F394683

General Info

Members Datasets Scaffolds Average Seq Length
299 204 288 224

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100356126|Ga0070671_1003561262
Length 215
Sequence MNPASSPLGLANLGPLAQLRAGRLPERLVRLLVGLWLYGVSIALLMQSALGGSPWVVFHQGAARHLPLSWIPLRQMPGLGTVANTLLLGPFTDFNLRVLDAPEAWPLRCVYLAGGVVACGLATALYVGAQLGPGPRDGLMTGFARRTGWSIQRVRTGIEIVVLTMGVLLGGTAGVGTLLFALCVGPITQFFMRYLVLRLEAPADGADPRMSAPGR

Samples

Sample ID Description Type Environment
1 2643221576 Nocardioides sp. Root614 Isolate Unclassified
2 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
3 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
4 2643221590 Nocardioides sp. Root682 Isolate Unclassified
5 2643221641 Nocardioides sp. Root122 Isolate Unclassified
6 2738541305 Nocardioides sp. CF167 Isolate Unclassified
7 2739367898 Nocardioides sp. CF479 Isolate Unclassified
8 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
9 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
10 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
141 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.32
Metatranscriptomes 0
Isolates 3.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.4
Nodule 0.33
Rhizoplane 8.03
Rhizosphere 64.55
Stem 0
Stem Tuber 0
Unclassified 5.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10018802 3300001990 Bacteria 2214
2 JGI24738J21930_10018389 3300002075 Bacteria 1461
3 JGI24742J22300_10009696 3300002244 Bacteria 1590
4 JGI25152J39213_1000030 3300002773 Bacteria 97777
5 JGI25150J39212_1000790 3300002774 Bacteria 10797
6 JGI25151J46595_10000068 3300003187 Bacteria 140039
7 JGI25151J46595_10039112 3300003187 Bacteria 1756
8 JGI25153J46596_10000051 3300003215 Bacteria 140039
9 Ga0055524_1006417 3300003775 Bacteria 5098
10 Ga0055524_1020095 3300003775 Bacteria 2261
11 Ga0055536_1000140 3300003781 Bacteria 62385
12 Ga0055536_1002169 3300003781 Bacteria 11186
13 Ga0055536_1004942 3300003781 Bacteria 6640
14 Ga0055536_1017411 3300003781 Bacteria 2354
15 Ga0055534_1017797 3300003784 Bacteria 1248
16 Ga0055530_10000692 3300003791 Bacteria 28512
17 Ga0055530_10000746 3300003791 Bacteria 26995
18 Ga0055530_10016588 3300003791 Bacteria 2346
19 Ga0055531_10001740 3300003794 Bacteria 15582
20 Ga0055531_10005157 3300003794 Bacteria 7704
21 Ga0055531_10006036 3300003794 Bacteria 6948
22 Ga0065704_10074584 3300005289 Bacteria 6153
23 Ga0070658_10125742 3300005327 Bacteria 2134
24 Ga0070683_100022656 3300005329 Bacteria 5617
25 Ga0070683_100053418 3300005329 Bacteria 3744
26 Ga0068869_100357779 3300005334 Bacteria 1191
27 Ga0070682_100000691 3300005337 Bacteria 20383
28 Ga0070682_100032948 3300005337 Bacteria 3145
29 Ga0068868_100617772 3300005338 Bacteria 962
30 Ga0070660_100039735 3300005339 Bacteria 3577
31 Ga0070689_100075568 3300005340 Bacteria 2638
32 Ga0070689_100524753 3300005340 Bacteria 1017
33 Ga0070691_10113625 3300005341 Bacteria 1357
34 Ga0070687_100017119 3300005343 Bacteria 3325
35 Ga0070692_10000955 3300005345 Bacteria 9835
36 Ga0070675_100050606 3300005354 Bacteria 3412
37 Ga0070671_100356126 3300005355 Bacteria 1249
38 Ga0070674_100479669 3300005356 Bacteria 1032
39 Ga0070673_100021384 3300005364 Bacteria 4689
40 Ga0070688_100022371 3300005365 Bacteria 3704
41 Ga0070659_100020420 3300005366 Bacteria 5031
42 Ga0070667_100030979 3300005367 Bacteria 4460
43 Ga0070714_100132811 3300005435 Bacteria 2226
44 Ga0070701_10003433 3300005438 Bacteria 6267
45 Ga0070700_100008183 3300005441 Bacteria 5692
46 Ga0070678_100306639 3300005456 Bacteria 1351
47 Ga0070679_100519923 3300005530 Bacteria 1134
48 Ga0070684_100001882 3300005535 Bacteria 15377
49 Ga0070684_100025980 3300005535 Bacteria 4928
50 Ga0068853_100043781 3300005539 Bacteria 3830
51 Ga0070672_100088175 3300005543 Bacteria 2498
52 Ga0070686_100023018 3300005544 Bacteria 3719
53 Ga0070693_100062506 3300005547 Bacteria 2167
54 Ga0070665_100310729 3300005548 Bacteria 1580
55 Ga0068855_100170291 3300005563 Bacteria 2467
56 Ga0068857_100020175 3300005577 Bacteria 5859
57 Ga0070702_100004270 3300005615 Bacteria 6508
58 Ga0070702_100147356 3300005615 Bacteria 1507
59 Ga0068859_100567507 3300005617 Bacteria 1229
60 Ga0068864_100064414 3300005618 Bacteria 3179
61 Ga0068866_10021671 3300005718 Bacteria 2963
62 Ga0068861_100008136 3300005719 Bacteria 7216
63 Ga0068861_100563715 3300005719 Bacteria 1040
64 Ga0068851_10029761 3300005834 Bacteria 2705
65 Ga0068870_10009074 3300005840 Bacteria 4504
66 Ga0068863_100252276 3300005841 Bacteria 1704
67 Ga0068858_100082450 3300005842 Bacteria 2989
68 Ga0068860_100015728 3300005843 Bacteria 7388
69 Ga0081539_10118241 3300005985 Bacteria 1321
70 Ga0075365_10014816 3300006038 Bacteria 4698
71 Ga0075365_10035610 3300006038 Bacteria 3221
72 Ga0075365_10113389 3300006038 Bacteria 1865
73 Ga0075365_10584196 3300006038 Bacteria 790
74 Ga0075364_10000300 3300006051 Bacteria 24079
75 Ga0075370_10436971 3300006353 Bacteria 787
76 Ga0068865_100013343 3300006881 Bacteria 5191
77 Ga0068865_100119630 3300006881 Bacteria 1956
78 Ga0097620_100567508 3300006931 Bacteria 1229
79 Ga0111539_10033785 3300009094 Bacteria 6208
80 Ga0105245_10004104 3300009098 Bacteria 12931
81 Ga0105247_10231655 3300009101 Bacteria 1255
82 Ga0105243_10004085 3300009148 Bacteria 11622
83 Ga0105243_10954458 3300009148 Bacteria 857
84 Ga0105242_10070502 3300009176 Bacteria 2898
85 Ga0105248_10009289 3300009177 Bacteria 10827
86 Ga0105248_10028377 3300009177 Bacteria 6235
87 Ga0105248_10138773 3300009177 Bacteria 2742
88 Ga0105238_10042871 3300009551 Bacteria 4580
89 Ga0105249_10045039 3300009553 Bacteria 4012
90 Ga0105249_10479075 3300009553 Bacteria 1287
91 Ga0105028_106791 3300009993 Bacteria 1196
92 Ga0105246_10003031 3300011119 Bacteria 10191
93 Ga0157327_1002500 3300012512 Bacteria 1274
94 Ga0157371_10321879 3300013102 Bacteria 1122
95 Ga0157369_10079332 3300013105 Bacteria 3516
96 Ga0157369_10347218 3300013105 Bacteria 1541
97 Ga0163162_10020305 3300013306 Bacteria 6525
98 Ga0157372_10007574 3300013307 Bacteria 11545
99 Ga0157372_10059437 3300013307 Bacteria 4275
100 Ga0157372_10142493 3300013307 Bacteria 2763
101 Ga0157372_10239963 3300013307 Bacteria 2103
102 Ga0157372_10607106 3300013307 Bacteria 1275
103 Ga0163163_10022224 3300014325 Bacteria 6001
104 Ga0157380_10002258 3300014326 Bacteria 12956
105 Ga0157377_10008317 3300014745 Bacteria 5056
106 Ga0157379_10007080 3300014968 Bacteria 9695
107 Ga0182006_1010144 3300015261 Bacteria 4198
108 Ga0213875_10033961 3300021388 Bacteria 2410
109 Ga0207425_1000011 3300025245 Bacteria 550735
110 Ga0209129_1000031 3300025258 Bacteria 383039
111 Ga0209673_1002712 3300025273 Bacteria 11701
112 Ga0209675_1012563 3300025291 Bacteria 2716
113 Ga0209675_1021669 3300025291 Bacteria 1708
114 Ga0209676_1000035 3300025292 Bacteria 459284
115 Ga0209676_1000095 3300025292 Bacteria 245393
116 Ga0209676_1000440 3300025292 Bacteria 71013
117 Ga0209676_1001211 3300025292 Bacteria 27432
118 Ga0209676_1005007 3300025292 Bacteria 7096
119 Ga0209676_1006206 3300025292 Bacteria 5972
120 Ga0209676_1011872 3300025292 Bacteria 3473
121 Ga0209025_1000012 3300025294 Bacteria 924362
122 Ga0209025_1000864 3300025294 Bacteria 47865
123 Ga0209025_1053960 3300025294 Bacteria 1570
124 Ga0209025_1067783 3300025294 Bacteria 1287
125 Ga0209025_1068702 3300025294 Bacteria 1271
126 Ga0209564_1002697 3300025295 Bacteria 13413
127 Ga0209758_1000018 3300025297 Bacteria 753320
128 Ga0209758_1035593 3300025297 Bacteria 1959
129 Ga0209758_1051744 3300025297 Bacteria 1427
130 Ga0209050_1000698 3300025298 Bacteria 49870
131 Ga0209050_1001329 3300025298 Bacteria 27531
132 Ga0209050_1001731 3300025298 Bacteria 21722
133 Ga0209256_1001712 3300025299 Bacteria 21067
134 Ga0209256_1001832 3300025299 Bacteria 19843
135 Ga0209256_1004823 3300025299 Bacteria 8179
136 Ga0209256_1006363 3300025299 Bacteria 6295
137 Ga0209051_1009633 3300025303 Bacteria 4959
138 Ga0209051_1013023 3300025303 Bacteria 3980
139 Ga0209257_1000153 3300025304 Bacteria 189177
140 Ga0209257_1000452 3300025304 Bacteria 77144
141 Ga0209257_1001029 3300025304 Bacteria 37450
142 Ga0209257_1001064 3300025304 Bacteria 36288
143 Ga0209257_1002121 3300025304 Bacteria 20717
144 Ga0207642_10037299 3300025899 Bacteria 2093
145 Ga0207688_10022337 3300025901 Bacteria 3462
146 Ga0207688_10152206 3300025901 Bacteria 1367
147 Ga0207647_10015332 3300025904 Bacteria 5258
148 Ga0207643_10014878 3300025908 Bacteria 4232
149 Ga0207643_10065043 3300025908 Bacteria 2088
150 Ga0207662_10028985 3300025918 Bacteria 3204
151 Ga0207657_10050636 3300025919 Bacteria 3614
152 Ga0207652_10553385 3300025921 Bacteria 1034
153 Ga0207659_10025327 3300025926 Bacteria 3985
154 Ga0207687_10007350 3300025927 Bacteria 7263
155 Ga0207687_10054103 3300025927 Bacteria 2807
156 Ga0207690_10012612 3300025932 Bacteria 5060
157 Ga0207690_10075888 3300025932 Bacteria 2332
158 Ga0207690_10095120 3300025932 Bacteria 2116
159 Ga0207686_10087247 3300025934 Bacteria 2052
160 Ga0207670_10158720 3300025936 Bacteria 1686
161 Ga0207669_10155761 3300025937 Bacteria 1607
162 Ga0207669_10398863 3300025937 Bacteria 1077
163 Ga0207704_10022485 3300025938 Bacteria 3379
164 Ga0207704_10093274 3300025938 Bacteria 1984
165 Ga0207691_10034165 3300025940 Bacteria 4730
166 Ga0207711_10067897 3300025941 Bacteria 3087
167 Ga0207711_10419532 3300025941 Bacteria 1245
168 Ga0207661_10039789 3300025944 Bacteria 3692
169 Ga0207712_10021607 3300025961 Bacteria 4226
170 Ga0207712_10430432 3300025961 Bacteria 1115
171 Ga0207668_10167734 3300025972 Bacteria 1719
172 Ga0207677_10583074 3300026023 Bacteria 979
173 Ga0207708_10000645 3300026075 Bacteria 26768
174 Ga0207702_10052086 3300026078 Bacteria 3462
175 Ga0207648_10004064 3300026089 Bacteria 15168
176 Ga0207676_10031921 3300026095 Bacteria 3964
177 Ga0207674_10027411 3300026116 Bacteria 6027
178 Ga0207675_100004892 3300026118 Bacteria 12913
179 Ga0207675_100081253 3300026118 Bacteria 3038
180 Ga0207698_10396840 3300026142 Bacteria 1317
181 Ga0207428_10171617 3300027907 Bacteria 1642
182 Ga0268266_10413590 3300028379 Bacteria 1277
183 Ga0268264_10019309 3300028381 Bacteria 5571
184 Ga0307405_10431646 3300031731 Bacteria 1040
185 Ga0307409_100174663 3300031995 Bacteria 1895
186 Ga0307416_100033901 3300032002 Bacteria 3878
187 Ga0307415_100247499 3300032126 Bacteria 1446
188 Ga0395905_0141166 3300037471 Bacteria 2266
189 Ga0436364_0310149 3300037853 Bacteria 3521
190 Ga0395901_0109652 3300038443 Bacteria 2898
191 Ga0237819_05457 3300038705 Bacteria 1993
192 Ga0451797_1142504 3300041453 Bacteria 1394
193 Ga0451807_0812822 3300041486 Bacteria 2371
194 Ga0451843_1147975 3300041509 Bacteria 824
195 Ga0451853_4035553 3300041512 Bacteria 1093
196 Ga0439445_0073726 3300042004 Bacteria 947
197 Ga0466972_0027795 3300044658 Bacteria 2796
198 Ga0466965_0019233 3300044683 Bacteria 3279
199 Ga0466965_0019917 3300044683 Bacteria 3221
200 Ga0466965_0197818 3300044683 Bacteria 1065
201 Ga0466961_0046142 3300044693 Bacteria 2787
202 Ga0466964_0021349 3300044706 Bacteria 2504
203 Ga0466970_0038348 3300044765 Bacteria 2541
204 Ga0466957_0001303 3300044842 Bacteria 13030
205 Ga0466957_0019167 3300044842 Bacteria 4023
206 Ga0466960_0026292 3300044901 Bacteria 2643
207 Ga0466960_0065563 3300044901 Bacteria 1794
208 Ga0466958_0313920 3300045836 Bacteria 1007
209 Ga0466967_0209347 3300045976 Bacteria 1849
210 Ga0466967_0456548 3300045976 Bacteria 1249
211 Ga0495638_0019331 3300046460 Bacteria 4507
212 Ga0495656_0000695 3300046615 Bacteria 10839
213 Ga0495656_0334680 3300046615 Bacteria 782
214 Ga0495636_0012395 3300047318 Bacteria 3375
215 Ga0496100_0205550 3300048903 Bacteria 1437
216 Ga0496101_0271943 3300048904 Bacteria 1323
217 Ga0496102_0006639 3300048905 Bacteria 9887
218 Ga0496102_0106323 3300048905 Bacteria 2612
219 Ga0496103_0155552 3300048906 Bacteria 1465
220 Ga0496103_0454228 3300048906 Bacteria 822
221 Ga0496105_0326161 3300048908 Bacteria 1230
222 Ga0496107_0243339 3300048910 Bacteria 1339
223 Ga0496108_0017221 3300048911 Bacteria 5911
224 Ga0496108_0096279 3300048911 Bacteria 2521
225 Ga0496109_0010791 3300048912 Bacteria 7822
226 Ga0496109_0715876 3300048912 Bacteria 939
227 Ga0496110_0074563 3300048913 Bacteria 3013
228 Ga0496110_0126946 3300048913 Bacteria 2302
229 Ga0496111_0218688 3300048914 Bacteria 1415
230 Ga0496112_0384299 3300048915 Bacteria 1345
231 Ga0496113_0109965 3300048916 Bacteria 2144
232 Ga0496113_0142070 3300048916 Bacteria 1889
233 Ga0496114_0000370 3300048917 Bacteria 33127
234 Ga0496114_0083887 3300048917 Bacteria 2697
235 Ga0496114_0430116 3300048917 Bacteria 1169
236 Ga0496114_0696118 3300048917 Bacteria 891
237 Ga0496124_0000507 3300048927 Bacteria 66974
238 Ga0496124_0078633 3300048927 Bacteria 2718
239 Ga0496126_0013276 3300048929 Bacteria 8394
240 Ga0501031_0003371 3300049568 Bacteria 10264
241 Ga0501031_0017914 3300049568 Bacteria 4607
242 Ga0501031_0066555 3300049568 Bacteria 2348
243 Ga0501032_0147329 3300049569 Bacteria 1549
244 Ga0501034_0000829 3300049571 Bacteria 45973
245 Ga0501036_0069433 3300049572 Bacteria 2980
246 Ga0501036_0144827 3300049572 Bacteria 2004
247 Ga0501036_0664704 3300049572 Bacteria 862
248 Ga0501038_0055965 3300049574 Bacteria 3388
249 Ga0501038_0077472 3300049574 Bacteria 2807
250 Ga0501038_0306601 3300049574 Bacteria 1245
251 Ga0501039_0014821 3300049575 Bacteria 5962
252 Ga0501039_0018494 3300049575 Bacteria 5350
253 Ga0501039_0354681 3300049575 Bacteria 1152
254 Ga0501040_0310098 3300049576 Bacteria 1128
255 Ga0501041_0037189 3300049577 Bacteria 2949
256 Ga0501041_0192212 3300049577 Bacteria 1279
257 Ga0501042_0138915 3300049578 Bacteria 1751
258 Ga0501042_0199448 3300049578 Bacteria 1443
259 Ga0501042_0229709 3300049578 Bacteria 1338
260 Ga0501043_0003327 3300049579 Bacteria 13249
261 Ga0501043_0675194 3300049579 Bacteria 757
262 Ga0501046_0124152 3300049580 Bacteria 1963
263 Ga0501048_0292975 3300049582 Bacteria 1157
264 Ga0501048_0469159 3300049582 Bacteria 902
265 Ga0501067_0188992 3300049583 Bacteria 1147
266 Ga0501069_0024454 3300049585 Bacteria 3295
267 Ga0501070_0561798 3300049586 Bacteria 913
268 Ga0501071_0014562 3300049587 Bacteria 5380
269 Ga0501071_0150430 3300049587 Bacteria 1736
270 Ga0501072_0494088 3300049588 Bacteria 968
271 Ga0501074_0524237 3300049590 Bacteria 839
272 Ga0501076_0010624 3300049592 Bacteria 6838
273 Ga0501076_0222027 3300049592 Bacteria 1544
274 Ga0501077_0147462 3300049593 Bacteria 1493
275 Ga0501225_0018438 3300049705 Bacteria 1934
276 Ga0501079_0190332 3300049741 Bacteria 1601
277 Ga0501081_0089384 3300049743 Bacteria 2165
278 Ga0501035_0319778 3300049822 Bacteria 1304
279 Ga0501045_0128057 3300049824 Bacteria 1887
280 Ga0501045_0221292 3300049824 Bacteria 1409
281 nmdc:mga00v17_265_c1 3300050491 Bacteria 30890
282 nmdc:mga0yw44_136472_c1 3300050492 Bacteria 1592
283 nmdc:mga0yw44_62831_c1 3300050492 Bacteria 2282
284 nmdc:mga0yw44_88258_c1 3300050492 Bacteria 1955
285 nmdc:mga06z11_94347_c1 3300050494 Bacteria 1630
286 Ga0501084_0341417 3300054114 Bacteria 1265
287 Ga0501082_0613530 3300060353 Bacteria 952
288 Ga0466962_0011953 3300061719 Bacteria 4177

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0384299 Ga0496112_0384299_657_1280 183
2 3300046615 Ga0495656_0000695 Ga0495656_0000695_1834_2526 201
3 3300047318 Ga0495636_0012395 Ga0495636_0012395_826_1518 201
4 3300050494 nmdc:mga06z11_94347_c1 nmdc:mga06z11_94347_c1_62_760 203
5 3300041509 Ga0451843_1147975 Ga0451843_1147975_71_754 204
6 3300049705 Ga0501225_0018438 Ga0501225_0018438_398_1078 204
7 3300025937 Ga0207669_10155761 Ga0207669_101557612 205
8 3300032126 Ga0307415_100247499 Ga0307415_1002474992 205
9 3300049568 Ga0501031_0066555 Ga0501031_0066555_53_769 205
10 3300049572 Ga0501036_0664704 Ga0501036_0664704_30_746 205
11 3300049574 Ga0501038_0306601 Ga0501038_0306601_337_1053 205
12 3300049577 Ga0501041_0192212 Ga0501041_0192212_150_866 205
13 3300049578 Ga0501042_0199448 Ga0501042_0199448_590_1306 205
14 3300049592 Ga0501076_0222027 Ga0501076_0222027_78_794 205
15 3300005355 Ga0070671_100356126 Ga0070671_1003561262 206
16 3300005618 Ga0068864_100064414 Ga0068864_1000644142 206
17 3300005719 Ga0068861_100563715 Ga0068861_1005637152 206
18 3300005841 Ga0068863_100252276 Ga0068863_1002522762 206
19 3300006038 Ga0075365_10014816 Ga0075365_100148165 206
20 3300009177 Ga0105248_10138773 Ga0105248_101387733 206
21 3300012512 Ga0157327_1002500 Ga0157327_10025001 206
22 3300013307 Ga0157372_10607106 Ga0157372_106071061 206
23 3300031731 Ga0307405_10431646 Ga0307405_104316462 206
24 3300031995 Ga0307409_100174663 Ga0307409_1001746632 206
25 3300046460 Ga0495638_0019331 Ga0495638_0019331_1455_2117 206
26 3300046615 Ga0495656_0334680 Ga0495656_0334680_102_764 206
27 3300048906 Ga0496103_0454228 Ga0496103_0454228_81_773 206
28 3300048916 Ga0496113_0142070 Ga0496113_0142070_140_832 206
29 3300048917 Ga0496114_0430116 Ga0496114_0430116_202_894 206
30 iso_pu_bacteria 2811994874 2812333907 208
31 3300045976 Ga0466967_0456548 Ga0466967_0456548_466_1134 209
32 3300002773 JGI25152J39213_1000030 JGI25152J39213_100003072 210
33 3300002774 JGI25150J39212_1000790 JGI25150J39212_10007904 210
34 3300003187 JGI25151J46595_10000068 JGI25151J46595_1000006838 210
35 3300003215 JGI25153J46596_10000051 JGI25153J46596_1000005138 210
36 3300025245 Ga0207425_1000011 Ga0207425_1000011219 210
37 3300025258 Ga0209129_1000031 Ga0209129_100003133 210
38 3300025294 Ga0209025_1000012 Ga0209025_1000012532 210
39 3300025297 Ga0209758_1000018 Ga0209758_1000018125 210
40 3300038443 Ga0395901_0109652 Ga0395901_0109652_2009_2671 212
41 3300021388 Ga0213875_10033961 Ga0213875_100339612 213
42 3300037471 Ga0395905_0141166 Ga0395905_0141166_1508_2170 213
43 3300037853 Ga0436364_0310149 Ga0436364_0310149_2115_2807 213
44 3300044658 Ga0466972_0027795 Ga0466972_0027795_1118_1783 213
45 3300044683 Ga0466965_0019917 Ga0466965_0019917_212_877 213
46 3300044693 Ga0466961_0046142 Ga0466961_0046142_1224_1889 213
47 3300044706 Ga0466964_0021349 Ga0466964_0021349_175_840 213
48 3300044765 Ga0466970_0038348 Ga0466970_0038348_1370_2035 213
49 3300044842 Ga0466957_0019167 Ga0466957_0019167_330_995 213
50 3300045836 Ga0466958_0313920 Ga0466958_0313920_181_846 213
51 3300045976 Ga0466967_0209347 Ga0466967_0209347_793_1458 213
52 3300049568 Ga0501031_0003371 Ga0501031_0003371_8409_9059 213
53 3300049572 Ga0501036_0069433 Ga0501036_0069433_1062_1712 213
54 3300049574 Ga0501038_0055965 Ga0501038_0055965_1382_2032 213
55 3300049575 Ga0501039_0018494 Ga0501039_0018494_4203_4853 213
56 3300049575 Ga0501039_0354681 Ga0501039_0354681_123_839 213
57 3300049576 Ga0501040_0310098 Ga0501040_0310098_444_1094 213
58 3300049577 Ga0501041_0037189 Ga0501041_0037189_2049_2699 213
59 3300049578 Ga0501042_0138915 Ga0501042_0138915_412_1062 213
60 3300049580 Ga0501046_0124152 Ga0501046_0124152_494_1144 213
61 3300049582 Ga0501048_0292975 Ga0501048_0292975_92_742 213
62 3300049586 Ga0501070_0561798 Ga0501070_0561798_166_816 213
63 3300049587 Ga0501071_0014562 Ga0501071_0014562_4112_4762 213
64 3300049592 Ga0501076_0010624 Ga0501076_0010624_2266_2916 213
65 3300049593 Ga0501077_0147462 Ga0501077_0147462_728_1378 213
66 3300049741 Ga0501079_0190332 Ga0501079_0190332_594_1244 213
67 3300049743 Ga0501081_0089384 Ga0501081_0089384_590_1240 213
68 3300049822 Ga0501035_0319778 Ga0501035_0319778_69_719 213
69 3300049824 Ga0501045_0221292 Ga0501045_0221292_412_1062 213
70 3300054114 Ga0501084_0341417 Ga0501084_0341417_80_730 213
71 3300061719 Ga0466962_0011953 Ga0466962_0011953_3500_4165 213
72 3300009993 Ga0105028_106791 Ga0105028_1067911 214
73 3300025932 Ga0207690_10075888 Ga0207690_100758882 214
74 3300044683 Ga0466965_0019233 Ga0466965_0019233_1303_1995 214
75 iso_pu_bacteria 2643221581 2643914200 214
76 iso_pu_bacteria 2738541305 2738871653 214
77 3300003791 Ga0055530_10000746 Ga0055530_1000074613 215
78 3300005985 Ga0081539_10118241 Ga0081539_101182412 215
79 3300025298 Ga0209050_1001329 Ga0209050_100132913 215
80 3300044683 Ga0466965_0197818 Ga0466965_0197818_139_822 215
81 3300044842 Ga0466957_0001303 Ga0466957_0001303_1014_1682 215
82 3300044901 Ga0466960_0065563 Ga0466960_0065563_1028_1711 215
83 3300048927 Ga0496124_0000507 Ga0496124_0000507_50107_50766 215
84 3300048927 Ga0496124_0078633 Ga0496124_0078633_877_1545 215
85 iso_pu_bacteria 2643221579 2643907498 215
86 iso_pu_bacteria 2923516293 2923516658 215
87 3300013307 Ga0157372_10059437 Ga0157372_100594372 216
88 3300050492 nmdc:mga0yw44_62831_c1 nmdc:mga0yw44_62831_c1_1010_1708 216
89 3300003781 Ga0055536_1004942 Ga0055536_10049423 217
90 3300006038 Ga0075365_10584196 Ga0075365_105841961 217
91 3300025292 Ga0209676_1000035 Ga0209676_1000035153 217
92 iso_pu_bacteria 2739367898 2740166695 217
93 3300002075 JGI24738J21930_10018389 JGI24738J21930_100183892 218
94 3300002244 JGI24742J22300_10009696 JGI24742J22300_100096962 218
95 3300005329 Ga0070683_100053418 Ga0070683_1000534184 218
96 3300005337 Ga0070682_100032948 Ga0070682_1000329484 218
97 3300005340 Ga0070689_100075568 Ga0070689_1000755684 218
98 3300005343 Ga0070687_100017119 Ga0070687_1000171194 218
99 3300005345 Ga0070692_10000955 Ga0070692_100009554 218
100 3300005354 Ga0070675_100050606 Ga0070675_1000506063 218
101 3300005364 Ga0070673_100021384 Ga0070673_1000213845 218
102 3300005365 Ga0070688_100022371 Ga0070688_1000223713 218
103 3300005435 Ga0070714_100132811 Ga0070714_1001328112 218
104 3300005438 Ga0070701_10003433 Ga0070701_100034332 218
105 3300005441 Ga0070700_100008183 Ga0070700_1000081832 218
106 3300005456 Ga0070678_100306639 Ga0070678_1003066391 218
107 3300005530 Ga0070679_100519923 Ga0070679_1005199232 218
108 3300005535 Ga0070684_100025980 Ga0070684_1000259804 218
109 3300005543 Ga0070672_100088175 Ga0070672_1000881753 218
110 3300005544 Ga0070686_100023018 Ga0070686_1000230182 218
111 3300005615 Ga0070702_100004270 Ga0070702_1000042704 218
112 3300005718 Ga0068866_10021671 Ga0068866_100216712 218
113 3300005719 Ga0068861_100008136 Ga0068861_1000081365 218
114 3300005834 Ga0068851_10029761 Ga0068851_100297612 218
115 3300005840 Ga0068870_10009074 Ga0068870_100090743 218
116 3300006038 Ga0075365_10035610 Ga0075365_100356103 218
117 3300006881 Ga0068865_100013343 Ga0068865_1000133432 218
118 3300009094 Ga0111539_10033785 Ga0111539_100337853 218
119 3300009101 Ga0105247_10231655 Ga0105247_102316552 218
120 3300009148 Ga0105243_10004085 Ga0105243_100040858 218
121 3300009177 Ga0105248_10009289 Ga0105248_100092896 218
122 3300009551 Ga0105238_10042871 Ga0105238_100428715 218
123 3300009553 Ga0105249_10479075 Ga0105249_104790751 218
124 3300013105 Ga0157369_10347218 Ga0157369_103472182 218
125 3300013307 Ga0157372_10239963 Ga0157372_102399632 218
126 3300014326 Ga0157380_10002258 Ga0157380_1000225812 218
127 3300014745 Ga0157377_10008317 Ga0157377_100083176 218
128 3300025899 Ga0207642_10037299 Ga0207642_100372992 218
129 3300025901 Ga0207688_10152206 Ga0207688_101522061 218
130 3300025908 Ga0207643_10014878 Ga0207643_100148782 218
131 3300025918 Ga0207662_10028985 Ga0207662_100289852 218
132 3300025921 Ga0207652_10553385 Ga0207652_105533852 218
133 3300025926 Ga0207659_10025327 Ga0207659_100253274 218
134 3300025927 Ga0207687_10054103 Ga0207687_100541032 218
135 3300025932 Ga0207690_10095120 Ga0207690_100951203 218
136 3300025936 Ga0207670_10158720 Ga0207670_101587202 218
137 3300025938 Ga0207704_10022485 Ga0207704_100224852 218
138 3300025940 Ga0207691_10034165 Ga0207691_100341654 218
139 3300025941 Ga0207711_10067897 Ga0207711_100678973 218
140 3300025944 Ga0207661_10039789 Ga0207661_100397894 218
141 3300025961 Ga0207712_10430432 Ga0207712_104304322 218
142 3300025972 Ga0207668_10167734 Ga0207668_101677342 218
143 3300026075 Ga0207708_10000645 Ga0207708_100006456 218
144 3300026089 Ga0207648_10004064 Ga0207648_100040644 218
145 3300026118 Ga0207675_100004892 Ga0207675_1000048925 218
146 3300026142 Ga0207698_10396840 Ga0207698_103968402 218
147 3300027907 Ga0207428_10171617 Ga0207428_101716172 218
148 3300041453 Ga0451797_1142504 Ga0451797_1142504_124_789 218
149 3300041486 Ga0451807_0812822 Ga0451807_0812822_361_1026 218
150 3300041512 Ga0451853_4035553 Ga0451853_4035553_379_1059 218
151 3300048903 Ga0496100_0205550 Ga0496100_0205550_60_740 218
152 3300048905 Ga0496102_0106323 Ga0496102_0106323_624_1304 218
153 3300048908 Ga0496105_0326161 Ga0496105_0326161_22_702 218
154 3300048910 Ga0496107_0243339 Ga0496107_0243339_68_748 218
155 3300048911 Ga0496108_0096279 Ga0496108_0096279_434_1114 218
156 3300048913 Ga0496110_0126946 Ga0496110_0126946_899_1579 218
157 3300048917 Ga0496114_0083887 Ga0496114_0083887_1782_2462 218
158 3300049579 Ga0501043_0675194 Ga0501043_0675194_43_738 218
159 3300049582 Ga0501048_0469159 Ga0501048_0469159_177_872 218
160 3300049588 Ga0501072_0494088 Ga0501072_0494088_231_926 218
161 3300049824 Ga0501045_0128057 Ga0501045_0128057_414_1109 218
162 3300050492 nmdc:mga0yw44_136472_c1 nmdc:mga0yw44_136472_c1_348_1028 218
163 3300003187 JGI25151J46595_10039112 JGI25151J46595_100391122 219
164 3300003775 Ga0055524_1006417 Ga0055524_10064172 219
165 3300003775 Ga0055524_1020095 Ga0055524_10200952 219
166 3300003781 Ga0055536_1000140 Ga0055536_10001407 219
167 3300003781 Ga0055536_1002169 Ga0055536_100216910 219
168 3300003781 Ga0055536_1017411 Ga0055536_10174112 219
169 3300003784 Ga0055534_1017797 Ga0055534_10177972 219
170 3300003791 Ga0055530_10000692 Ga0055530_1000069220 219
171 3300003791 Ga0055530_10016588 Ga0055530_100165882 219
172 3300003794 Ga0055531_10001740 Ga0055531_100017404 219
173 3300003794 Ga0055531_10005157 Ga0055531_100051574 219
174 3300003794 Ga0055531_10006036 Ga0055531_100060367 219
175 3300006353 Ga0075370_10436971 Ga0075370_104369711 219
176 3300015261 Ga0182006_1010144 Ga0182006_10101444 219
177 3300025273 Ga0209673_1002712 Ga0209673_10027123 219
178 3300025291 Ga0209675_1012563 Ga0209675_10125632 219
179 3300025291 Ga0209675_1021669 Ga0209675_10216692 219
180 3300025292 Ga0209676_1000095 Ga0209676_100009558 219
181 3300025292 Ga0209676_1000440 Ga0209676_100044011 219
182 3300025292 Ga0209676_1001211 Ga0209676_10012116 219
183 3300025292 Ga0209676_1005007 Ga0209676_10050074 219
184 3300025292 Ga0209676_1006206 Ga0209676_10062063 219
185 3300025292 Ga0209676_1011872 Ga0209676_10118722 219
186 3300025294 Ga0209025_1000864 Ga0209025_100086411 219
187 3300025294 Ga0209025_1053960 Ga0209025_10539602 219
188 3300025294 Ga0209025_1067783 Ga0209025_10677832 219
189 3300025294 Ga0209025_1068702 Ga0209025_10687021 219
190 3300025295 Ga0209564_1002697 Ga0209564_10026972 219
191 3300025297 Ga0209758_1035593 Ga0209758_10355932 219
192 3300025297 Ga0209758_1051744 Ga0209758_10517442 219
193 3300025298 Ga0209050_1000698 Ga0209050_10006988 219
194 3300025298 Ga0209050_1001731 Ga0209050_100173111 219
195 3300025299 Ga0209256_1001712 Ga0209256_100171218 219
196 3300025299 Ga0209256_1001832 Ga0209256_100183212 219
197 3300025299 Ga0209256_1004823 Ga0209256_10048232 219
198 3300025299 Ga0209256_1006363 Ga0209256_10063632 219
199 3300025303 Ga0209051_1009633 Ga0209051_10096336 219
200 3300025303 Ga0209051_1013023 Ga0209051_10130233 219
201 3300025304 Ga0209257_1000153 Ga0209257_1000153105 219
202 3300025304 Ga0209257_1000452 Ga0209257_100045211 219
203 3300025304 Ga0209257_1001029 Ga0209257_100102927 219
204 3300025304 Ga0209257_1001064 Ga0209257_100106411 219
205 3300025304 Ga0209257_1002121 Ga0209257_10021214 219
206 3300032002 Ga0307416_100033901 Ga0307416_1000339012 219
207 3300038705 Ga0237819_05457 Ga0237819_05457_1112_1792 219
208 3300049571 Ga0501034_0000829 Ga0501034_0000829_15699_16379 219
209 3300049579 Ga0501043_0003327 Ga0501043_0003327_3048_3728 219
210 3300005289 Ga0065704_10074584 Ga0065704_100745845 220
211 3300042004 Ga0439445_0073726 Ga0439445_0073726_205_885 220
212 3300044901 Ga0466960_0026292 Ga0466960_0026292_749_1429 220
213 iso_pu_bacteria 2643221641 2644231376 220
214 3300006051 Ga0075364_10000300 Ga0075364_100003004 221
215 3300048917 Ga0496114_0000370 Ga0496114_0000370_15309_15995 221
216 3300048929 Ga0496126_0013276 Ga0496126_0013276_409_1095 221
217 3300049568 Ga0501031_0017914 Ga0501031_0017914_1479_2225 221
218 3300049585 Ga0501069_0024454 Ga0501069_0024454_1769_2455 221
219 3300050491 nmdc:mga00v17_265_c1 nmdc:mga00v17_265_c1_1465_2157 221
220 iso_pu_bacteria 2643221576 2643893231 221
221 iso_pu_bacteria 2643221590 2643961710 221
222 iso_pu_bacteria 8054609563 8054612431 221
223 3300001990 JGI24737J22298_10018802 JGI24737J22298_100188021 222
224 3300005327 Ga0070658_10125742 Ga0070658_101257422 222
225 3300005329 Ga0070683_100022656 Ga0070683_1000226564 222
226 3300005334 Ga0068869_100357779 Ga0068869_1003577792 222
227 3300005337 Ga0070682_100000691 Ga0070682_1000006915 222
228 3300005338 Ga0068868_100617772 Ga0068868_1006177722 222
229 3300005339 Ga0070660_100039735 Ga0070660_1000397353 222
230 3300005340 Ga0070689_100524753 Ga0070689_1005247531 222
231 3300005341 Ga0070691_10113625 Ga0070691_101136252 222
232 3300005356 Ga0070674_100479669 Ga0070674_1004796691 222
233 3300005366 Ga0070659_100020420 Ga0070659_1000204204 222
234 3300005367 Ga0070667_100030979 Ga0070667_1000309794 222
235 3300005535 Ga0070684_100001882 Ga0070684_10000188214 222
236 3300005539 Ga0068853_100043781 Ga0068853_1000437812 222
237 3300005547 Ga0070693_100062506 Ga0070693_1000625062 222
238 3300005548 Ga0070665_100310729 Ga0070665_1003107292 222
239 3300005563 Ga0068855_100170291 Ga0068855_1001702912 222
240 3300005577 Ga0068857_100020175 Ga0068857_1000201754 222
241 3300005615 Ga0070702_100147356 Ga0070702_1001473562 222
242 3300005617 Ga0068859_100567507 Ga0068859_1005675072 222
243 3300005842 Ga0068858_100082450 Ga0068858_1000824502 222
244 3300005843 Ga0068860_100015728 Ga0068860_1000157282 222
245 3300006038 Ga0075365_10113389 Ga0075365_101133892 222
246 3300006881 Ga0068865_100119630 Ga0068865_1001196302 222
247 3300006931 Ga0097620_100567508 Ga0097620_1005675082 222
248 3300009098 Ga0105245_10004104 Ga0105245_1000410412 222
249 3300009148 Ga0105243_10954458 Ga0105243_109544581 222
250 3300009176 Ga0105242_10070502 Ga0105242_100705022 222
251 3300009177 Ga0105248_10028377 Ga0105248_100283776 222
252 3300009553 Ga0105249_10045039 Ga0105249_100450392 222
253 3300011119 Ga0105246_10003031 Ga0105246_100030312 222
254 3300013102 Ga0157371_10321879 Ga0157371_103218792 222
255 3300013105 Ga0157369_10079332 Ga0157369_100793322 222
256 3300013306 Ga0163162_10020305 Ga0163162_100203053 222
257 3300013307 Ga0157372_10007574 Ga0157372_100075747 222
258 3300013307 Ga0157372_10142493 Ga0157372_101424932 222
259 3300014325 Ga0163163_10022224 Ga0163163_100222243 222
260 3300014968 Ga0157379_10007080 Ga0157379_100070802 222
261 3300025901 Ga0207688_10022337 Ga0207688_100223372 222
262 3300025904 Ga0207647_10015332 Ga0207647_100153322 222
263 3300025908 Ga0207643_10065043 Ga0207643_100650432 222
264 3300025919 Ga0207657_10050636 Ga0207657_100506361 222
265 3300025927 Ga0207687_10007350 Ga0207687_100073506 222
266 3300025932 Ga0207690_10012612 Ga0207690_100126122 222
267 3300025934 Ga0207686_10087247 Ga0207686_100872472 222
268 3300025937 Ga0207669_10398863 Ga0207669_103988632 222
269 3300025938 Ga0207704_10093274 Ga0207704_100932742 222
270 3300025941 Ga0207711_10419532 Ga0207711_104195321 222
271 3300025961 Ga0207712_10021607 Ga0207712_100216072 222
272 3300026023 Ga0207677_10583074 Ga0207677_105830742 222
273 3300026078 Ga0207702_10052086 Ga0207702_100520862 222
274 3300026095 Ga0207676_10031921 Ga0207676_100319213 222
275 3300026116 Ga0207674_10027411 Ga0207674_100274113 222
276 3300026118 Ga0207675_100081253 Ga0207675_1000812534 222
277 3300028379 Ga0268266_10413590 Ga0268266_104135902 222
278 3300028381 Ga0268264_10019309 Ga0268264_100193092 222
279 3300048904 Ga0496101_0271943 Ga0496101_0271943_76_744 222
280 3300048905 Ga0496102_0006639 Ga0496102_0006639_6894_7562 222
281 3300048906 Ga0496103_0155552 Ga0496103_0155552_424_1092 222
282 3300048911 Ga0496108_0017221 Ga0496108_0017221_3908_4576 222
283 3300048912 Ga0496109_0010791 Ga0496109_0010791_2326_2994 222
284 3300048912 Ga0496109_0715876 Ga0496109_0715876_12_746 222
285 3300048913 Ga0496110_0074563 Ga0496110_0074563_2031_2699 222
286 3300048914 Ga0496111_0218688 Ga0496111_0218688_269_937 222
287 3300048916 Ga0496113_0109965 Ga0496113_0109965_11_679 222
288 3300048917 Ga0496114_0696118 Ga0496114_0696118_48_776 222
289 3300049569 Ga0501032_0147329 Ga0501032_0147329_456_1205 222
290 3300049572 Ga0501036_0144827 Ga0501036_0144827_1024_1737 222
291 3300049574 Ga0501038_0077472 Ga0501038_0077472_1263_1976 222
292 3300049575 Ga0501039_0014821 Ga0501039_0014821_1286_1999 222
293 3300049578 Ga0501042_0229709 Ga0501042_0229709_449_1162 222
294 3300049583 Ga0501067_0188992 Ga0501067_0188992_187_900 222
295 3300049587 Ga0501071_0150430 Ga0501071_0150430_748_1461 222
296 3300049590 Ga0501074_0524237 Ga0501074_0524237_61_774 222
297 3300050492 nmdc:mga0yw44_88258_c1 nmdc:mga0yw44_88258_c1_1045_1836 222
298 3300060353 Ga0501082_0613530 Ga0501082_0613530_88_801 222
299 iso_pu_bacteria 2855386786 2855387529 222

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lrd-assembly1.cif.gz_B self-assembly of spider silk proteins is controlled by a ph-sensitive relay 0.3845 54 208
3lrd-assembly1.cif.gz_B self-assembly of spider silk proteins is controlled by a ph-sensitive relay 0.3733 54 208
5wuf-assembly1.cif.gz_A structural basis for conductance through tric cation channels 0.3268 29 183
6ysf-assembly1.cif.gz_D structure of the flagellar motab stator complex from clostridium sporogenes 0.3126 71 160
7m1t-assembly1.cif.gz_B crystal structure of an archaeal cnnm, mtcorb, with c-terminal deletion in complex with mg2+-atp 0.3063 25 208
ID Description Score Start End Superfamily
af_Q2G2E2_1_187_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7249 23 212 1.10.1760.20
af_Q2G2E2_1_187_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7218 23 212 1.10.1760.20
af_A0A1D6EFQ3_11_126_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.3491 33 178 1.10.3730.20
af_A0A1D6EFQ3_11_126_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.3425 33 178 1.10.3730.20
af_Q22816_108_427_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.317 28 147 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1H7SNL7-F1-model_v4 Uncharacterized membrane protein YczE 0.996 25 213 GO:0016020
AF-A0A1Q9SNN4-F1-model_v4 Membrane protein YczE 0.9949 24 213 GO:0016020
AF-A0A285E2M7-F1-model_v4 deleted 0.9942 24 208
AF-A0A235G7U8-F1-model_v4 Putative membrane protein YczE 0.9933 25 207 GO:0016020
AF-A0A2C8Z414-F1-model_v4 Uncharacterized membrane protein YczE 0.9925 25 213 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.84 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map