga0400491_08805_1230_1430 64
104 3300038741 Ga0400488_49024 Ga0400488_49024_2954_3154 64
105 3300039110 Ga0400487_29008 Ga0400487_29008_4641_4841 64
106 3300046616 Ga0495668_0735007 Ga0495668_0735007_218_418 64
107 3300049569 Ga0501032_0186675 Ga0501032_0186675_47_247 64
108 3300049571 Ga0501034_0307949 Ga0501034_0307949_329_529 64
109 3300049572 Ga0501036_1443203 Ga0501036_1443203_13_213 64
110 3300049574 Ga0501038_0241573 Ga0501038_0241573_1171_1371 64
111 3300049575 Ga0501039_1337815 Ga0501039_1337815_188_388 64
112 3300049579 Ga0501043_0653620 Ga0501043_0653620_370_570 64
113 3300049581 Ga0501047_0002319 Ga0501047_0002319_12619_12819 64
114 3300049582 Ga0501048_0208760 Ga0501048_0208760_1139_1339 64
115 3300049589 Ga0501073_0649819 Ga0501073_0649819_518_718 64
116 3300049823 Ga0501044_0854523 Ga0501044_0854523_441_641 64
117 3300050491 nmdc:mga00v17_662547_c1 nmdc:mga00v17_662547_c1_363_563 64
118 3300014325 Ga0163163_11830703 Ga0163163_118307032 65
119 3300031727 Ga0316576_10238957 Ga0316576_102389573 65
120 3300031728 Ga0316578_10009841 Ga0316578_100098419 65
121 3300031733 Ga0316577_10141621 Ga0316577_101416212 65
122 3300035398 Ga0316574_0546947 Ga0316574_0546947_252_455 65
123 3300035398 Ga0316574_0792545 Ga0316574_0792545_44_247 65
124 3300036647 Ga0316582_0281247 Ga0316582_0281247_764_967 65
125 3300036712 Ga0316584_0013113 Ga0316584_0013113_3996_4199 65
126 3300003187 JGI25151J46595_10000624 JGI25151J46595_1000062434 66
127 3300003354 JGI25160J50197_1036456 JGI25160J50197_10364564 66
128 3300003579 Ga0007429J51699_1067287 Ga0007429J51699_10672871 66
129 3300003659 JGI25404J52841_10139395 JGI25404J52841_101393952 66
130 3300005455 Ga0070663_101772085 Ga0070663_1017720852 66
131 3300005539 Ga0068853_100709018 Ga0068853_1007090182 66
132 3300005577 Ga0068857_100560610 Ga0068857_1005606102 66
133 3300005834 Ga0068851_10621967 Ga0068851_106219672 66
134 3300005937 Ga0081455_10071811 Ga0081455_100718117 66
135 3300005981 Ga0081538_10199388 Ga0081538_101993882 66
136 3300005983 Ga0081540_1006324 Ga0081540_100632415 66
137 3300006177 Ga0075362_10259021 Ga0075362_102590213 66
138 3300006186 Ga0075369_10223816 Ga0075369_102238163 66
139 3300006844 Ga0075428_102747409 Ga0075428_1027474091 66
140 3300010375 Ga0105239_11324313 Ga0105239_113243132 66
141 3300021361 Ga0213872_10018614 Ga0213872_100186147 66
142 3300021361 Ga0213872_10188126 Ga0213872_101881262 66
143 3300025284 Ga0209130_1000706 Ga0209130_100070633 66
144 3300025294 Ga0209025_1000750 Ga0209025_100075011 66
145 3300025297 Ga0209758_1009034 Ga0209758_10090342 66
146 3300025302 Ga0207426_1000336 Ga0207426_100033687 66
147 3300025972 Ga0207668_11155388 Ga0207668_111553883 66
148 3300026023 Ga0207677_12260120 Ga0207677_122601202 66
149 3300026041 Ga0207639_10604222 Ga0207639_106042223 66
150 3300026116 Ga0207674_10570739 Ga0207674_105707392 66
151 3300030888 Ga0265769_108088 Ga0265769_1080882 66
152 3300035116 Ga0373945_0242983 Ga0373945_0242983_207_416 66
153 3300035118 Ga0373954_0585144 Ga0373954_0585144_171_380 66
154 3300035119 Ga0373956_0027855 Ga0373956_0027855_2157_2366 66
155 3300035120 Ga0373957_0258871 Ga0373957_0258871_387_596 66
156 3300035170 Ga0373943_0582455 Ga0373943_0582455_383_592 66
157 3300035172 Ga0373955_0104944 Ga0373955_0104944_1310_1519 66
158 3300035724 Ga0373933_0484192 Ga0373933_0484192_80_289 66
159 3300036401 Ga0373937_0158163 Ga0373937_0158163_1210_1419 66
160 3300039437 Ga0436365_0441459 Ga0436365_0441459_3046_3264 66
161 3300039438 Ga0436360_0353163 Ga0436360_0353163_392_598 66
162 3300039438 Ga0436360_0361359 Ga0436360_0361359_974_1183 66
163 3300039438 Ga0436360_0458798 Ga0436360_0458798_131_346 66
164 3300039447 Ga0436361_0431627 Ga0436361_0431627_1509_1715 66
165 3300039447 Ga0436361_1179814 Ga0436361_1179814_1079_1285 66
166 3300039450 Ga0436363_0030844 Ga0436363_0030844_105_323 66
167 3300039453 Ga0436362_0316600 Ga0436362_0316600_635_853 66
168 3300039453 Ga0436362_0462667 Ga0436362_0462667_162_371 66
169 3300041407 Ga0439447_018070 Ga0439447_018070_663_869 66
170 3300041411 Ga0439466_0242808 Ga0439466_0242808_20_226 66
171 3300041413 Ga0439465_0025742 Ga0439465_0025742_1334_1540 66
172 3300042157 Ga0439458_0022320 Ga0439458_0022320_116_322 66
173 3300042185 Ga0450909_039289 Ga0450909_039289_104_310 66
174 3300042435 Ga0439434_0087816 Ga0439434_0087816_570_776 66
175 3300044842 Ga0466957_0407091 Ga0466957_0407091_262_468 66
176 3300044842 Ga0466957_0918809 Ga0466957_0918809_67_276 66
177 3300044901 Ga0466960_0980941 Ga0466960_0980941_283_489 66
178 3300046459 Ga0495629_0432484 Ga0495629_0432484_656_865 66
179 3300046462 Ga0495651_0410063 Ga0495651_0410063_208_417 66
180 3300046477 Ga0495664_0712064 Ga0495664_0712064_115_324 66
181 3300046499 Ga0495594_0095334 Ga0495594_0095334_164_373 66
182 3300046499 Ga0495594_0164738 Ga0495594_0164738_937_1146 66
183 3300046506 Ga0495583_0423502 Ga0495583_0423502_114_320 66
184 3300046511 Ga0495608_0580789 Ga0495608_0580789_208_417 66
185 3300046512 Ga0495610_0026115 Ga0495610_0026115_118_324 66
186 3300046516 Ga0495628_0222648 Ga0495628_0222648_54_263 66
187 3300046529 Ga0495652_1069876 Ga0495652_1069876_289_498 66
188 3300046535 Ga0495586_0133613 Ga0495586_0133613_670_879 66
189 3300046559 Ga0495667_0106171 Ga0495667_0106171_1167_1376 66
190 3300046642 Ga0495634_0193577 Ga0495634_0193577_407_616 66
191 3300046663 Ga0495635_0018858 Ga0495635_0018858_3372_3581 66
192 3300046694 Ga0495649_0338877 Ga0495649_0338877_236_442 66
193 3300046809 Ga0495600_0145489 Ga0495600_0145489_1202_1411 66
194 3300047322 Ga0495680_0067338 Ga0495680_0067338_2447_2656 66
195 3300047469 Ga0495673_0196452 Ga0495673_0196452_517_723 66
196 3300047471 Ga0495684_0847892 Ga0495684_0847892_271_480 66
197 3300048922 Ga0496119_0365215 Ga0496119_0365215_428_634 66
198 3300048926 Ga0496123_0330982 Ga0496123_0330982_229_435 66
199 3300049541 Ga0501325_040950 Ga0501325_040950_149_355 66
200 3300049574 Ga0501038_0874658 Ga0501038_0874658_330_536 66
201 3300049579 Ga0501043_1117080 Ga0501043_1117080_127_333 66
202 3300049581 Ga0501047_1139632 Ga0501047_1139632_264_476 66
203 3300049584 Ga0501068_0790627 Ga0501068_0790627_39_245 66
204 3300049586 Ga0501070_0393203 Ga0501070_0393203_378_590 66
205 3300049742 Ga0501080_1389941 Ga0501080_1389941_159_371 66
206 3300049823 Ga0501044_1045559 Ga0501044_1045559_91_297 66
207 3300050489 nmdc:mga03683_330400_c1 nmdc:mga03683_330400_c1_184_408 66
208 3300050490 nmdc:mga03n38_913118_c1 nmdc:mga03n38_913118_c1_266_472 66
209 3300050493 nmdc:mga0k408_111990_c1 nmdc:mga0k408_111990_c1_1333_1539 66
210 3300053077 Ga0495601_0018046 Ga0495601_0018046_1925_2134 66
211 3300053078 Ga0495612_0317042 Ga0495612_0317042_283_489 66
212 3300053084 Ga0495595_0113889 Ga0495595_0113889_970_1179 66
213 3300053085 Ga0495619_0004308 Ga0495619_0004308_4429_4638 66
214 3300053139 Ga0500568_0047087 Ga0500568_0047087_1258_1464 66
215 3300059477 Ga0587084_085271 Ga0587084_085271_115_321 66
216 3300059493 Ga0587077_057363 Ga0587077_057363_318_524 66
217 3300059503 Ga0587080_104205 Ga0587080_104205_105_311 66
218 3300059507 Ga0587086_048237 Ga0587086_048237_164_370 66
219 3300059510 Ga0587090_000239 Ga0587090_000239_1555_1761 66
220 3300059604 Ga0587098_009070 Ga0587098_009070_228_434 66
221 3300059623 Ga0587101_000303 Ga0587101_000303_2338_2544 66
222 3300059639 Ga0587062_111297 Ga0587062_111297_117_323 66
223 3300059641 Ga0587068_001246 Ga0587068_001246_2288_2494 66
224 3300059643 Ga0587072_161028 Ga0587072_161028_131_337 66
225 3300059645 Ga0587076_016276 Ga0587076_016276_310_516 66
226 3300059646 Ga0587078_000387 Ga0587078_000387_662_868 66
227 3300060344 Ga0587071_084340 Ga0587071_084340_294_500 66
228 3300060346 Ga0587111_0000079 Ga0587111_0000079_2301_2507 66
229 2010549000 RicEn_FSXC10445_g1 RicEn_235870 67
230 3300005356 Ga0070674_100917230 Ga0070674_1009172302 67
231 3300005434 Ga0070709_10266128 Ga0070709_102661283 67
232 3300005435 Ga0070714_100352877 Ga0070714_1003528773 67
233 3300005435 Ga0070714_100860466 Ga0070714_1008604661 67
234 3300005436 Ga0070713_100315402 Ga0070713_1003154022 67
235 3300005436 Ga0070713_100760308 Ga0070713_1007603081 67
236 3300005436 Ga0070713_100766838 Ga0070713_1007668383 67
237 3300005437 Ga0070710_10096459 Ga0070710_100964593 67
238 3300005439 Ga0070711_100496450 Ga0070711_1004964502 67
239 3300005467 Ga0070706_100061175 Ga0070706_1000611754 67
240 3300005468 Ga0070707_100033707 Ga0070707_1000337072 67
241 3300005471 Ga0070698_100065506 Ga0070698_1000655067 67
242 3300005518 Ga0070699_100036064 Ga0070699_10003606410 67
243 3300005536 Ga0070697_100595433 Ga0070697_1005954333 67
244 3300005564 Ga0070664_100490429 Ga0070664_1004904292 67
245 3300005614 Ga0068856_100194610 Ga0068856_1001946102 67
246 3300005616 Ga0068852_101139088 Ga0068852_1011390882 67
247 3300005841 Ga0068863_101385406 Ga0068863_1013854062 67
248 3300006028 Ga0070717_10053359 Ga0070717_100533593 67
249 3300006028 Ga0070717_10520824 Ga0070717_105208242 67
250 3300006173 Ga0070716_100133122 Ga0070716_1001331223 67
251 3300006871 Ga0075434_100833692 Ga0075434_1008336922 67
252 3300006914 Ga0075436_100228491 Ga0075436_1002284913 67
253 3300007076 Ga0075435_100065482 Ga0075435_1000654823 67
254 3300009098 Ga0105245_10731578 Ga0105245_107315782 67
255 3300010159 Ga0099796_10055928 Ga0099796_100559284 67
256 3300013104 Ga0157370_11448615 Ga0157370_114486152 67
257 3300013105 Ga0157369_12448785 Ga0157369_124487852 67
258 3300014497 Ga0182008_10674639 Ga0182008_106746392 67
259 3300014969 Ga0157376_12452376 Ga0157376_124523762 67
260 3300021358 Ga0213873_10005677 Ga0213873_100056775 67
261 3300021384 Ga0213876_10183275 Ga0213876_101832752 67
262 3300025898 Ga0207692_10848504 Ga0207692_108485042 67
263 3300025906 Ga0207699_11468660 Ga0207699_114686601 67
264 3300025910 Ga0207684_10019216 Ga0207684_100192169 67
265 3300025915 Ga0207693_10113345 Ga0207693_101133455 67
266 3300025915 Ga0207693_10124956 Ga0207693_101249561 67
267 3300025916 Ga0207663_10050583 Ga0207663_100505835 67
268 3300025922 Ga0207646_10071444 Ga0207646_100714445 67
269 3300025928 Ga0207700_10500477 Ga0207700_105004773 67
270 3300025929 Ga0207664_10269792 Ga0207664_102697923 67
271 3300025929 Ga0207664_10324705 Ga0207664_103247052 67
272 3300025931 Ga0207644_10632681 Ga0207644_106326812 67
273 3300025939 Ga0207665_10007579 Ga0207665_100075798 67
274 3300026078 Ga0207702_10196753 Ga0207702_101967535 67
275 3300026088 Ga0207641_11484933 Ga0207641_114849331 67
276 3300026142 Ga0207698_11599176 Ga0207698_115991762 67
277 3300027512 Ga0209179_1001257 Ga0209179_10012576 67
278 3300031901 Ga0307406_11351701 Ga0307406_113517012 67
279 3300035085 Ga0373929_0106034 Ga0373929_0106034_473_700 67
280 3300035112 Ga0373932_0019729 Ga0373932_0019729_293_520 67
281 3300035115 Ga0373941_0175316 Ga0373941_0175316_40_267 67
282 3300035121 Ga0373960_0048102 Ga0373960_0048102_858_1085 67
283 3300035691 Ga0373931_0020821 Ga0373931_0020821_232_459 67
284 3300044694 Ga0466963_0386967 Ga0466963_0386967_273_500 67
285 3300045836 Ga0466958_0176744 Ga0466958_0176744_1069_1296 67
286 3300045976 Ga0466967_0851845 Ga0466967_0851845_246_473 67
287 3300048907 Ga0496104_0147796 Ga0496104_0147796_1894_2121 67
288 3300048912 Ga0496109_1091818 Ga0496109_1091818_177_392 67
289 3300048913 Ga0496110_0326196 Ga0496110_0326196_797_1024 67
290 3300048915 Ga0496112_0040118 Ga0496112_0040118_3352_3579 67
291 3300048915 Ga0496112_0196206 Ga0496112_0196206_123_350 67
292 3300048916 Ga0496113_0221932 Ga0496113_0221932_1005_1232 67
293 3300049533 Ga0501317_002279 Ga0501317_002279_560_775 67
294 3300050512 nmdc:mga0n895_324758_c1 nmdc:mga0n895_324758_c1_931_1158 67
295 3300050513 nmdc:mga0rr50_88314_c1 nmdc:mga0rr50_88314_c1_609_836 67
296 3300050514 nmdc:mga08x19_408733_c1 nmdc:mga08x19_408733_c1_148_375 67
297 3300059477 Ga0587084_124041 Ga0587084_124041_215_442 67
298 3300059506 Ga0587085_107167 Ga0587085_107167_250_477 67
299 3300060344 Ga0587071_194805 Ga0587071_194805_79_306 67

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00831

Ribosomal_L29

Ribosomal L29 protein

7

63

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uvv-assembly1.cif.gz_X a. baumannii ribosome-streptothricin-f complex: 70s with p-site trna 0.9947 3 60
8a63-assembly1.cif.gz_2 cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9897 6 61
8a57-assembly1.cif.gz_2 cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. 0.9895 6 61
7uvx-assembly1.cif.gz_X a. baumannii 70s ribosome-streptothricin-f complex 0.9894 3 61
7uvw-assembly1.cif.gz_X a. baumannii ribosome: 70s with e-site trna 0.9887 3 61
ID Description Score Start End Superfamily
4wf9V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9828 11 67 1.10.287.310
4wceV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9673 3 67 1.10.287.310
3cclV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9594 3 62 1.10.287.310
1vq5V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9588 3 62 1.10.287.310
4hubV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9588 1 62 1.10.287.310
ID Description Score Start End GO Terms
AF-A0A1G2C723-F1-model_v4 Large ribosomal subunit protein uL29 0.9996 4 64 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7X5JCI4-F1-model_v4 Large ribosomal subunit protein uL29 0.9988 2 62 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1G2PMA6-F1-model_v4 Large ribosomal subunit protein uL29 0.9964 1 64 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7V2H9L5-F1-model_v4 Large ribosomal subunit protein uL29 0.9942 2 58 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2H0N3S9-F1-model_v4 Large ribosomal subunit protein uL29 0.9936 2 66 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
88.61 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map