F394696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 230 | 298 | 69 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100352877|Ga0070714_1003528773 |
| Length | 75 |
| Sequence | VKGTKPSDLRSRSEDELNEQIDTLGKEIFNLRFQRASGQLENTARVRQVRRDIARIKTILGERRRGQAAGAAGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 71 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 97 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 98 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 100 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 101 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 102 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 105 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 106 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 107 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 108 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 109 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 111 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 113 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 114 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 115 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 116 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 117 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 118 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 120 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 121 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 122 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 123 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 124 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 125 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 126 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 127 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 128 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 129 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 130 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 131 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 132 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 133 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 134 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 135 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 136 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 137 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 169 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 170 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 202 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 203 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 204 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 205 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 213 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 214 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.3 |
| Metatranscriptomes | 8.36 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.35 |
| Nodule | 0 |
| Rhizoplane | 2.01 |
| Rhizosphere | 89.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC10445_g1 | 2010549000 | Bacteria | 776 |
| 2 | JGI25151J46595_10000624 | 3300003187 | Bacteria | 30772 |
| 3 | JGI25160J50197_1036456 | 3300003354 | Bacteria | 1192 |
| 4 | Ga0007429J51699_1067287 | 3300003579 | Bacteria | 1140 |
| 5 | JGI25404J52841_10139395 | 3300003659 | Bacteria | 514 |
| 6 | Ga0070676_10747938 | 3300005328 | Bacteria | 717 |
| 7 | Ga0070690_101747335 | 3300005330 | Unclassified | 506 |
| 8 | Ga0070666_10414492 | 3300005335 | Bacteria | 969 |
| 9 | Ga0068868_100564894 | 3300005338 | Bacteria | 1004 |
| 10 | Ga0070668_100018845 | 3300005347 | Bacteria | 5184 |
| 11 | Ga0070669_100836773 | 3300005353 | Bacteria | 784 |
| 12 | Ga0070669_101226162 | 3300005353 | Bacteria | 648 |
| 13 | Ga0070675_100610656 | 3300005354 | Bacteria | 989 |
| 14 | Ga0070674_100917230 | 3300005356 | Bacteria | 764 |
| 15 | Ga0070674_100990442 | 3300005356 | Bacteria | 737 |
| 16 | Ga0070667_100026034 | 3300005367 | Bacteria | 4864 |
| 17 | Ga0070667_100513791 | 3300005367 | Bacteria | 1099 |
| 18 | Ga0070709_10266128 | 3300005434 | Bacteria | 1240 |
| 19 | Ga0070709_10840726 | 3300005434 | Bacteria | 723 |
| 20 | Ga0070714_100352877 | 3300005435 | Bacteria | 1382 |
| 21 | Ga0070714_100860466 | 3300005435 | Bacteria | 879 |
| 22 | Ga0070714_101009384 | 3300005435 | Bacteria | 810 |
| 23 | Ga0070713_100315402 | 3300005436 | Bacteria | 1443 |
| 24 | Ga0070713_100760308 | 3300005436 | Bacteria | 927 |
| 25 | Ga0070713_100766838 | 3300005436 | Bacteria | 923 |
| 26 | Ga0070713_101238061 | 3300005436 | Bacteria | 723 |
| 27 | Ga0070710_10096459 | 3300005437 | Bacteria | 1753 |
| 28 | Ga0070711_100496450 | 3300005439 | Bacteria | 1005 |
| 29 | Ga0070663_100704860 | 3300005455 | Bacteria | 858 |
| 30 | Ga0070663_101772085 | 3300005455 | Bacteria | 553 |
| 31 | Ga0068867_100287201 | 3300005459 | Bacteria | 1351 |
| 32 | Ga0070706_100061175 | 3300005467 | Bacteria | 3477 |
| 33 | Ga0070707_100033707 | 3300005468 | Bacteria | 4883 |
| 34 | Ga0070698_100065506 | 3300005471 | Bacteria | 3658 |
| 35 | Ga0070699_100036064 | 3300005518 | Bacteria | 4277 |
| 36 | Ga0070697_100595433 | 3300005536 | Bacteria | 971 |
| 37 | Ga0068853_100709018 | 3300005539 | Bacteria | 960 |
| 38 | Ga0070665_100029959 | 3300005548 | Bacteria | 5477 |
| 39 | Ga0070665_100598287 | 3300005548 | Bacteria | 1116 |
| 40 | Ga0070664_100490429 | 3300005564 | Bacteria | 1131 |
| 41 | Ga0068857_100560610 | 3300005577 | Bacteria | 1077 |
| 42 | Ga0068857_101002556 | 3300005577 | Bacteria | 804 |
| 43 | Ga0068856_100194610 | 3300005614 | Bacteria | 2041 |
| 44 | Ga0068852_101139088 | 3300005616 | Bacteria | 801 |
| 45 | Ga0068859_100406184 | 3300005617 | Bacteria | 1458 |
| 46 | Ga0068859_101129201 | 3300005617 | Bacteria | 862 |
| 47 | Ga0068864_100000263 | 3300005618 | Bacteria | 47003 |
| 48 | Ga0068864_100419719 | 3300005618 | Bacteria | 1275 |
| 49 | Ga0068851_10621967 | 3300005834 | Bacteria | 659 |
| 50 | Ga0068863_100036803 | 3300005841 | Bacteria | 4661 |
| 51 | Ga0068863_100200103 | 3300005841 | Bacteria | 1921 |
| 52 | Ga0068863_101385406 | 3300005841 | Bacteria | 711 |
| 53 | Ga0068858_100091786 | 3300005842 | Bacteria | 2826 |
| 54 | Ga0068860_100001684 | 3300005843 | Bacteria | 23610 |
| 55 | Ga0068860_100406402 | 3300005843 | Bacteria | 1348 |
| 56 | Ga0068862_100031082 | 3300005844 | Bacteria | 4504 |
| 57 | Ga0068862_100038406 | 3300005844 | Bacteria | 4060 |
| 58 | Ga0081455_10071811 | 3300005937 | Bacteria | 2868 |
| 59 | Ga0081538_10199388 | 3300005981 | Bacteria | 825 |
| 60 | Ga0081540_1006324 | 3300005983 | Bacteria | 8652 |
| 61 | Ga0070717_10053359 | 3300006028 | Bacteria | 3332 |
| 62 | Ga0070717_10520824 | 3300006028 | Bacteria | 1076 |
| 63 | Ga0075364_10155236 | 3300006051 | Bacteria | 1544 |
| 64 | Ga0070716_100133122 | 3300006173 | Bacteria | 1575 |
| 65 | Ga0070716_100440956 | 3300006173 | Bacteria | 947 |
| 66 | Ga0070716_101678130 | 3300006173 | Bacteria | 524 |
| 67 | Ga0070712_101021421 | 3300006175 | Bacteria | 716 |
| 68 | Ga0075362_10259021 | 3300006177 | Bacteria | 857 |
| 69 | Ga0075369_10223816 | 3300006186 | Bacteria | 871 |
| 70 | Ga0075428_102747409 | 3300006844 | Unclassified | 501 |
| 71 | Ga0075434_100833692 | 3300006871 | Bacteria | 938 |
| 72 | Ga0075436_100228491 | 3300006914 | Bacteria | 1321 |
| 73 | Ga0097620_100406189 | 3300006931 | Bacteria | 1458 |
| 74 | Ga0097620_101129196 | 3300006931 | Bacteria | 862 |
| 75 | Ga0075435_100065482 | 3300007076 | Bacteria | 2954 |
| 76 | Ga0111539_10460054 | 3300009094 | Bacteria | 1482 |
| 77 | Ga0105245_10731578 | 3300009098 | Bacteria | 1024 |
| 78 | Ga0105245_12751507 | 3300009098 | Bacteria | 545 |
| 79 | Ga0105247_10131614 | 3300009101 | Bacteria | 1631 |
| 80 | Ga0105248_13047485 | 3300009177 | Bacteria | 533 |
| 81 | Ga0105249_10478945 | 3300009553 | Bacteria | 1287 |
| 82 | Ga0105249_11168345 | 3300009553 | Bacteria | 840 |
| 83 | Ga0105249_11645009 | 3300009553 | Bacteria | 715 |
| 84 | Ga0099796_10055928 | 3300010159 | Bacteria | 1383 |
| 85 | Ga0105239_11324313 | 3300010375 | Bacteria | 831 |
| 86 | Ga0157370_11448615 | 3300013104 | Bacteria | 618 |
| 87 | Ga0157369_11241166 | 3300013105 | Bacteria | 760 |
| 88 | Ga0157369_12448785 | 3300013105 | Bacteria | 529 |
| 89 | Ga0163162_10962972 | 3300013306 | Bacteria | 964 |
| 90 | Ga0157372_12426953 | 3300013307 | Bacteria | 602 |
| 91 | Ga0163163_10074299 | 3300014325 | Bacteria | 3391 |
| 92 | Ga0163163_11830703 | 3300014325 | Bacteria | 667 |
| 93 | Ga0157380_10416789 | 3300014326 | Bacteria | 1279 |
| 94 | Ga0157380_11414454 | 3300014326 | Bacteria | 746 |
| 95 | Ga0182008_10674639 | 3300014497 | Bacteria | 588 |
| 96 | Ga0182008_10801793 | 3300014497 | Bacteria | 547 |
| 97 | Ga0157376_10896364 | 3300014969 | Bacteria | 905 |
| 98 | Ga0157376_12452376 | 3300014969 | Bacteria | 561 |
| 99 | Ga0206351_10920011 | 3300020077 | Bacteria | 517 |
| 100 | Ga0213873_10005677 | 3300021358 | Bacteria | 2408 |
| 101 | Ga0213872_10018614 | 3300021361 | Bacteria | 3201 |
| 102 | Ga0213872_10065019 | 3300021361 | Bacteria | 1647 |
| 103 | Ga0213872_10188126 | 3300021361 | Bacteria | 889 |
| 104 | Ga0213876_10183275 | 3300021384 | Bacteria | 1113 |
| 105 | Ga0209130_1000706 | 3300025284 | Bacteria | 29893 |
| 106 | Ga0209025_1000750 | 3300025294 | Bacteria | 54523 |
| 107 | Ga0209758_1009034 | 3300025297 | Bacteria | 6297 |
| 108 | Ga0207426_1000336 | 3300025302 | Bacteria | 88370 |
| 109 | Ga0207692_10848504 | 3300025898 | Bacteria | 599 |
| 110 | Ga0207699_11468660 | 3300025906 | Bacteria | 504 |
| 111 | Ga0207684_10019216 | 3300025910 | Bacteria | 5845 |
| 112 | Ga0207693_10113345 | 3300025915 | Bacteria | 2127 |
| 113 | Ga0207693_10124956 | 3300025915 | Bacteria | 2021 |
| 114 | Ga0207663_10050583 | 3300025916 | Bacteria | 2583 |
| 115 | Ga0207646_10071444 | 3300025922 | Bacteria | 3100 |
| 116 | Ga0207700_10500477 | 3300025928 | Bacteria | 1075 |
| 117 | Ga0207664_10217971 | 3300025929 | Bacteria | 1654 |
| 118 | Ga0207664_10269792 | 3300025929 | Bacteria | 1490 |
| 119 | Ga0207664_10324705 | 3300025929 | Bacteria | 1358 |
| 120 | Ga0207644_10632681 | 3300025931 | Bacteria | 890 |
| 121 | Ga0207665_10007579 | 3300025939 | Bacteria | 7172 |
| 122 | Ga0207665_10129885 | 3300025939 | Bacteria | 1787 |
| 123 | Ga0207668_11155388 | 3300025972 | Bacteria | 695 |
| 124 | Ga0207677_12260120 | 3300026023 | Bacteria | 506 |
| 125 | Ga0207639_10604222 | 3300026041 | Bacteria | 1012 |
| 126 | Ga0207702_10196753 | 3300026078 | Bacteria | 1866 |
| 127 | Ga0207641_11484933 | 3300026088 | Bacteria | 679 |
| 128 | Ga0207674_10570739 | 3300026116 | Bacteria | 1093 |
| 129 | Ga0207698_11599176 | 3300026142 | Bacteria | 667 |
| 130 | Ga0209179_1001257 | 3300027512 | Bacteria | 3037 |
| 131 | Ga0265769_108088 | 3300030888 | Bacteria | 687 |
| 132 | Ga0316576_10238957 | 3300031727 | Bacteria | 1365 |
| 133 | Ga0316578_10009841 | 3300031728 | Bacteria | 4935 |
| 134 | Ga0307405_11495788 | 3300031731 | Unclassified | 593 |
| 135 | Ga0316577_10141621 | 3300031733 | Bacteria | 1355 |
| 136 | Ga0307406_11351701 | 3300031901 | Bacteria | 623 |
| 137 | Ga0307412_10576484 | 3300031911 | Unclassified | 949 |
| 138 | Ga0316593_10000032 | 3300032168 | Bacteria | 14610 |
| 139 | Ga0316596_1054892 | 3300033541 | Bacteria | 1057 |
| 140 | Ga0316596_1120920 | 3300033541 | Bacteria | 713 |
| 141 | Ga0373929_0106034 | 3300035085 | Bacteria | 714 |
| 142 | Ga0373932_0019729 | 3300035112 | Bacteria | 1760 |
| 143 | Ga0373941_0175316 | 3300035115 | Bacteria | 801 |
| 144 | Ga0373945_0242983 | 3300035116 | Bacteria | 758 |
| 145 | Ga0373954_0585144 | 3300035118 | Bacteria | 553 |
| 146 | Ga0373956_0027855 | 3300035119 | Bacteria | 2456 |
| 147 | Ga0373957_0258871 | 3300035120 | Bacteria | 733 |
| 148 | Ga0373960_0048102 | 3300035121 | Bacteria | 1257 |
| 149 | Ga0373943_0582455 | 3300035170 | Bacteria | 658 |
| 150 | Ga0373955_0104944 | 3300035172 | Bacteria | 1627 |
| 151 | Ga0316574_0161677 | 3300035398 | Bacteria | 1442 |
| 152 | Ga0316574_0546947 | 3300035398 | Bacteria | 719 |
| 153 | Ga0316574_0792545 | 3300035398 | Bacteria | 577 |
| 154 | Ga0373931_0020821 | 3300035691 | Bacteria | 3284 |
| 155 | Ga0373927_1059713 | 3300035695 | Bacteria | 535 |
| 156 | Ga0373933_0484192 | 3300035724 | Bacteria | 810 |
| 157 | Ga0373937_0158163 | 3300036401 | Bacteria | 2124 |
| 158 | Ga0316582_0034174 | 3300036647 | Bacteria | 3129 |
| 159 | Ga0316582_0281247 | 3300036647 | Bacteria | 1142 |
| 160 | Ga0316584_0013113 | 3300036712 | Bacteria | 5859 |
| 161 | Ga0395905_0672089 | 3300037471 | Bacteria | 938 |
| 162 | Ga0400490_39901 | 3300038726 | Bacteria | 15663 |
| 163 | Ga0400491_08805 | 3300038727 | Bacteria | 1576 |
| 164 | Ga0400488_49024 | 3300038741 | Bacteria | 3498 |
| 165 | Ga0400487_29008 | 3300039110 | Bacteria | 14273 |
| 166 | Ga0436365_0441459 | 3300039437 | Bacteria | 7457 |
| 167 | Ga0436360_0353163 | 3300039438 | Bacteria | 689 |
| 168 | Ga0436360_0361359 | 3300039438 | Bacteria | 1700 |
| 169 | Ga0436360_0458798 | 3300039438 | Bacteria | 919 |
| 170 | Ga0436360_1303757 | 3300039438 | Bacteria | 3138 |
| 171 | Ga0436361_0030247 | 3300039447 | Bacteria | 1658 |
| 172 | Ga0436361_0431627 | 3300039447 | Bacteria | 2515 |
| 173 | Ga0436361_1179814 | 3300039447 | Bacteria | 3236 |
| 174 | Ga0436363_0030844 | 3300039450 | Bacteria | 1148 |
| 175 | Ga0436362_0316600 | 3300039453 | Bacteria | 4165 |
| 176 | Ga0436362_0462667 | 3300039453 | Bacteria | 1670 |
| 177 | Ga0439447_018070 | 3300041407 | Bacteria | 1909 |
| 178 | Ga0439466_0242808 | 3300041411 | Bacteria | 546 |
| 179 | Ga0439465_0025742 | 3300041413 | Bacteria | 1858 |
| 180 | Ga0439458_0022320 | 3300042157 | Bacteria | 1470 |
| 181 | Ga0450909_039289 | 3300042185 | Bacteria | 727 |
| 182 | Ga0439434_0087816 | 3300042435 | Bacteria | 992 |
| 183 | Ga0439444_0073030 | 3300042437 | Bacteria | 738 |
| 184 | Ga0466963_0386967 | 3300044694 | Bacteria | 986 |
| 185 | Ga0466964_0841632 | 3300044706 | Bacteria | 521 |
| 186 | Ga0466957_0407091 | 3300044842 | Bacteria | 931 |
| 187 | Ga0466957_0918809 | 3300044842 | Bacteria | 626 |
| 188 | Ga0466960_0980941 | 3300044901 | Bacteria | 518 |
| 189 | Ga0466958_0176744 | 3300045836 | Bacteria | 1354 |
| 190 | Ga0466967_0851845 | 3300045976 | Bacteria | 906 |
| 191 | Ga0495629_0432484 | 3300046459 | Bacteria | 892 |
| 192 | Ga0495651_0410063 | 3300046462 | Bacteria | 883 |
| 193 | Ga0495664_0712064 | 3300046477 | Bacteria | 593 |
| 194 | Ga0495594_0095334 | 3300046499 | Bacteria | 1671 |
| 195 | Ga0495594_0164738 | 3300046499 | Bacteria | 1261 |
| 196 | Ga0495583_0423502 | 3300046506 | Bacteria | 522 |
| 197 | Ga0495608_0580789 | 3300046511 | Bacteria | 674 |
| 198 | Ga0495610_0026115 | 3300046512 | Bacteria | 3122 |
| 199 | Ga0495628_0222648 | 3300046516 | Bacteria | 1417 |
| 200 | Ga0495652_1069876 | 3300046529 | Bacteria | 525 |
| 201 | Ga0495586_0133613 | 3300046535 | Bacteria | 1390 |
| 202 | Ga0495667_0106171 | 3300046559 | Bacteria | 1815 |
| 203 | Ga0495668_0735007 | 3300046616 | Bacteria | 546 |
| 204 | Ga0495634_0193577 | 3300046642 | Bacteria | 1267 |
| 205 | Ga0495635_0018858 | 3300046663 | Bacteria | 4814 |
| 206 | Ga0495649_0338877 | 3300046694 | Bacteria | 761 |
| 207 | Ga0495600_0145489 | 3300046809 | Bacteria | 1536 |
| 208 | Ga0495680_0067338 | 3300047322 | Bacteria | 2738 |
| 209 | Ga0495673_0196452 | 3300047469 | Bacteria | 757 |
| 210 | Ga0495684_0847892 | 3300047471 | Bacteria | 593 |
| 211 | Ga0496104_0147796 | 3300048907 | Bacteria | 2257 |
| 212 | Ga0496109_1091818 | 3300048912 | Bacteria | 735 |
| 213 | Ga0496110_0326196 | 3300048913 | Bacteria | 1398 |
| 214 | Ga0496112_0040118 | 3300048915 | Bacteria | 4577 |
| 215 | Ga0496112_0196206 | 3300048915 | Bacteria | 1979 |
| 216 | Ga0496113_0221932 | 3300048916 | Bacteria | 1506 |
| 217 | Ga0496119_0365215 | 3300048922 | Bacteria | 696 |
| 218 | Ga0496123_0330982 | 3300048926 | Bacteria | 715 |
| 219 | Ga0501317_002279 | 3300049533 | Bacteria | 1793 |
| 220 | Ga0501325_040950 | 3300049541 | Bacteria | 564 |
| 221 | Ga0501032_0186675 | 3300049569 | Bacteria | 1356 |
| 222 | Ga0501033_0337674 | 3300049570 | Bacteria | 1057 |
| 223 | Ga0501034_0307949 | 3300049571 | Bacteria | 1519 |
| 224 | Ga0501036_1443203 | 3300049572 | Bacteria | 557 |
| 225 | Ga0501037_0133346 | 3300049573 | Bacteria | 1780 |
| 226 | Ga0501037_0574196 | 3300049573 | Bacteria | 759 |
| 227 | Ga0501038_0241573 | 3300049574 | Bacteria | 1434 |
| 228 | Ga0501038_0874658 | 3300049574 | Bacteria | 664 |
| 229 | Ga0501039_0195812 | 3300049575 | Bacteria | 1589 |
| 230 | Ga0501039_0813102 | 3300049575 | Bacteria | 729 |
| 231 | Ga0501039_1337815 | 3300049575 | Bacteria | 552 |
| 232 | Ga0501040_0080605 | 3300049576 | Bacteria | 2255 |
| 233 | Ga0501041_0615809 | 3300049577 | Bacteria | 693 |
| 234 | Ga0501042_0168103 | 3300049578 | Bacteria | 1582 |
| 235 | Ga0501043_0653620 | 3300049579 | Bacteria | 772 |
| 236 | Ga0501043_0667602 | 3300049579 | Bacteria | 762 |
| 237 | Ga0501043_1117080 | 3300049579 | Bacteria | 556 |
| 238 | Ga0501043_1182134 | 3300049579 | Bacteria | 538 |
| 239 | Ga0501047_0002319 | 3300049581 | Bacteria | 18206 |
| 240 | Ga0501047_1139632 | 3300049581 | Bacteria | 593 |
| 241 | Ga0501048_0208760 | 3300049582 | Bacteria | 1385 |
| 242 | Ga0501048_0274210 | 3300049582 | Bacteria | 1199 |
| 243 | Ga0501068_0790627 | 3300049584 | Bacteria | 622 |
| 244 | Ga0501070_0393203 | 3300049586 | Bacteria | 1122 |
| 245 | Ga0501071_0090066 | 3300049587 | Bacteria | 2252 |
| 246 | Ga0501072_0437979 | 3300049588 | Bacteria | 1035 |
| 247 | Ga0501072_1129391 | 3300049588 | Bacteria | 609 |
| 248 | Ga0501073_0649819 | 3300049589 | Bacteria | 728 |
| 249 | Ga0501074_0350131 | 3300049590 | Bacteria | 1048 |
| 250 | Ga0501074_1048323 | 3300049590 | Bacteria | 573 |
| 251 | Ga0501075_0269444 | 3300049591 | Bacteria | 1298 |
| 252 | Ga0501075_0341685 | 3300049591 | Bacteria | 1141 |
| 253 | Ga0501076_0828499 | 3300049592 | Bacteria | 763 |
| 254 | Ga0501077_0893308 | 3300049593 | Bacteria | 571 |
| 255 | Ga0501079_0845969 | 3300049741 | Bacteria | 720 |
| 256 | Ga0501080_0889263 | 3300049742 | Bacteria | 777 |
| 257 | Ga0501080_1389941 | 3300049742 | Bacteria | 599 |
| 258 | Ga0501081_0192349 | 3300049743 | Bacteria | 1478 |
| 259 | Ga0501081_0365335 | 3300049743 | Bacteria | 1065 |
| 260 | Ga0501081_0470034 | 3300049743 | Bacteria | 935 |
| 261 | Ga0501083_0528052 | 3300049744 | Bacteria | 768 |
| 262 | Ga0501035_0163352 | 3300049822 | Bacteria | 1927 |
| 263 | Ga0501035_0473640 | 3300049822 | Bacteria | 1034 |
| 264 | Ga0501044_0854523 | 3300049823 | Bacteria | 787 |
| 265 | Ga0501044_1045559 | 3300049823 | Bacteria | 687 |
| 266 | Ga0501045_0722685 | 3300049824 | Bacteria | 734 |
| 267 | nmdc:mga03683_330400_c1 | 3300050489 | Bacteria | 719 |
| 268 | nmdc:mga03n38_913118_c1 | 3300050490 | Bacteria | 516 |
| 269 | nmdc:mga00v17_662547_c1 | 3300050491 | Bacteria | 671 |
| 270 | nmdc:mga0k408_111990_c1 | 3300050493 | Bacteria | 1613 |
| 271 | nmdc:mga0n895_324758_c1 | 3300050512 | Bacteria | 1559 |
| 272 | nmdc:mga0n895_415235_c1 | 3300050512 | Bacteria | 1360 |
| 273 | nmdc:mga0rr50_88314_c1 | 3300050513 | Bacteria | 2408 |
| 274 | nmdc:mga08x19_408733_c1 | 3300050514 | Bacteria | 953 |
| 275 | Ga0495601_0018046 | 3300053077 | Bacteria | 4290 |
| 276 | Ga0495612_0317042 | 3300053078 | Bacteria | 701 |
| 277 | Ga0495595_0113889 | 3300053084 | Bacteria | 1313 |
| 278 | Ga0495619_0004308 | 3300053085 | Bacteria | 9078 |
| 279 | Ga0500643_001398 | 3300053087 | Bacteria | 13944 |
| 280 | Ga0500568_0047087 | 3300053139 | Bacteria | 1709 |
| 281 | Ga0587084_085271 | 3300059477 | Bacteria | 618 |
| 282 | Ga0587084_124041 | 3300059477 | Bacteria | 546 |
| 283 | Ga0587077_057363 | 3300059493 | Bacteria | 833 |
| 284 | Ga0587080_104205 | 3300059503 | Bacteria | 611 |
| 285 | Ga0587085_107167 | 3300059506 | Bacteria | 598 |
| 286 | Ga0587086_048237 | 3300059507 | Bacteria | 679 |
| 287 | Ga0587090_000239 | 3300059510 | Bacteria | 4051 |
| 288 | Ga0587098_009070 | 3300059604 | Bacteria | 1072 |
| 289 | Ga0587101_000303 | 3300059623 | Bacteria | 3204 |
| 290 | Ga0587062_111297 | 3300059639 | Bacteria | 544 |
| 291 | Ga0587068_001246 | 3300059641 | Bacteria | 2782 |
| 292 | Ga0587072_161028 | 3300059643 | Bacteria | 548 |
| 293 | Ga0587076_016276 | 3300059645 | Bacteria | 1171 |
| 294 | Ga0587078_000387 | 3300059646 | Bacteria | 3211 |
| 295 | Ga0587071_084340 | 3300060344 | Bacteria | 712 |
| 296 | Ga0587071_194805 | 3300060344 | Bacteria | 527 |
| 297 | Ga0587111_0000079 | 3300060346 | Bacteria | 5946 |
| 298 | Ga0501082_1013276 | 3300060353 | Bacteria | 726 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005328 | Ga0070676_10747938 | Ga0070676_107479381 | 62 |
| 2 | 3300005330 | Ga0070690_101747335 | Ga0070690_1017473352 | 62 |
| 3 | 3300005335 | Ga0070666_10414492 | Ga0070666_104144923 | 62 |
| 4 | 3300005338 | Ga0068868_100564894 | Ga0068868_1005648942 | 62 |
| 5 | 3300005347 | Ga0070668_100018845 | Ga0070668_1000188459 | 62 |
| 6 | 3300005353 | Ga0070669_100836773 | Ga0070669_1008367732 | 62 |
| 7 | 3300005353 | Ga0070669_101226162 | Ga0070669_1012261622 | 62 |
| 8 | 3300005354 | Ga0070675_100610656 | Ga0070675_1006106562 | 62 |
| 9 | 3300005356 | Ga0070674_100990442 | Ga0070674_1009904423 | 62 |
| 10 | 3300005367 | Ga0070667_100026034 | Ga0070667_1000260341 | 62 |
| 11 | 3300005367 | Ga0070667_100513791 | Ga0070667_1005137913 | 62 |
| 12 | 3300005455 | Ga0070663_100704860 | Ga0070663_1007048603 | 62 |
| 13 | 3300005459 | Ga0068867_100287201 | Ga0068867_1002872013 | 62 |
| 14 | 3300005548 | Ga0070665_100029959 | Ga0070665_10002995912 | 62 |
| 15 | 3300005548 | Ga0070665_100598287 | Ga0070665_1005982873 | 62 |
| 16 | 3300005577 | Ga0068857_101002556 | Ga0068857_1010025563 | 62 |
| 17 | 3300005617 | Ga0068859_100406184 | Ga0068859_1004061843 | 62 |
| 18 | 3300005617 | Ga0068859_101129201 | Ga0068859_1011292012 | 62 |
| 19 | 3300005618 | Ga0068864_100000263 | Ga0068864_10000026358 | 62 |
| 20 | 3300005618 | Ga0068864_100419719 | Ga0068864_1004197193 | 62 |
| 21 | 3300005841 | Ga0068863_100036803 | Ga0068863_10003680312 | 62 |
| 22 | 3300005841 | Ga0068863_100200103 | Ga0068863_1002001033 | 62 |
| 23 | 3300005842 | Ga0068858_100091786 | Ga0068858_1000917866 | 62 |
| 24 | 3300005843 | Ga0068860_100001684 | Ga0068860_1000016848 | 62 |
| 25 | 3300005843 | Ga0068860_100406402 | Ga0068860_1004064022 | 62 |
| 26 | 3300005844 | Ga0068862_100031082 | Ga0068862_1000310828 | 62 |
| 27 | 3300005844 | Ga0068862_100038406 | Ga0068862_1000384068 | 62 |
| 28 | 3300006931 | Ga0097620_100406189 | Ga0097620_1004061893 | 62 |
| 29 | 3300006931 | Ga0097620_101129196 | Ga0097620_1011291963 | 62 |
| 30 | 3300009094 | Ga0111539_10460054 | Ga0111539_104600542 | 62 |
| 31 | 3300009098 | Ga0105245_12751507 | Ga0105245_127515072 | 62 |
| 32 | 3300009101 | Ga0105247_10131614 | Ga0105247_101316145 | 62 |
| 33 | 3300009177 | Ga0105248_13047485 | Ga0105248_130474852 | 62 |
| 34 | 3300009553 | Ga0105249_10478945 | Ga0105249_104789453 | 62 |
| 35 | 3300009553 | Ga0105249_11168345 | Ga0105249_111683453 | 62 |
| 36 | 3300009553 | Ga0105249_11645009 | Ga0105249_116450091 | 62 |
| 37 | 3300013105 | Ga0157369_11241166 | Ga0157369_112411662 | 62 |
| 38 | 3300013306 | Ga0163162_10962972 | Ga0163162_109629723 | 62 |
| 39 | 3300013307 | Ga0157372_12426953 | Ga0157372_124269532 | 62 |
| 40 | 3300014325 | Ga0163163_10074299 | Ga0163163_100742993 | 62 |
| 41 | 3300014326 | Ga0157380_10416789 | Ga0157380_104167892 | 62 |
| 42 | 3300014326 | Ga0157380_11414454 | Ga0157380_114144543 | 62 |
| 43 | 3300014497 | Ga0182008_10801793 | Ga0182008_108017932 | 62 |
| 44 | 3300014969 | Ga0157376_10896364 | Ga0157376_108963643 | 62 |
| 45 | 3300020077 | Ga0206351_10920011 | Ga0206351_109200111 | 63 |
| 46 | 3300021361 | Ga0213872_10065019 | Ga0213872_100650192 | 63 |
| 47 | 3300031731 | Ga0307405_11495788 | Ga0307405_114957881 | 63 |
| 48 | 3300031911 | Ga0307412_10576484 | Ga0307412_105764842 | 63 |
| 49 | 3300032168 | Ga0316593_10000032 | Ga0316593_100000329 | 63 |
| 50 | 3300033541 | Ga0316596_1054892 | Ga0316596_10548922 | 63 |
| 51 | 3300033541 | Ga0316596_1120920 | Ga0316596_11209202 | 63 |
| 52 | 3300036647 | Ga0316582_0034174 | Ga0316582_0034174_1793_1990 | 63 |
| 53 | 3300037471 | Ga0395905_0672089 | Ga0395905_0672089_256_453 | 63 |
| 54 | 3300039438 | Ga0436360_1303757 | Ga0436360_1303757_2236_2433 | 63 |
| 55 | 3300039447 | Ga0436361_0030247 | Ga0436361_0030247_1245_1442 | 63 |
| 56 | 3300042437 | Ga0439444_0073030 | Ga0439444_0073030_41_238 | 63 |
| 57 | 3300044706 | Ga0466964_0841632 | Ga0466964_0841632_190_387 | 63 |
| 58 | 3300049570 | Ga0501033_0337674 | Ga0501033_0337674_541_738 | 63 |
| 59 | 3300049573 | Ga0501037_0133346 | Ga0501037_0133346_644_841 | 63 |
| 60 | 3300049573 | Ga0501037_0574196 | Ga0501037_0574196_418_615 | 63 |
| 61 | 3300049575 | Ga0501039_0195812 | Ga0501039_0195812_421_618 | 63 |
| 62 | 3300049575 | Ga0501039_0813102 | Ga0501039_0813102_480_677 | 63 |
| 63 | 3300049576 | Ga0501040_0080605 | Ga0501040_0080605_577_774 | 63 |
| 64 | 3300049577 | Ga0501041_0615809 | Ga0501041_0615809_351_548 | 63 |
| 65 | 3300049578 | Ga0501042_0168103 | Ga0501042_0168103_90_287 | 63 |
| 66 | 3300049579 | Ga0501043_0667602 | Ga0501043_0667602_442_639 | 63 |
| 67 | 3300049579 | Ga0501043_1182134 | Ga0501043_1182134_77_274 | 63 |
| 68 | 3300049582 | Ga0501048_0274210 | Ga0501048_0274210_406_603 | 63 |
| 69 | 3300049587 | Ga0501071_0090066 | Ga0501071_0090066_81_278 | 63 |
| 70 | 3300049588 | Ga0501072_0437979 | Ga0501072_0437979_11_208 | 63 |
| 71 | 3300049588 | Ga0501072_1129391 | Ga0501072_1129391_263_460 | 63 |
| 72 | 3300049590 | Ga0501074_0350131 | Ga0501074_0350131_475_672 | 63 |
| 73 | 3300049590 | Ga0501074_1048323 | Ga0501074_1048323_249_446 | 63 |
| 74 | 3300049591 | Ga0501075_0269444 | Ga0501075_0269444_1047_1244 | 63 |
| 75 | 3300049591 | Ga0501075_0341685 | Ga0501075_0341685_745_942 | 63 |
| 76 | 3300049592 | Ga0501076_0828499 | Ga0501076_0828499_335_532 | 63 |
| 77 | 3300049593 | Ga0501077_0893308 | Ga0501077_0893308_301_498 | 63 |
| 78 | 3300049741 | Ga0501079_0845969 | Ga0501079_0845969_289_486 | 63 |
| 79 | 3300049742 | Ga0501080_0889263 | Ga0501080_0889263_157_354 | 63 |
| 80 | 3300049743 | Ga0501081_0192349 | Ga0501081_0192349_1173_1370 | 63 |
| 81 | 3300049743 | Ga0501081_0365335 | Ga0501081_0365335_724_921 | 63 |
| 82 | 3300049743 | Ga0501081_0470034 | Ga0501081_0470034_242_439 | 63 |
| 83 | 3300049744 | Ga0501083_0528052 | Ga0501083_0528052_204_401 | 63 |
| 84 | 3300049822 | Ga0501035_0163352 | Ga0501035_0163352_107_304 | 63 |
| 85 | 3300049822 | Ga0501035_0473640 | Ga0501035_0473640_431_628 | 63 |
| 86 | 3300049824 | Ga0501045_0722685 | Ga0501045_0722685_140_337 | 63 |
| 87 | 3300050512 | nmdc:mga0n895_415235_c1 | nmdc:mga0n895_415235_c1_751_948 | 63 |
| 88 | 3300053087 | Ga0500643_001398 | Ga0500643_001398_2334_2531 | 63 |
| 89 | 3300060353 | Ga0501082_1013276 | Ga0501082_1013276_465_662 | 63 |
| 90 | iso_pu_bacteria | 8054563764 | 8054566748 | 63 |
| 91 | 3300005434 | Ga0070709_10840726 | Ga0070709_108407263 | 64 |
| 92 | 3300005435 | Ga0070714_101009384 | Ga0070714_1010093842 | 64 |
| 93 | 3300005436 | Ga0070713_101238061 | Ga0070713_1012380611 | 64 |
| 94 | 3300006051 | Ga0075364_10155236 | Ga0075364_101552362 | 64 |
| 95 | 3300006173 | Ga0070716_100440956 | Ga0070716_1004409563 | 64 |
| 96 | 3300006173 | Ga0070716_101678130 | Ga0070716_1016781301 | 64 |
| 97 | 3300006175 | Ga0070712_101021421 | Ga0070712_1010214212 | 64 |
| 98 | 3300025929 | Ga0207664_10217971 | Ga0207664_102179715 | 64 |
| 99 | 3300025939 | Ga0207665_10129885 | Ga0207665_101298852 | 64 |
| 100 | 3300035398 | Ga0316574_0161677 | Ga0316574_0161677_806_1006 | 64 |
| 101 | 3300035695 | Ga0373927_1059713 | Ga0373927_1059713_81_281 | 64 |
| 102 | 3300038726 | Ga0400490_39901 | Ga0400490_39901_4702_4902 | 64 |
| 103 | 3300038727 | Ga0400491_08805 | Ga0400491_08805_1230_1430 | 64 |
| 104 | 3300038741 | Ga0400488_49024 | Ga0400488_49024_2954_3154 | 64 |
| 105 | 3300039110 | Ga0400487_29008 | Ga0400487_29008_4641_4841 | 64 |
| 106 | 3300046616 | Ga0495668_0735007 | Ga0495668_0735007_218_418 | 64 |
| 107 | 3300049569 | Ga0501032_0186675 | Ga0501032_0186675_47_247 | 64 |
| 108 | 3300049571 | Ga0501034_0307949 | Ga0501034_0307949_329_529 | 64 |
| 109 | 3300049572 | Ga0501036_1443203 | Ga0501036_1443203_13_213 | 64 |
| 110 | 3300049574 | Ga0501038_0241573 | Ga0501038_0241573_1171_1371 | 64 |
| 111 | 3300049575 | Ga0501039_1337815 | Ga0501039_1337815_188_388 | 64 |
| 112 | 3300049579 | Ga0501043_0653620 | Ga0501043_0653620_370_570 | 64 |
| 113 | 3300049581 | Ga0501047_0002319 | Ga0501047_0002319_12619_12819 | 64 |
| 114 | 3300049582 | Ga0501048_0208760 | Ga0501048_0208760_1139_1339 | 64 |
| 115 | 3300049589 | Ga0501073_0649819 | Ga0501073_0649819_518_718 | 64 |
| 116 | 3300049823 | Ga0501044_0854523 | Ga0501044_0854523_441_641 | 64 |
| 117 | 3300050491 | nmdc:mga00v17_662547_c1 | nmdc:mga00v17_662547_c1_363_563 | 64 |
| 118 | 3300014325 | Ga0163163_11830703 | Ga0163163_118307032 | 65 |
| 119 | 3300031727 | Ga0316576_10238957 | Ga0316576_102389573 | 65 |
| 120 | 3300031728 | Ga0316578_10009841 | Ga0316578_100098419 | 65 |
| 121 | 3300031733 | Ga0316577_10141621 | Ga0316577_101416212 | 65 |
| 122 | 3300035398 | Ga0316574_0546947 | Ga0316574_0546947_252_455 | 65 |
| 123 | 3300035398 | Ga0316574_0792545 | Ga0316574_0792545_44_247 | 65 |
| 124 | 3300036647 | Ga0316582_0281247 | Ga0316582_0281247_764_967 | 65 |
| 125 | 3300036712 | Ga0316584_0013113 | Ga0316584_0013113_3996_4199 | 65 |
| 126 | 3300003187 | JGI25151J46595_10000624 | JGI25151J46595_1000062434 | 66 |
| 127 | 3300003354 | JGI25160J50197_1036456 | JGI25160J50197_10364564 | 66 |
| 128 | 3300003579 | Ga0007429J51699_1067287 | Ga0007429J51699_10672871 | 66 |
| 129 | 3300003659 | JGI25404J52841_10139395 | JGI25404J52841_101393952 | 66 |
| 130 | 3300005455 | Ga0070663_101772085 | Ga0070663_1017720852 | 66 |
| 131 | 3300005539 | Ga0068853_100709018 | Ga0068853_1007090182 | 66 |
| 132 | 3300005577 | Ga0068857_100560610 | Ga0068857_1005606102 | 66 |
| 133 | 3300005834 | Ga0068851_10621967 | Ga0068851_106219672 | 66 |
| 134 | 3300005937 | Ga0081455_10071811 | Ga0081455_100718117 | 66 |
| 135 | 3300005981 | Ga0081538_10199388 | Ga0081538_101993882 | 66 |
| 136 | 3300005983 | Ga0081540_1006324 | Ga0081540_100632415 | 66 |
| 137 | 3300006177 | Ga0075362_10259021 | Ga0075362_102590213 | 66 |
| 138 | 3300006186 | Ga0075369_10223816 | Ga0075369_102238163 | 66 |
| 139 | 3300006844 | Ga0075428_102747409 | Ga0075428_1027474091 | 66 |
| 140 | 3300010375 | Ga0105239_11324313 | Ga0105239_113243132 | 66 |
| 141 | 3300021361 | Ga0213872_10018614 | Ga0213872_100186147 | 66 |
| 142 | 3300021361 | Ga0213872_10188126 | Ga0213872_101881262 | 66 |
| 143 | 3300025284 | Ga0209130_1000706 | Ga0209130_100070633 | 66 |
| 144 | 3300025294 | Ga0209025_1000750 | Ga0209025_100075011 | 66 |
| 145 | 3300025297 | Ga0209758_1009034 | Ga0209758_10090342 | 66 |
| 146 | 3300025302 | Ga0207426_1000336 | Ga0207426_100033687 | 66 |
| 147 | 3300025972 | Ga0207668_11155388 | Ga0207668_111553883 | 66 |
| 148 | 3300026023 | Ga0207677_12260120 | Ga0207677_122601202 | 66 |
| 149 | 3300026041 | Ga0207639_10604222 | Ga0207639_106042223 | 66 |
| 150 | 3300026116 | Ga0207674_10570739 | Ga0207674_105707392 | 66 |
| 151 | 3300030888 | Ga0265769_108088 | Ga0265769_1080882 | 66 |
| 152 | 3300035116 | Ga0373945_0242983 | Ga0373945_0242983_207_416 | 66 |
| 153 | 3300035118 | Ga0373954_0585144 | Ga0373954_0585144_171_380 | 66 |
| 154 | 3300035119 | Ga0373956_0027855 | Ga0373956_0027855_2157_2366 | 66 |
| 155 | 3300035120 | Ga0373957_0258871 | Ga0373957_0258871_387_596 | 66 |
| 156 | 3300035170 | Ga0373943_0582455 | Ga0373943_0582455_383_592 | 66 |
| 157 | 3300035172 | Ga0373955_0104944 | Ga0373955_0104944_1310_1519 | 66 |
| 158 | 3300035724 | Ga0373933_0484192 | Ga0373933_0484192_80_289 | 66 |
| 159 | 3300036401 | Ga0373937_0158163 | Ga0373937_0158163_1210_1419 | 66 |
| 160 | 3300039437 | Ga0436365_0441459 | Ga0436365_0441459_3046_3264 | 66 |
| 161 | 3300039438 | Ga0436360_0353163 | Ga0436360_0353163_392_598 | 66 |
| 162 | 3300039438 | Ga0436360_0361359 | Ga0436360_0361359_974_1183 | 66 |
| 163 | 3300039438 | Ga0436360_0458798 | Ga0436360_0458798_131_346 | 66 |
| 164 | 3300039447 | Ga0436361_0431627 | Ga0436361_0431627_1509_1715 | 66 |
| 165 | 3300039447 | Ga0436361_1179814 | Ga0436361_1179814_1079_1285 | 66 |
| 166 | 3300039450 | Ga0436363_0030844 | Ga0436363_0030844_105_323 | 66 |
| 167 | 3300039453 | Ga0436362_0316600 | Ga0436362_0316600_635_853 | 66 |
| 168 | 3300039453 | Ga0436362_0462667 | Ga0436362_0462667_162_371 | 66 |
| 169 | 3300041407 | Ga0439447_018070 | Ga0439447_018070_663_869 | 66 |
| 170 | 3300041411 | Ga0439466_0242808 | Ga0439466_0242808_20_226 | 66 |
| 171 | 3300041413 | Ga0439465_0025742 | Ga0439465_0025742_1334_1540 | 66 |
| 172 | 3300042157 | Ga0439458_0022320 | Ga0439458_0022320_116_322 | 66 |
| 173 | 3300042185 | Ga0450909_039289 | Ga0450909_039289_104_310 | 66 |
| 174 | 3300042435 | Ga0439434_0087816 | Ga0439434_0087816_570_776 | 66 |
| 175 | 3300044842 | Ga0466957_0407091 | Ga0466957_0407091_262_468 | 66 |
| 176 | 3300044842 | Ga0466957_0918809 | Ga0466957_0918809_67_276 | 66 |
| 177 | 3300044901 | Ga0466960_0980941 | Ga0466960_0980941_283_489 | 66 |
| 178 | 3300046459 | Ga0495629_0432484 | Ga0495629_0432484_656_865 | 66 |
| 179 | 3300046462 | Ga0495651_0410063 | Ga0495651_0410063_208_417 | 66 |
| 180 | 3300046477 | Ga0495664_0712064 | Ga0495664_0712064_115_324 | 66 |
| 181 | 3300046499 | Ga0495594_0095334 | Ga0495594_0095334_164_373 | 66 |
| 182 | 3300046499 | Ga0495594_0164738 | Ga0495594_0164738_937_1146 | 66 |
| 183 | 3300046506 | Ga0495583_0423502 | Ga0495583_0423502_114_320 | 66 |
| 184 | 3300046511 | Ga0495608_0580789 | Ga0495608_0580789_208_417 | 66 |
| 185 | 3300046512 | Ga0495610_0026115 | Ga0495610_0026115_118_324 | 66 |
| 186 | 3300046516 | Ga0495628_0222648 | Ga0495628_0222648_54_263 | 66 |
| 187 | 3300046529 | Ga0495652_1069876 | Ga0495652_1069876_289_498 | 66 |
| 188 | 3300046535 | Ga0495586_0133613 | Ga0495586_0133613_670_879 | 66 |
| 189 | 3300046559 | Ga0495667_0106171 | Ga0495667_0106171_1167_1376 | 66 |
| 190 | 3300046642 | Ga0495634_0193577 | Ga0495634_0193577_407_616 | 66 |
| 191 | 3300046663 | Ga0495635_0018858 | Ga0495635_0018858_3372_3581 | 66 |
| 192 | 3300046694 | Ga0495649_0338877 | Ga0495649_0338877_236_442 | 66 |
| 193 | 3300046809 | Ga0495600_0145489 | Ga0495600_0145489_1202_1411 | 66 |
| 194 | 3300047322 | Ga0495680_0067338 | Ga0495680_0067338_2447_2656 | 66 |
| 195 | 3300047469 | Ga0495673_0196452 | Ga0495673_0196452_517_723 | 66 |
| 196 | 3300047471 | Ga0495684_0847892 | Ga0495684_0847892_271_480 | 66 |
| 197 | 3300048922 | Ga0496119_0365215 | Ga0496119_0365215_428_634 | 66 |
| 198 | 3300048926 | Ga0496123_0330982 | Ga0496123_0330982_229_435 | 66 |
| 199 | 3300049541 | Ga0501325_040950 | Ga0501325_040950_149_355 | 66 |
| 200 | 3300049574 | Ga0501038_0874658 | Ga0501038_0874658_330_536 | 66 |
| 201 | 3300049579 | Ga0501043_1117080 | Ga0501043_1117080_127_333 | 66 |
| 202 | 3300049581 | Ga0501047_1139632 | Ga0501047_1139632_264_476 | 66 |
| 203 | 3300049584 | Ga0501068_0790627 | Ga0501068_0790627_39_245 | 66 |
| 204 | 3300049586 | Ga0501070_0393203 | Ga0501070_0393203_378_590 | 66 |
| 205 | 3300049742 | Ga0501080_1389941 | Ga0501080_1389941_159_371 | 66 |
| 206 | 3300049823 | Ga0501044_1045559 | Ga0501044_1045559_91_297 | 66 |
| 207 | 3300050489 | nmdc:mga03683_330400_c1 | nmdc:mga03683_330400_c1_184_408 | 66 |
| 208 | 3300050490 | nmdc:mga03n38_913118_c1 | nmdc:mga03n38_913118_c1_266_472 | 66 |
| 209 | 3300050493 | nmdc:mga0k408_111990_c1 | nmdc:mga0k408_111990_c1_1333_1539 | 66 |
| 210 | 3300053077 | Ga0495601_0018046 | Ga0495601_0018046_1925_2134 | 66 |
| 211 | 3300053078 | Ga0495612_0317042 | Ga0495612_0317042_283_489 | 66 |
| 212 | 3300053084 | Ga0495595_0113889 | Ga0495595_0113889_970_1179 | 66 |
| 213 | 3300053085 | Ga0495619_0004308 | Ga0495619_0004308_4429_4638 | 66 |
| 214 | 3300053139 | Ga0500568_0047087 | Ga0500568_0047087_1258_1464 | 66 |
| 215 | 3300059477 | Ga0587084_085271 | Ga0587084_085271_115_321 | 66 |
| 216 | 3300059493 | Ga0587077_057363 | Ga0587077_057363_318_524 | 66 |
| 217 | 3300059503 | Ga0587080_104205 | Ga0587080_104205_105_311 | 66 |
| 218 | 3300059507 | Ga0587086_048237 | Ga0587086_048237_164_370 | 66 |
| 219 | 3300059510 | Ga0587090_000239 | Ga0587090_000239_1555_1761 | 66 |
| 220 | 3300059604 | Ga0587098_009070 | Ga0587098_009070_228_434 | 66 |
| 221 | 3300059623 | Ga0587101_000303 | Ga0587101_000303_2338_2544 | 66 |
| 222 | 3300059639 | Ga0587062_111297 | Ga0587062_111297_117_323 | 66 |
| 223 | 3300059641 | Ga0587068_001246 | Ga0587068_001246_2288_2494 | 66 |
| 224 | 3300059643 | Ga0587072_161028 | Ga0587072_161028_131_337 | 66 |
| 225 | 3300059645 | Ga0587076_016276 | Ga0587076_016276_310_516 | 66 |
| 226 | 3300059646 | Ga0587078_000387 | Ga0587078_000387_662_868 | 66 |
| 227 | 3300060344 | Ga0587071_084340 | Ga0587071_084340_294_500 | 66 |
| 228 | 3300060346 | Ga0587111_0000079 | Ga0587111_0000079_2301_2507 | 66 |
| 229 | 2010549000 | RicEn_FSXC10445_g1 | RicEn_235870 | 67 |
| 230 | 3300005356 | Ga0070674_100917230 | Ga0070674_1009172302 | 67 |
| 231 | 3300005434 | Ga0070709_10266128 | Ga0070709_102661283 | 67 |
| 232 | 3300005435 | Ga0070714_100352877 | Ga0070714_1003528773 | 67 |
| 233 | 3300005435 | Ga0070714_100860466 | Ga0070714_1008604661 | 67 |
| 234 | 3300005436 | Ga0070713_100315402 | Ga0070713_1003154022 | 67 |
| 235 | 3300005436 | Ga0070713_100760308 | Ga0070713_1007603081 | 67 |
| 236 | 3300005436 | Ga0070713_100766838 | Ga0070713_1007668383 | 67 |
| 237 | 3300005437 | Ga0070710_10096459 | Ga0070710_100964593 | 67 |
| 238 | 3300005439 | Ga0070711_100496450 | Ga0070711_1004964502 | 67 |
| 239 | 3300005467 | Ga0070706_100061175 | Ga0070706_1000611754 | 67 |
| 240 | 3300005468 | Ga0070707_100033707 | Ga0070707_1000337072 | 67 |
| 241 | 3300005471 | Ga0070698_100065506 | Ga0070698_1000655067 | 67 |
| 242 | 3300005518 | Ga0070699_100036064 | Ga0070699_10003606410 | 67 |
| 243 | 3300005536 | Ga0070697_100595433 | Ga0070697_1005954333 | 67 |
| 244 | 3300005564 | Ga0070664_100490429 | Ga0070664_1004904292 | 67 |
| 245 | 3300005614 | Ga0068856_100194610 | Ga0068856_1001946102 | 67 |
| 246 | 3300005616 | Ga0068852_101139088 | Ga0068852_1011390882 | 67 |
| 247 | 3300005841 | Ga0068863_101385406 | Ga0068863_1013854062 | 67 |
| 248 | 3300006028 | Ga0070717_10053359 | Ga0070717_100533593 | 67 |
| 249 | 3300006028 | Ga0070717_10520824 | Ga0070717_105208242 | 67 |
| 250 | 3300006173 | Ga0070716_100133122 | Ga0070716_1001331223 | 67 |
| 251 | 3300006871 | Ga0075434_100833692 | Ga0075434_1008336922 | 67 |
| 252 | 3300006914 | Ga0075436_100228491 | Ga0075436_1002284913 | 67 |
| 253 | 3300007076 | Ga0075435_100065482 | Ga0075435_1000654823 | 67 |
| 254 | 3300009098 | Ga0105245_10731578 | Ga0105245_107315782 | 67 |
| 255 | 3300010159 | Ga0099796_10055928 | Ga0099796_100559284 | 67 |
| 256 | 3300013104 | Ga0157370_11448615 | Ga0157370_114486152 | 67 |
| 257 | 3300013105 | Ga0157369_12448785 | Ga0157369_124487852 | 67 |
| 258 | 3300014497 | Ga0182008_10674639 | Ga0182008_106746392 | 67 |
| 259 | 3300014969 | Ga0157376_12452376 | Ga0157376_124523762 | 67 |
| 260 | 3300021358 | Ga0213873_10005677 | Ga0213873_100056775 | 67 |
| 261 | 3300021384 | Ga0213876_10183275 | Ga0213876_101832752 | 67 |
| 262 | 3300025898 | Ga0207692_10848504 | Ga0207692_108485042 | 67 |
| 263 | 3300025906 | Ga0207699_11468660 | Ga0207699_114686601 | 67 |
| 264 | 3300025910 | Ga0207684_10019216 | Ga0207684_100192169 | 67 |
| 265 | 3300025915 | Ga0207693_10113345 | Ga0207693_101133455 | 67 |
| 266 | 3300025915 | Ga0207693_10124956 | Ga0207693_101249561 | 67 |
| 267 | 3300025916 | Ga0207663_10050583 | Ga0207663_100505835 | 67 |
| 268 | 3300025922 | Ga0207646_10071444 | Ga0207646_100714445 | 67 |
| 269 | 3300025928 | Ga0207700_10500477 | Ga0207700_105004773 | 67 |
| 270 | 3300025929 | Ga0207664_10269792 | Ga0207664_102697923 | 67 |
| 271 | 3300025929 | Ga0207664_10324705 | Ga0207664_103247052 | 67 |
| 272 | 3300025931 | Ga0207644_10632681 | Ga0207644_106326812 | 67 |
| 273 | 3300025939 | Ga0207665_10007579 | Ga0207665_100075798 | 67 |
| 274 | 3300026078 | Ga0207702_10196753 | Ga0207702_101967535 | 67 |
| 275 | 3300026088 | Ga0207641_11484933 | Ga0207641_114849331 | 67 |
| 276 | 3300026142 | Ga0207698_11599176 | Ga0207698_115991762 | 67 |
| 277 | 3300027512 | Ga0209179_1001257 | Ga0209179_10012576 | 67 |
| 278 | 3300031901 | Ga0307406_11351701 | Ga0307406_113517012 | 67 |
| 279 | 3300035085 | Ga0373929_0106034 | Ga0373929_0106034_473_700 | 67 |
| 280 | 3300035112 | Ga0373932_0019729 | Ga0373932_0019729_293_520 | 67 |
| 281 | 3300035115 | Ga0373941_0175316 | Ga0373941_0175316_40_267 | 67 |
| 282 | 3300035121 | Ga0373960_0048102 | Ga0373960_0048102_858_1085 | 67 |
| 283 | 3300035691 | Ga0373931_0020821 | Ga0373931_0020821_232_459 | 67 |
| 284 | 3300044694 | Ga0466963_0386967 | Ga0466963_0386967_273_500 | 67 |
| 285 | 3300045836 | Ga0466958_0176744 | Ga0466958_0176744_1069_1296 | 67 |
| 286 | 3300045976 | Ga0466967_0851845 | Ga0466967_0851845_246_473 | 67 |
| 287 | 3300048907 | Ga0496104_0147796 | Ga0496104_0147796_1894_2121 | 67 |
| 288 | 3300048912 | Ga0496109_1091818 | Ga0496109_1091818_177_392 | 67 |
| 289 | 3300048913 | Ga0496110_0326196 | Ga0496110_0326196_797_1024 | 67 |
| 290 | 3300048915 | Ga0496112_0040118 | Ga0496112_0040118_3352_3579 | 67 |
| 291 | 3300048915 | Ga0496112_0196206 | Ga0496112_0196206_123_350 | 67 |
| 292 | 3300048916 | Ga0496113_0221932 | Ga0496113_0221932_1005_1232 | 67 |
| 293 | 3300049533 | Ga0501317_002279 | Ga0501317_002279_560_775 | 67 |
| 294 | 3300050512 | nmdc:mga0n895_324758_c1 | nmdc:mga0n895_324758_c1_931_1158 | 67 |
| 295 | 3300050513 | nmdc:mga0rr50_88314_c1 | nmdc:mga0rr50_88314_c1_609_836 | 67 |
| 296 | 3300050514 | nmdc:mga08x19_408733_c1 | nmdc:mga08x19_408733_c1_148_375 | 67 |
| 297 | 3300059477 | Ga0587084_124041 | Ga0587084_124041_215_442 | 67 |
| 298 | 3300059506 | Ga0587085_107167 | Ga0587085_107167_250_477 | 67 |
| 299 | 3300060344 | Ga0587071_194805 | Ga0587071_194805_79_306 | 67 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7uvv-assembly1.cif.gz_X | a. baumannii ribosome-streptothricin-f complex: 70s with p-site trna | 0.9947 | 3 | 60 |
| 8a63-assembly1.cif.gz_2 | cryo-em structure of listeria monocytogenes 50s ribosomal subunit. | 0.9897 | 6 | 61 |
| 8a57-assembly1.cif.gz_2 | cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. | 0.9895 | 6 | 61 |
| 7uvx-assembly1.cif.gz_X | a. baumannii 70s ribosome-streptothricin-f complex | 0.9894 | 3 | 61 |
| 7uvw-assembly1.cif.gz_X | a. baumannii ribosome: 70s with e-site trna | 0.9887 | 3 | 61 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wf9V00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9828 | 11 | 67 | 1.10.287.310 |
| 4wceV00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9673 | 3 | 67 | 1.10.287.310 |
| 3cclV00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9594 | 3 | 62 | 1.10.287.310 |
| 1vq5V00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9588 | 3 | 62 | 1.10.287.310 |
| 4hubV00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9588 | 1 | 62 | 1.10.287.310 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G2C723-F1-model_v4 | Large ribosomal subunit protein uL29 | 0.9996 | 4 | 64 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7X5JCI4-F1-model_v4 | Large ribosomal subunit protein uL29 | 0.9988 | 2 | 62 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A1G2PMA6-F1-model_v4 | Large ribosomal subunit protein uL29 | 0.9964 | 1 | 64 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7V2H9L5-F1-model_v4 | Large ribosomal subunit protein uL29 | 0.9942 | 2 | 58 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2H0N3S9-F1-model_v4 | Large ribosomal subunit protein uL29 | 0.9936 | 2 | 66 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar