F394683
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 204 | 288 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100356126|Ga0070671_1003561262 |
| Length | 215 |
| Sequence | MNPASSPLGLANLGPLAQLRAGRLPERLVRLLVGLWLYGVSIALLMQSALGGSPWVVFHQGAARHLPLSWIPLRQMPGLGTVANTLLLGPFTDFNLRVLDAPEAWPLRCVYLAGGVVACGLATALYVGAQLGPGPRDGLMTGFARRTGWSIQRVRTGIEIVVLTMGVLLGGTAGVGTLLFALCVGPITQFFMRYLVLRLEAPADGADPRMSAPGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 2 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 3 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 4 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 5 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 6 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 7 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 8 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 9 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 10 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 15 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 16 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 91 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 131 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 138 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 141 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 144 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 145 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 146 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 147 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 148 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 149 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 150 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 151 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 152 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 164 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 167 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 168 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 169 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 172 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 173 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 194 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 199 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 200 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 201 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 204 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.32 |
| Metatranscriptomes | 0 |
| Isolates | 3.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.4 |
| Nodule | 0.33 |
| Rhizoplane | 8.03 |
| Rhizosphere | 64.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10018802 | 3300001990 | Bacteria | 2214 |
| 2 | JGI24738J21930_10018389 | 3300002075 | Bacteria | 1461 |
| 3 | JGI24742J22300_10009696 | 3300002244 | Bacteria | 1590 |
| 4 | JGI25152J39213_1000030 | 3300002773 | Bacteria | 97777 |
| 5 | JGI25150J39212_1000790 | 3300002774 | Bacteria | 10797 |
| 6 | JGI25151J46595_10000068 | 3300003187 | Bacteria | 140039 |
| 7 | JGI25151J46595_10039112 | 3300003187 | Bacteria | 1756 |
| 8 | JGI25153J46596_10000051 | 3300003215 | Bacteria | 140039 |
| 9 | Ga0055524_1006417 | 3300003775 | Bacteria | 5098 |
| 10 | Ga0055524_1020095 | 3300003775 | Bacteria | 2261 |
| 11 | Ga0055536_1000140 | 3300003781 | Bacteria | 62385 |
| 12 | Ga0055536_1002169 | 3300003781 | Bacteria | 11186 |
| 13 | Ga0055536_1004942 | 3300003781 | Bacteria | 6640 |
| 14 | Ga0055536_1017411 | 3300003781 | Bacteria | 2354 |
| 15 | Ga0055534_1017797 | 3300003784 | Bacteria | 1248 |
| 16 | Ga0055530_10000692 | 3300003791 | Bacteria | 28512 |
| 17 | Ga0055530_10000746 | 3300003791 | Bacteria | 26995 |
| 18 | Ga0055530_10016588 | 3300003791 | Bacteria | 2346 |
| 19 | Ga0055531_10001740 | 3300003794 | Bacteria | 15582 |
| 20 | Ga0055531_10005157 | 3300003794 | Bacteria | 7704 |
| 21 | Ga0055531_10006036 | 3300003794 | Bacteria | 6948 |
| 22 | Ga0065704_10074584 | 3300005289 | Bacteria | 6153 |
| 23 | Ga0070658_10125742 | 3300005327 | Bacteria | 2134 |
| 24 | Ga0070683_100022656 | 3300005329 | Bacteria | 5617 |
| 25 | Ga0070683_100053418 | 3300005329 | Bacteria | 3744 |
| 26 | Ga0068869_100357779 | 3300005334 | Bacteria | 1191 |
| 27 | Ga0070682_100000691 | 3300005337 | Bacteria | 20383 |
| 28 | Ga0070682_100032948 | 3300005337 | Bacteria | 3145 |
| 29 | Ga0068868_100617772 | 3300005338 | Bacteria | 962 |
| 30 | Ga0070660_100039735 | 3300005339 | Bacteria | 3577 |
| 31 | Ga0070689_100075568 | 3300005340 | Bacteria | 2638 |
| 32 | Ga0070689_100524753 | 3300005340 | Bacteria | 1017 |
| 33 | Ga0070691_10113625 | 3300005341 | Bacteria | 1357 |
| 34 | Ga0070687_100017119 | 3300005343 | Bacteria | 3325 |
| 35 | Ga0070692_10000955 | 3300005345 | Bacteria | 9835 |
| 36 | Ga0070675_100050606 | 3300005354 | Bacteria | 3412 |
| 37 | Ga0070671_100356126 | 3300005355 | Bacteria | 1249 |
| 38 | Ga0070674_100479669 | 3300005356 | Bacteria | 1032 |
| 39 | Ga0070673_100021384 | 3300005364 | Bacteria | 4689 |
| 40 | Ga0070688_100022371 | 3300005365 | Bacteria | 3704 |
| 41 | Ga0070659_100020420 | 3300005366 | Bacteria | 5031 |
| 42 | Ga0070667_100030979 | 3300005367 | Bacteria | 4460 |
| 43 | Ga0070714_100132811 | 3300005435 | Bacteria | 2226 |
| 44 | Ga0070701_10003433 | 3300005438 | Bacteria | 6267 |
| 45 | Ga0070700_100008183 | 3300005441 | Bacteria | 5692 |
| 46 | Ga0070678_100306639 | 3300005456 | Bacteria | 1351 |
| 47 | Ga0070679_100519923 | 3300005530 | Bacteria | 1134 |
| 48 | Ga0070684_100001882 | 3300005535 | Bacteria | 15377 |
| 49 | Ga0070684_100025980 | 3300005535 | Bacteria | 4928 |
| 50 | Ga0068853_100043781 | 3300005539 | Bacteria | 3830 |
| 51 | Ga0070672_100088175 | 3300005543 | Bacteria | 2498 |
| 52 | Ga0070686_100023018 | 3300005544 | Bacteria | 3719 |
| 53 | Ga0070693_100062506 | 3300005547 | Bacteria | 2167 |
| 54 | Ga0070665_100310729 | 3300005548 | Bacteria | 1580 |
| 55 | Ga0068855_100170291 | 3300005563 | Bacteria | 2467 |
| 56 | Ga0068857_100020175 | 3300005577 | Bacteria | 5859 |
| 57 | Ga0070702_100004270 | 3300005615 | Bacteria | 6508 |
| 58 | Ga0070702_100147356 | 3300005615 | Bacteria | 1507 |
| 59 | Ga0068859_100567507 | 3300005617 | Bacteria | 1229 |
| 60 | Ga0068864_100064414 | 3300005618 | Bacteria | 3179 |
| 61 | Ga0068866_10021671 | 3300005718 | Bacteria | 2963 |
| 62 | Ga0068861_100008136 | 3300005719 | Bacteria | 7216 |
| 63 | Ga0068861_100563715 | 3300005719 | Bacteria | 1040 |
| 64 | Ga0068851_10029761 | 3300005834 | Bacteria | 2705 |
| 65 | Ga0068870_10009074 | 3300005840 | Bacteria | 4504 |
| 66 | Ga0068863_100252276 | 3300005841 | Bacteria | 1704 |
| 67 | Ga0068858_100082450 | 3300005842 | Bacteria | 2989 |
| 68 | Ga0068860_100015728 | 3300005843 | Bacteria | 7388 |
| 69 | Ga0081539_10118241 | 3300005985 | Bacteria | 1321 |
| 70 | Ga0075365_10014816 | 3300006038 | Bacteria | 4698 |
| 71 | Ga0075365_10035610 | 3300006038 | Bacteria | 3221 |
| 72 | Ga0075365_10113389 | 3300006038 | Bacteria | 1865 |
| 73 | Ga0075365_10584196 | 3300006038 | Bacteria | 790 |
| 74 | Ga0075364_10000300 | 3300006051 | Bacteria | 24079 |
| 75 | Ga0075370_10436971 | 3300006353 | Bacteria | 787 |
| 76 | Ga0068865_100013343 | 3300006881 | Bacteria | 5191 |
| 77 | Ga0068865_100119630 | 3300006881 | Bacteria | 1956 |
| 78 | Ga0097620_100567508 | 3300006931 | Bacteria | 1229 |
| 79 | Ga0111539_10033785 | 3300009094 | Bacteria | 6208 |
| 80 | Ga0105245_10004104 | 3300009098 | Bacteria | 12931 |
| 81 | Ga0105247_10231655 | 3300009101 | Bacteria | 1255 |
| 82 | Ga0105243_10004085 | 3300009148 | Bacteria | 11622 |
| 83 | Ga0105243_10954458 | 3300009148 | Bacteria | 857 |
| 84 | Ga0105242_10070502 | 3300009176 | Bacteria | 2898 |
| 85 | Ga0105248_10009289 | 3300009177 | Bacteria | 10827 |
| 86 | Ga0105248_10028377 | 3300009177 | Bacteria | 6235 |
| 87 | Ga0105248_10138773 | 3300009177 | Bacteria | 2742 |
| 88 | Ga0105238_10042871 | 3300009551 | Bacteria | 4580 |
| 89 | Ga0105249_10045039 | 3300009553 | Bacteria | 4012 |
| 90 | Ga0105249_10479075 | 3300009553 | Bacteria | 1287 |
| 91 | Ga0105028_106791 | 3300009993 | Bacteria | 1196 |
| 92 | Ga0105246_10003031 | 3300011119 | Bacteria | 10191 |
| 93 | Ga0157327_1002500 | 3300012512 | Bacteria | 1274 |
| 94 | Ga0157371_10321879 | 3300013102 | Bacteria | 1122 |
| 95 | Ga0157369_10079332 | 3300013105 | Bacteria | 3516 |
| 96 | Ga0157369_10347218 | 3300013105 | Bacteria | 1541 |
| 97 | Ga0163162_10020305 | 3300013306 | Bacteria | 6525 |
| 98 | Ga0157372_10007574 | 3300013307 | Bacteria | 11545 |
| 99 | Ga0157372_10059437 | 3300013307 | Bacteria | 4275 |
| 100 | Ga0157372_10142493 | 3300013307 | Bacteria | 2763 |
| 101 | Ga0157372_10239963 | 3300013307 | Bacteria | 2103 |
| 102 | Ga0157372_10607106 | 3300013307 | Bacteria | 1275 |
| 103 | Ga0163163_10022224 | 3300014325 | Bacteria | 6001 |
| 104 | Ga0157380_10002258 | 3300014326 | Bacteria | 12956 |
| 105 | Ga0157377_10008317 | 3300014745 | Bacteria | 5056 |
| 106 | Ga0157379_10007080 | 3300014968 | Bacteria | 9695 |
| 107 | Ga0182006_1010144 | 3300015261 | Bacteria | 4198 |
| 108 | Ga0213875_10033961 | 3300021388 | Bacteria | 2410 |
| 109 | Ga0207425_1000011 | 3300025245 | Bacteria | 550735 |
| 110 | Ga0209129_1000031 | 3300025258 | Bacteria | 383039 |
| 111 | Ga0209673_1002712 | 3300025273 | Bacteria | 11701 |
| 112 | Ga0209675_1012563 | 3300025291 | Bacteria | 2716 |
| 113 | Ga0209675_1021669 | 3300025291 | Bacteria | 1708 |
| 114 | Ga0209676_1000035 | 3300025292 | Bacteria | 459284 |
| 115 | Ga0209676_1000095 | 3300025292 | Bacteria | 245393 |
| 116 | Ga0209676_1000440 | 3300025292 | Bacteria | 71013 |
| 117 | Ga0209676_1001211 | 3300025292 | Bacteria | 27432 |
| 118 | Ga0209676_1005007 | 3300025292 | Bacteria | 7096 |
| 119 | Ga0209676_1006206 | 3300025292 | Bacteria | 5972 |
| 120 | Ga0209676_1011872 | 3300025292 | Bacteria | 3473 |
| 121 | Ga0209025_1000012 | 3300025294 | Bacteria | 924362 |
| 122 | Ga0209025_1000864 | 3300025294 | Bacteria | 47865 |
| 123 | Ga0209025_1053960 | 3300025294 | Bacteria | 1570 |
| 124 | Ga0209025_1067783 | 3300025294 | Bacteria | 1287 |
| 125 | Ga0209025_1068702 | 3300025294 | Bacteria | 1271 |
| 126 | Ga0209564_1002697 | 3300025295 | Bacteria | 13413 |
| 127 | Ga0209758_1000018 | 3300025297 | Bacteria | 753320 |
| 128 | Ga0209758_1035593 | 3300025297 | Bacteria | 1959 |
| 129 | Ga0209758_1051744 | 3300025297 | Bacteria | 1427 |
| 130 | Ga0209050_1000698 | 3300025298 | Bacteria | 49870 |
| 131 | Ga0209050_1001329 | 3300025298 | Bacteria | 27531 |
| 132 | Ga0209050_1001731 | 3300025298 | Bacteria | 21722 |
| 133 | Ga0209256_1001712 | 3300025299 | Bacteria | 21067 |
| 134 | Ga0209256_1001832 | 3300025299 | Bacteria | 19843 |
| 135 | Ga0209256_1004823 | 3300025299 | Bacteria | 8179 |
| 136 | Ga0209256_1006363 | 3300025299 | Bacteria | 6295 |
| 137 | Ga0209051_1009633 | 3300025303 | Bacteria | 4959 |
| 138 | Ga0209051_1013023 | 3300025303 | Bacteria | 3980 |
| 139 | Ga0209257_1000153 | 3300025304 | Bacteria | 189177 |
| 140 | Ga0209257_1000452 | 3300025304 | Bacteria | 77144 |
| 141 | Ga0209257_1001029 | 3300025304 | Bacteria | 37450 |
| 142 | Ga0209257_1001064 | 3300025304 | Bacteria | 36288 |
| 143 | Ga0209257_1002121 | 3300025304 | Bacteria | 20717 |
| 144 | Ga0207642_10037299 | 3300025899 | Bacteria | 2093 |
| 145 | Ga0207688_10022337 | 3300025901 | Bacteria | 3462 |
| 146 | Ga0207688_10152206 | 3300025901 | Bacteria | 1367 |
| 147 | Ga0207647_10015332 | 3300025904 | Bacteria | 5258 |
| 148 | Ga0207643_10014878 | 3300025908 | Bacteria | 4232 |
| 149 | Ga0207643_10065043 | 3300025908 | Bacteria | 2088 |
| 150 | Ga0207662_10028985 | 3300025918 | Bacteria | 3204 |
| 151 | Ga0207657_10050636 | 3300025919 | Bacteria | 3614 |
| 152 | Ga0207652_10553385 | 3300025921 | Bacteria | 1034 |
| 153 | Ga0207659_10025327 | 3300025926 | Bacteria | 3985 |
| 154 | Ga0207687_10007350 | 3300025927 | Bacteria | 7263 |
| 155 | Ga0207687_10054103 | 3300025927 | Bacteria | 2807 |
| 156 | Ga0207690_10012612 | 3300025932 | Bacteria | 5060 |
| 157 | Ga0207690_10075888 | 3300025932 | Bacteria | 2332 |
| 158 | Ga0207690_10095120 | 3300025932 | Bacteria | 2116 |
| 159 | Ga0207686_10087247 | 3300025934 | Bacteria | 2052 |
| 160 | Ga0207670_10158720 | 3300025936 | Bacteria | 1686 |
| 161 | Ga0207669_10155761 | 3300025937 | Bacteria | 1607 |
| 162 | Ga0207669_10398863 | 3300025937 | Bacteria | 1077 |
| 163 | Ga0207704_10022485 | 3300025938 | Bacteria | 3379 |
| 164 | Ga0207704_10093274 | 3300025938 | Bacteria | 1984 |
| 165 | Ga0207691_10034165 | 3300025940 | Bacteria | 4730 |
| 166 | Ga0207711_10067897 | 3300025941 | Bacteria | 3087 |
| 167 | Ga0207711_10419532 | 3300025941 | Bacteria | 1245 |
| 168 | Ga0207661_10039789 | 3300025944 | Bacteria | 3692 |
| 169 | Ga0207712_10021607 | 3300025961 | Bacteria | 4226 |
| 170 | Ga0207712_10430432 | 3300025961 | Bacteria | 1115 |
| 171 | Ga0207668_10167734 | 3300025972 | Bacteria | 1719 |
| 172 | Ga0207677_10583074 | 3300026023 | Bacteria | 979 |
| 173 | Ga0207708_10000645 | 3300026075 | Bacteria | 26768 |
| 174 | Ga0207702_10052086 | 3300026078 | Bacteria | 3462 |
| 175 | Ga0207648_10004064 | 3300026089 | Bacteria | 15168 |
| 176 | Ga0207676_10031921 | 3300026095 | Bacteria | 3964 |
| 177 | Ga0207674_10027411 | 3300026116 | Bacteria | 6027 |
| 178 | Ga0207675_100004892 | 3300026118 | Bacteria | 12913 |
| 179 | Ga0207675_100081253 | 3300026118 | Bacteria | 3038 |
| 180 | Ga0207698_10396840 | 3300026142 | Bacteria | 1317 |
| 181 | Ga0207428_10171617 | 3300027907 | Bacteria | 1642 |
| 182 | Ga0268266_10413590 | 3300028379 | Bacteria | 1277 |
| 183 | Ga0268264_10019309 | 3300028381 | Bacteria | 5571 |
| 184 | Ga0307405_10431646 | 3300031731 | Bacteria | 1040 |
| 185 | Ga0307409_100174663 | 3300031995 | Bacteria | 1895 |
| 186 | Ga0307416_100033901 | 3300032002 | Bacteria | 3878 |
| 187 | Ga0307415_100247499 | 3300032126 | Bacteria | 1446 |
| 188 | Ga0395905_0141166 | 3300037471 | Bacteria | 2266 |
| 189 | Ga0436364_0310149 | 3300037853 | Bacteria | 3521 |
| 190 | Ga0395901_0109652 | 3300038443 | Bacteria | 2898 |
| 191 | Ga0237819_05457 | 3300038705 | Bacteria | 1993 |
| 192 | Ga0451797_1142504 | 3300041453 | Bacteria | 1394 |
| 193 | Ga0451807_0812822 | 3300041486 | Bacteria | 2371 |
| 194 | Ga0451843_1147975 | 3300041509 | Bacteria | 824 |
| 195 | Ga0451853_4035553 | 3300041512 | Bacteria | 1093 |
| 196 | Ga0439445_0073726 | 3300042004 | Bacteria | 947 |
| 197 | Ga0466972_0027795 | 3300044658 | Bacteria | 2796 |
| 198 | Ga0466965_0019233 | 3300044683 | Bacteria | 3279 |
| 199 | Ga0466965_0019917 | 3300044683 | Bacteria | 3221 |
| 200 | Ga0466965_0197818 | 3300044683 | Bacteria | 1065 |
| 201 | Ga0466961_0046142 | 3300044693 | Bacteria | 2787 |
| 202 | Ga0466964_0021349 | 3300044706 | Bacteria | 2504 |
| 203 | Ga0466970_0038348 | 3300044765 | Bacteria | 2541 |
| 204 | Ga0466957_0001303 | 3300044842 | Bacteria | 13030 |
| 205 | Ga0466957_0019167 | 3300044842 | Bacteria | 4023 |
| 206 | Ga0466960_0026292 | 3300044901 | Bacteria | 2643 |
| 207 | Ga0466960_0065563 | 3300044901 | Bacteria | 1794 |
| 208 | Ga0466958_0313920 | 3300045836 | Bacteria | 1007 |
| 209 | Ga0466967_0209347 | 3300045976 | Bacteria | 1849 |
| 210 | Ga0466967_0456548 | 3300045976 | Bacteria | 1249 |
| 211 | Ga0495638_0019331 | 3300046460 | Bacteria | 4507 |
| 212 | Ga0495656_0000695 | 3300046615 | Bacteria | 10839 |
| 213 | Ga0495656_0334680 | 3300046615 | Bacteria | 782 |
| 214 | Ga0495636_0012395 | 3300047318 | Bacteria | 3375 |
| 215 | Ga0496100_0205550 | 3300048903 | Bacteria | 1437 |
| 216 | Ga0496101_0271943 | 3300048904 | Bacteria | 1323 |
| 217 | Ga0496102_0006639 | 3300048905 | Bacteria | 9887 |
| 218 | Ga0496102_0106323 | 3300048905 | Bacteria | 2612 |
| 219 | Ga0496103_0155552 | 3300048906 | Bacteria | 1465 |
| 220 | Ga0496103_0454228 | 3300048906 | Bacteria | 822 |
| 221 | Ga0496105_0326161 | 3300048908 | Bacteria | 1230 |
| 222 | Ga0496107_0243339 | 3300048910 | Bacteria | 1339 |
| 223 | Ga0496108_0017221 | 3300048911 | Bacteria | 5911 |
| 224 | Ga0496108_0096279 | 3300048911 | Bacteria | 2521 |
| 225 | Ga0496109_0010791 | 3300048912 | Bacteria | 7822 |
| 226 | Ga0496109_0715876 | 3300048912 | Bacteria | 939 |
| 227 | Ga0496110_0074563 | 3300048913 | Bacteria | 3013 |
| 228 | Ga0496110_0126946 | 3300048913 | Bacteria | 2302 |
| 229 | Ga0496111_0218688 | 3300048914 | Bacteria | 1415 |
| 230 | Ga0496112_0384299 | 3300048915 | Bacteria | 1345 |
| 231 | Ga0496113_0109965 | 3300048916 | Bacteria | 2144 |
| 232 | Ga0496113_0142070 | 3300048916 | Bacteria | 1889 |
| 233 | Ga0496114_0000370 | 3300048917 | Bacteria | 33127 |
| 234 | Ga0496114_0083887 | 3300048917 | Bacteria | 2697 |
| 235 | Ga0496114_0430116 | 3300048917 | Bacteria | 1169 |
| 236 | Ga0496114_0696118 | 3300048917 | Bacteria | 891 |
| 237 | Ga0496124_0000507 | 3300048927 | Bacteria | 66974 |
| 238 | Ga0496124_0078633 | 3300048927 | Bacteria | 2718 |
| 239 | Ga0496126_0013276 | 3300048929 | Bacteria | 8394 |
| 240 | Ga0501031_0003371 | 3300049568 | Bacteria | 10264 |
| 241 | Ga0501031_0017914 | 3300049568 | Bacteria | 4607 |
| 242 | Ga0501031_0066555 | 3300049568 | Bacteria | 2348 |
| 243 | Ga0501032_0147329 | 3300049569 | Bacteria | 1549 |
| 244 | Ga0501034_0000829 | 3300049571 | Bacteria | 45973 |
| 245 | Ga0501036_0069433 | 3300049572 | Bacteria | 2980 |
| 246 | Ga0501036_0144827 | 3300049572 | Bacteria | 2004 |
| 247 | Ga0501036_0664704 | 3300049572 | Bacteria | 862 |
| 248 | Ga0501038_0055965 | 3300049574 | Bacteria | 3388 |
| 249 | Ga0501038_0077472 | 3300049574 | Bacteria | 2807 |
| 250 | Ga0501038_0306601 | 3300049574 | Bacteria | 1245 |
| 251 | Ga0501039_0014821 | 3300049575 | Bacteria | 5962 |
| 252 | Ga0501039_0018494 | 3300049575 | Bacteria | 5350 |
| 253 | Ga0501039_0354681 | 3300049575 | Bacteria | 1152 |
| 254 | Ga0501040_0310098 | 3300049576 | Bacteria | 1128 |
| 255 | Ga0501041_0037189 | 3300049577 | Bacteria | 2949 |
| 256 | Ga0501041_0192212 | 3300049577 | Bacteria | 1279 |
| 257 | Ga0501042_0138915 | 3300049578 | Bacteria | 1751 |
| 258 | Ga0501042_0199448 | 3300049578 | Bacteria | 1443 |
| 259 | Ga0501042_0229709 | 3300049578 | Bacteria | 1338 |
| 260 | Ga0501043_0003327 | 3300049579 | Bacteria | 13249 |
| 261 | Ga0501043_0675194 | 3300049579 | Bacteria | 757 |
| 262 | Ga0501046_0124152 | 3300049580 | Bacteria | 1963 |
| 263 | Ga0501048_0292975 | 3300049582 | Bacteria | 1157 |
| 264 | Ga0501048_0469159 | 3300049582 | Bacteria | 902 |
| 265 | Ga0501067_0188992 | 3300049583 | Bacteria | 1147 |
| 266 | Ga0501069_0024454 | 3300049585 | Bacteria | 3295 |
| 267 | Ga0501070_0561798 | 3300049586 | Bacteria | 913 |
| 268 | Ga0501071_0014562 | 3300049587 | Bacteria | 5380 |
| 269 | Ga0501071_0150430 | 3300049587 | Bacteria | 1736 |
| 270 | Ga0501072_0494088 | 3300049588 | Bacteria | 968 |
| 271 | Ga0501074_0524237 | 3300049590 | Bacteria | 839 |
| 272 | Ga0501076_0010624 | 3300049592 | Bacteria | 6838 |
| 273 | Ga0501076_0222027 | 3300049592 | Bacteria | 1544 |
| 274 | Ga0501077_0147462 | 3300049593 | Bacteria | 1493 |
| 275 | Ga0501225_0018438 | 3300049705 | Bacteria | 1934 |
| 276 | Ga0501079_0190332 | 3300049741 | Bacteria | 1601 |
| 277 | Ga0501081_0089384 | 3300049743 | Bacteria | 2165 |
| 278 | Ga0501035_0319778 | 3300049822 | Bacteria | 1304 |
| 279 | Ga0501045_0128057 | 3300049824 | Bacteria | 1887 |
| 280 | Ga0501045_0221292 | 3300049824 | Bacteria | 1409 |
| 281 | nmdc:mga00v17_265_c1 | 3300050491 | Bacteria | 30890 |
| 282 | nmdc:mga0yw44_136472_c1 | 3300050492 | Bacteria | 1592 |
| 283 | nmdc:mga0yw44_62831_c1 | 3300050492 | Bacteria | 2282 |
| 284 | nmdc:mga0yw44_88258_c1 | 3300050492 | Bacteria | 1955 |
| 285 | nmdc:mga06z11_94347_c1 | 3300050494 | Bacteria | 1630 |
| 286 | Ga0501084_0341417 | 3300054114 | Bacteria | 1265 |
| 287 | Ga0501082_0613530 | 3300060353 | Bacteria | 952 |
| 288 | Ga0466962_0011953 | 3300061719 | Bacteria | 4177 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048915 | Ga0496112_0384299 | Ga0496112_0384299_657_1280 | 183 |
| 2 | 3300046615 | Ga0495656_0000695 | Ga0495656_0000695_1834_2526 | 201 |
| 3 | 3300047318 | Ga0495636_0012395 | Ga0495636_0012395_826_1518 | 201 |
| 4 | 3300050494 | nmdc:mga06z11_94347_c1 | nmdc:mga06z11_94347_c1_62_760 | 203 |
| 5 | 3300041509 | Ga0451843_1147975 | Ga0451843_1147975_71_754 | 204 |
| 6 | 3300049705 | Ga0501225_0018438 | Ga0501225_0018438_398_1078 | 204 |
| 7 | 3300025937 | Ga0207669_10155761 | Ga0207669_101557612 | 205 |
| 8 | 3300032126 | Ga0307415_100247499 | Ga0307415_1002474992 | 205 |
| 9 | 3300049568 | Ga0501031_0066555 | Ga0501031_0066555_53_769 | 205 |
| 10 | 3300049572 | Ga0501036_0664704 | Ga0501036_0664704_30_746 | 205 |
| 11 | 3300049574 | Ga0501038_0306601 | Ga0501038_0306601_337_1053 | 205 |
| 12 | 3300049577 | Ga0501041_0192212 | Ga0501041_0192212_150_866 | 205 |
| 13 | 3300049578 | Ga0501042_0199448 | Ga0501042_0199448_590_1306 | 205 |
| 14 | 3300049592 | Ga0501076_0222027 | Ga0501076_0222027_78_794 | 205 |
| 15 | 3300005355 | Ga0070671_100356126 | Ga0070671_1003561262 | 206 |
| 16 | 3300005618 | Ga0068864_100064414 | Ga0068864_1000644142 | 206 |
| 17 | 3300005719 | Ga0068861_100563715 | Ga0068861_1005637152 | 206 |
| 18 | 3300005841 | Ga0068863_100252276 | Ga0068863_1002522762 | 206 |
| 19 | 3300006038 | Ga0075365_10014816 | Ga0075365_100148165 | 206 |
| 20 | 3300009177 | Ga0105248_10138773 | Ga0105248_101387733 | 206 |
| 21 | 3300012512 | Ga0157327_1002500 | Ga0157327_10025001 | 206 |
| 22 | 3300013307 | Ga0157372_10607106 | Ga0157372_106071061 | 206 |
| 23 | 3300031731 | Ga0307405_10431646 | Ga0307405_104316462 | 206 |
| 24 | 3300031995 | Ga0307409_100174663 | Ga0307409_1001746632 | 206 |
| 25 | 3300046460 | Ga0495638_0019331 | Ga0495638_0019331_1455_2117 | 206 |
| 26 | 3300046615 | Ga0495656_0334680 | Ga0495656_0334680_102_764 | 206 |
| 27 | 3300048906 | Ga0496103_0454228 | Ga0496103_0454228_81_773 | 206 |
| 28 | 3300048916 | Ga0496113_0142070 | Ga0496113_0142070_140_832 | 206 |
| 29 | 3300048917 | Ga0496114_0430116 | Ga0496114_0430116_202_894 | 206 |
| 30 | iso_pu_bacteria | 2811994874 | 2812333907 | 208 |
| 31 | 3300045976 | Ga0466967_0456548 | Ga0466967_0456548_466_1134 | 209 |
| 32 | 3300002773 | JGI25152J39213_1000030 | JGI25152J39213_100003072 | 210 |
| 33 | 3300002774 | JGI25150J39212_1000790 | JGI25150J39212_10007904 | 210 |
| 34 | 3300003187 | JGI25151J46595_10000068 | JGI25151J46595_1000006838 | 210 |
| 35 | 3300003215 | JGI25153J46596_10000051 | JGI25153J46596_1000005138 | 210 |
| 36 | 3300025245 | Ga0207425_1000011 | Ga0207425_1000011219 | 210 |
| 37 | 3300025258 | Ga0209129_1000031 | Ga0209129_100003133 | 210 |
| 38 | 3300025294 | Ga0209025_1000012 | Ga0209025_1000012532 | 210 |
| 39 | 3300025297 | Ga0209758_1000018 | Ga0209758_1000018125 | 210 |
| 40 | 3300038443 | Ga0395901_0109652 | Ga0395901_0109652_2009_2671 | 212 |
| 41 | 3300021388 | Ga0213875_10033961 | Ga0213875_100339612 | 213 |
| 42 | 3300037471 | Ga0395905_0141166 | Ga0395905_0141166_1508_2170 | 213 |
| 43 | 3300037853 | Ga0436364_0310149 | Ga0436364_0310149_2115_2807 | 213 |
| 44 | 3300044658 | Ga0466972_0027795 | Ga0466972_0027795_1118_1783 | 213 |
| 45 | 3300044683 | Ga0466965_0019917 | Ga0466965_0019917_212_877 | 213 |
| 46 | 3300044693 | Ga0466961_0046142 | Ga0466961_0046142_1224_1889 | 213 |
| 47 | 3300044706 | Ga0466964_0021349 | Ga0466964_0021349_175_840 | 213 |
| 48 | 3300044765 | Ga0466970_0038348 | Ga0466970_0038348_1370_2035 | 213 |
| 49 | 3300044842 | Ga0466957_0019167 | Ga0466957_0019167_330_995 | 213 |
| 50 | 3300045836 | Ga0466958_0313920 | Ga0466958_0313920_181_846 | 213 |
| 51 | 3300045976 | Ga0466967_0209347 | Ga0466967_0209347_793_1458 | 213 |
| 52 | 3300049568 | Ga0501031_0003371 | Ga0501031_0003371_8409_9059 | 213 |
| 53 | 3300049572 | Ga0501036_0069433 | Ga0501036_0069433_1062_1712 | 213 |
| 54 | 3300049574 | Ga0501038_0055965 | Ga0501038_0055965_1382_2032 | 213 |
| 55 | 3300049575 | Ga0501039_0018494 | Ga0501039_0018494_4203_4853 | 213 |
| 56 | 3300049575 | Ga0501039_0354681 | Ga0501039_0354681_123_839 | 213 |
| 57 | 3300049576 | Ga0501040_0310098 | Ga0501040_0310098_444_1094 | 213 |
| 58 | 3300049577 | Ga0501041_0037189 | Ga0501041_0037189_2049_2699 | 213 |
| 59 | 3300049578 | Ga0501042_0138915 | Ga0501042_0138915_412_1062 | 213 |
| 60 | 3300049580 | Ga0501046_0124152 | Ga0501046_0124152_494_1144 | 213 |
| 61 | 3300049582 | Ga0501048_0292975 | Ga0501048_0292975_92_742 | 213 |
| 62 | 3300049586 | Ga0501070_0561798 | Ga0501070_0561798_166_816 | 213 |
| 63 | 3300049587 | Ga0501071_0014562 | Ga0501071_0014562_4112_4762 | 213 |
| 64 | 3300049592 | Ga0501076_0010624 | Ga0501076_0010624_2266_2916 | 213 |
| 65 | 3300049593 | Ga0501077_0147462 | Ga0501077_0147462_728_1378 | 213 |
| 66 | 3300049741 | Ga0501079_0190332 | Ga0501079_0190332_594_1244 | 213 |
| 67 | 3300049743 | Ga0501081_0089384 | Ga0501081_0089384_590_1240 | 213 |
| 68 | 3300049822 | Ga0501035_0319778 | Ga0501035_0319778_69_719 | 213 |
| 69 | 3300049824 | Ga0501045_0221292 | Ga0501045_0221292_412_1062 | 213 |
| 70 | 3300054114 | Ga0501084_0341417 | Ga0501084_0341417_80_730 | 213 |
| 71 | 3300061719 | Ga0466962_0011953 | Ga0466962_0011953_3500_4165 | 213 |
| 72 | 3300009993 | Ga0105028_106791 | Ga0105028_1067911 | 214 |
| 73 | 3300025932 | Ga0207690_10075888 | Ga0207690_100758882 | 214 |
| 74 | 3300044683 | Ga0466965_0019233 | Ga0466965_0019233_1303_1995 | 214 |
| 75 | iso_pu_bacteria | 2643221581 | 2643914200 | 214 |
| 76 | iso_pu_bacteria | 2738541305 | 2738871653 | 214 |
| 77 | 3300003791 | Ga0055530_10000746 | Ga0055530_1000074613 | 215 |
| 78 | 3300005985 | Ga0081539_10118241 | Ga0081539_101182412 | 215 |
| 79 | 3300025298 | Ga0209050_1001329 | Ga0209050_100132913 | 215 |
| 80 | 3300044683 | Ga0466965_0197818 | Ga0466965_0197818_139_822 | 215 |
| 81 | 3300044842 | Ga0466957_0001303 | Ga0466957_0001303_1014_1682 | 215 |
| 82 | 3300044901 | Ga0466960_0065563 | Ga0466960_0065563_1028_1711 | 215 |
| 83 | 3300048927 | Ga0496124_0000507 | Ga0496124_0000507_50107_50766 | 215 |
| 84 | 3300048927 | Ga0496124_0078633 | Ga0496124_0078633_877_1545 | 215 |
| 85 | iso_pu_bacteria | 2643221579 | 2643907498 | 215 |
| 86 | iso_pu_bacteria | 2923516293 | 2923516658 | 215 |
| 87 | 3300013307 | Ga0157372_10059437 | Ga0157372_100594372 | 216 |
| 88 | 3300050492 | nmdc:mga0yw44_62831_c1 | nmdc:mga0yw44_62831_c1_1010_1708 | 216 |
| 89 | 3300003781 | Ga0055536_1004942 | Ga0055536_10049423 | 217 |
| 90 | 3300006038 | Ga0075365_10584196 | Ga0075365_105841961 | 217 |
| 91 | 3300025292 | Ga0209676_1000035 | Ga0209676_1000035153 | 217 |
| 92 | iso_pu_bacteria | 2739367898 | 2740166695 | 217 |
| 93 | 3300002075 | JGI24738J21930_10018389 | JGI24738J21930_100183892 | 218 |
| 94 | 3300002244 | JGI24742J22300_10009696 | JGI24742J22300_100096962 | 218 |
| 95 | 3300005329 | Ga0070683_100053418 | Ga0070683_1000534184 | 218 |
| 96 | 3300005337 | Ga0070682_100032948 | Ga0070682_1000329484 | 218 |
| 97 | 3300005340 | Ga0070689_100075568 | Ga0070689_1000755684 | 218 |
| 98 | 3300005343 | Ga0070687_100017119 | Ga0070687_1000171194 | 218 |
| 99 | 3300005345 | Ga0070692_10000955 | Ga0070692_100009554 | 218 |
| 100 | 3300005354 | Ga0070675_100050606 | Ga0070675_1000506063 | 218 |
| 101 | 3300005364 | Ga0070673_100021384 | Ga0070673_1000213845 | 218 |
| 102 | 3300005365 | Ga0070688_100022371 | Ga0070688_1000223713 | 218 |
| 103 | 3300005435 | Ga0070714_100132811 | Ga0070714_1001328112 | 218 |
| 104 | 3300005438 | Ga0070701_10003433 | Ga0070701_100034332 | 218 |
| 105 | 3300005441 | Ga0070700_100008183 | Ga0070700_1000081832 | 218 |
| 106 | 3300005456 | Ga0070678_100306639 | Ga0070678_1003066391 | 218 |
| 107 | 3300005530 | Ga0070679_100519923 | Ga0070679_1005199232 | 218 |
| 108 | 3300005535 | Ga0070684_100025980 | Ga0070684_1000259804 | 218 |
| 109 | 3300005543 | Ga0070672_100088175 | Ga0070672_1000881753 | 218 |
| 110 | 3300005544 | Ga0070686_100023018 | Ga0070686_1000230182 | 218 |
| 111 | 3300005615 | Ga0070702_100004270 | Ga0070702_1000042704 | 218 |
| 112 | 3300005718 | Ga0068866_10021671 | Ga0068866_100216712 | 218 |
| 113 | 3300005719 | Ga0068861_100008136 | Ga0068861_1000081365 | 218 |
| 114 | 3300005834 | Ga0068851_10029761 | Ga0068851_100297612 | 218 |
| 115 | 3300005840 | Ga0068870_10009074 | Ga0068870_100090743 | 218 |
| 116 | 3300006038 | Ga0075365_10035610 | Ga0075365_100356103 | 218 |
| 117 | 3300006881 | Ga0068865_100013343 | Ga0068865_1000133432 | 218 |
| 118 | 3300009094 | Ga0111539_10033785 | Ga0111539_100337853 | 218 |
| 119 | 3300009101 | Ga0105247_10231655 | Ga0105247_102316552 | 218 |
| 120 | 3300009148 | Ga0105243_10004085 | Ga0105243_100040858 | 218 |
| 121 | 3300009177 | Ga0105248_10009289 | Ga0105248_100092896 | 218 |
| 122 | 3300009551 | Ga0105238_10042871 | Ga0105238_100428715 | 218 |
| 123 | 3300009553 | Ga0105249_10479075 | Ga0105249_104790751 | 218 |
| 124 | 3300013105 | Ga0157369_10347218 | Ga0157369_103472182 | 218 |
| 125 | 3300013307 | Ga0157372_10239963 | Ga0157372_102399632 | 218 |
| 126 | 3300014326 | Ga0157380_10002258 | Ga0157380_1000225812 | 218 |
| 127 | 3300014745 | Ga0157377_10008317 | Ga0157377_100083176 | 218 |
| 128 | 3300025899 | Ga0207642_10037299 | Ga0207642_100372992 | 218 |
| 129 | 3300025901 | Ga0207688_10152206 | Ga0207688_101522061 | 218 |
| 130 | 3300025908 | Ga0207643_10014878 | Ga0207643_100148782 | 218 |
| 131 | 3300025918 | Ga0207662_10028985 | Ga0207662_100289852 | 218 |
| 132 | 3300025921 | Ga0207652_10553385 | Ga0207652_105533852 | 218 |
| 133 | 3300025926 | Ga0207659_10025327 | Ga0207659_100253274 | 218 |
| 134 | 3300025927 | Ga0207687_10054103 | Ga0207687_100541032 | 218 |
| 135 | 3300025932 | Ga0207690_10095120 | Ga0207690_100951203 | 218 |
| 136 | 3300025936 | Ga0207670_10158720 | Ga0207670_101587202 | 218 |
| 137 | 3300025938 | Ga0207704_10022485 | Ga0207704_100224852 | 218 |
| 138 | 3300025940 | Ga0207691_10034165 | Ga0207691_100341654 | 218 |
| 139 | 3300025941 | Ga0207711_10067897 | Ga0207711_100678973 | 218 |
| 140 | 3300025944 | Ga0207661_10039789 | Ga0207661_100397894 | 218 |
| 141 | 3300025961 | Ga0207712_10430432 | Ga0207712_104304322 | 218 |
| 142 | 3300025972 | Ga0207668_10167734 | Ga0207668_101677342 | 218 |
| 143 | 3300026075 | Ga0207708_10000645 | Ga0207708_100006456 | 218 |
| 144 | 3300026089 | Ga0207648_10004064 | Ga0207648_100040644 | 218 |
| 145 | 3300026118 | Ga0207675_100004892 | Ga0207675_1000048925 | 218 |
| 146 | 3300026142 | Ga0207698_10396840 | Ga0207698_103968402 | 218 |
| 147 | 3300027907 | Ga0207428_10171617 | Ga0207428_101716172 | 218 |
| 148 | 3300041453 | Ga0451797_1142504 | Ga0451797_1142504_124_789 | 218 |
| 149 | 3300041486 | Ga0451807_0812822 | Ga0451807_0812822_361_1026 | 218 |
| 150 | 3300041512 | Ga0451853_4035553 | Ga0451853_4035553_379_1059 | 218 |
| 151 | 3300048903 | Ga0496100_0205550 | Ga0496100_0205550_60_740 | 218 |
| 152 | 3300048905 | Ga0496102_0106323 | Ga0496102_0106323_624_1304 | 218 |
| 153 | 3300048908 | Ga0496105_0326161 | Ga0496105_0326161_22_702 | 218 |
| 154 | 3300048910 | Ga0496107_0243339 | Ga0496107_0243339_68_748 | 218 |
| 155 | 3300048911 | Ga0496108_0096279 | Ga0496108_0096279_434_1114 | 218 |
| 156 | 3300048913 | Ga0496110_0126946 | Ga0496110_0126946_899_1579 | 218 |
| 157 | 3300048917 | Ga0496114_0083887 | Ga0496114_0083887_1782_2462 | 218 |
| 158 | 3300049579 | Ga0501043_0675194 | Ga0501043_0675194_43_738 | 218 |
| 159 | 3300049582 | Ga0501048_0469159 | Ga0501048_0469159_177_872 | 218 |
| 160 | 3300049588 | Ga0501072_0494088 | Ga0501072_0494088_231_926 | 218 |
| 161 | 3300049824 | Ga0501045_0128057 | Ga0501045_0128057_414_1109 | 218 |
| 162 | 3300050492 | nmdc:mga0yw44_136472_c1 | nmdc:mga0yw44_136472_c1_348_1028 | 218 |
| 163 | 3300003187 | JGI25151J46595_10039112 | JGI25151J46595_100391122 | 219 |
| 164 | 3300003775 | Ga0055524_1006417 | Ga0055524_10064172 | 219 |
| 165 | 3300003775 | Ga0055524_1020095 | Ga0055524_10200952 | 219 |
| 166 | 3300003781 | Ga0055536_1000140 | Ga0055536_10001407 | 219 |
| 167 | 3300003781 | Ga0055536_1002169 | Ga0055536_100216910 | 219 |
| 168 | 3300003781 | Ga0055536_1017411 | Ga0055536_10174112 | 219 |
| 169 | 3300003784 | Ga0055534_1017797 | Ga0055534_10177972 | 219 |
| 170 | 3300003791 | Ga0055530_10000692 | Ga0055530_1000069220 | 219 |
| 171 | 3300003791 | Ga0055530_10016588 | Ga0055530_100165882 | 219 |
| 172 | 3300003794 | Ga0055531_10001740 | Ga0055531_100017404 | 219 |
| 173 | 3300003794 | Ga0055531_10005157 | Ga0055531_100051574 | 219 |
| 174 | 3300003794 | Ga0055531_10006036 | Ga0055531_100060367 | 219 |
| 175 | 3300006353 | Ga0075370_10436971 | Ga0075370_104369711 | 219 |
| 176 | 3300015261 | Ga0182006_1010144 | Ga0182006_10101444 | 219 |
| 177 | 3300025273 | Ga0209673_1002712 | Ga0209673_10027123 | 219 |
| 178 | 3300025291 | Ga0209675_1012563 | Ga0209675_10125632 | 219 |
| 179 | 3300025291 | Ga0209675_1021669 | Ga0209675_10216692 | 219 |
| 180 | 3300025292 | Ga0209676_1000095 | Ga0209676_100009558 | 219 |
| 181 | 3300025292 | Ga0209676_1000440 | Ga0209676_100044011 | 219 |
| 182 | 3300025292 | Ga0209676_1001211 | Ga0209676_10012116 | 219 |
| 183 | 3300025292 | Ga0209676_1005007 | Ga0209676_10050074 | 219 |
| 184 | 3300025292 | Ga0209676_1006206 | Ga0209676_10062063 | 219 |
| 185 | 3300025292 | Ga0209676_1011872 | Ga0209676_10118722 | 219 |
| 186 | 3300025294 | Ga0209025_1000864 | Ga0209025_100086411 | 219 |
| 187 | 3300025294 | Ga0209025_1053960 | Ga0209025_10539602 | 219 |
| 188 | 3300025294 | Ga0209025_1067783 | Ga0209025_10677832 | 219 |
| 189 | 3300025294 | Ga0209025_1068702 | Ga0209025_10687021 | 219 |
| 190 | 3300025295 | Ga0209564_1002697 | Ga0209564_10026972 | 219 |
| 191 | 3300025297 | Ga0209758_1035593 | Ga0209758_10355932 | 219 |
| 192 | 3300025297 | Ga0209758_1051744 | Ga0209758_10517442 | 219 |
| 193 | 3300025298 | Ga0209050_1000698 | Ga0209050_10006988 | 219 |
| 194 | 3300025298 | Ga0209050_1001731 | Ga0209050_100173111 | 219 |
| 195 | 3300025299 | Ga0209256_1001712 | Ga0209256_100171218 | 219 |
| 196 | 3300025299 | Ga0209256_1001832 | Ga0209256_100183212 | 219 |
| 197 | 3300025299 | Ga0209256_1004823 | Ga0209256_10048232 | 219 |
| 198 | 3300025299 | Ga0209256_1006363 | Ga0209256_10063632 | 219 |
| 199 | 3300025303 | Ga0209051_1009633 | Ga0209051_10096336 | 219 |
| 200 | 3300025303 | Ga0209051_1013023 | Ga0209051_10130233 | 219 |
| 201 | 3300025304 | Ga0209257_1000153 | Ga0209257_1000153105 | 219 |
| 202 | 3300025304 | Ga0209257_1000452 | Ga0209257_100045211 | 219 |
| 203 | 3300025304 | Ga0209257_1001029 | Ga0209257_100102927 | 219 |
| 204 | 3300025304 | Ga0209257_1001064 | Ga0209257_100106411 | 219 |
| 205 | 3300025304 | Ga0209257_1002121 | Ga0209257_10021214 | 219 |
| 206 | 3300032002 | Ga0307416_100033901 | Ga0307416_1000339012 | 219 |
| 207 | 3300038705 | Ga0237819_05457 | Ga0237819_05457_1112_1792 | 219 |
| 208 | 3300049571 | Ga0501034_0000829 | Ga0501034_0000829_15699_16379 | 219 |
| 209 | 3300049579 | Ga0501043_0003327 | Ga0501043_0003327_3048_3728 | 219 |
| 210 | 3300005289 | Ga0065704_10074584 | Ga0065704_100745845 | 220 |
| 211 | 3300042004 | Ga0439445_0073726 | Ga0439445_0073726_205_885 | 220 |
| 212 | 3300044901 | Ga0466960_0026292 | Ga0466960_0026292_749_1429 | 220 |
| 213 | iso_pu_bacteria | 2643221641 | 2644231376 | 220 |
| 214 | 3300006051 | Ga0075364_10000300 | Ga0075364_100003004 | 221 |
| 215 | 3300048917 | Ga0496114_0000370 | Ga0496114_0000370_15309_15995 | 221 |
| 216 | 3300048929 | Ga0496126_0013276 | Ga0496126_0013276_409_1095 | 221 |
| 217 | 3300049568 | Ga0501031_0017914 | Ga0501031_0017914_1479_2225 | 221 |
| 218 | 3300049585 | Ga0501069_0024454 | Ga0501069_0024454_1769_2455 | 221 |
| 219 | 3300050491 | nmdc:mga00v17_265_c1 | nmdc:mga00v17_265_c1_1465_2157 | 221 |
| 220 | iso_pu_bacteria | 2643221576 | 2643893231 | 221 |
| 221 | iso_pu_bacteria | 2643221590 | 2643961710 | 221 |
| 222 | iso_pu_bacteria | 8054609563 | 8054612431 | 221 |
| 223 | 3300001990 | JGI24737J22298_10018802 | JGI24737J22298_100188021 | 222 |
| 224 | 3300005327 | Ga0070658_10125742 | Ga0070658_101257422 | 222 |
| 225 | 3300005329 | Ga0070683_100022656 | Ga0070683_1000226564 | 222 |
| 226 | 3300005334 | Ga0068869_100357779 | Ga0068869_1003577792 | 222 |
| 227 | 3300005337 | Ga0070682_100000691 | Ga0070682_1000006915 | 222 |
| 228 | 3300005338 | Ga0068868_100617772 | Ga0068868_1006177722 | 222 |
| 229 | 3300005339 | Ga0070660_100039735 | Ga0070660_1000397353 | 222 |
| 230 | 3300005340 | Ga0070689_100524753 | Ga0070689_1005247531 | 222 |
| 231 | 3300005341 | Ga0070691_10113625 | Ga0070691_101136252 | 222 |
| 232 | 3300005356 | Ga0070674_100479669 | Ga0070674_1004796691 | 222 |
| 233 | 3300005366 | Ga0070659_100020420 | Ga0070659_1000204204 | 222 |
| 234 | 3300005367 | Ga0070667_100030979 | Ga0070667_1000309794 | 222 |
| 235 | 3300005535 | Ga0070684_100001882 | Ga0070684_10000188214 | 222 |
| 236 | 3300005539 | Ga0068853_100043781 | Ga0068853_1000437812 | 222 |
| 237 | 3300005547 | Ga0070693_100062506 | Ga0070693_1000625062 | 222 |
| 238 | 3300005548 | Ga0070665_100310729 | Ga0070665_1003107292 | 222 |
| 239 | 3300005563 | Ga0068855_100170291 | Ga0068855_1001702912 | 222 |
| 240 | 3300005577 | Ga0068857_100020175 | Ga0068857_1000201754 | 222 |
| 241 | 3300005615 | Ga0070702_100147356 | Ga0070702_1001473562 | 222 |
| 242 | 3300005617 | Ga0068859_100567507 | Ga0068859_1005675072 | 222 |
| 243 | 3300005842 | Ga0068858_100082450 | Ga0068858_1000824502 | 222 |
| 244 | 3300005843 | Ga0068860_100015728 | Ga0068860_1000157282 | 222 |
| 245 | 3300006038 | Ga0075365_10113389 | Ga0075365_101133892 | 222 |
| 246 | 3300006881 | Ga0068865_100119630 | Ga0068865_1001196302 | 222 |
| 247 | 3300006931 | Ga0097620_100567508 | Ga0097620_1005675082 | 222 |
| 248 | 3300009098 | Ga0105245_10004104 | Ga0105245_1000410412 | 222 |
| 249 | 3300009148 | Ga0105243_10954458 | Ga0105243_109544581 | 222 |
| 250 | 3300009176 | Ga0105242_10070502 | Ga0105242_100705022 | 222 |
| 251 | 3300009177 | Ga0105248_10028377 | Ga0105248_100283776 | 222 |
| 252 | 3300009553 | Ga0105249_10045039 | Ga0105249_100450392 | 222 |
| 253 | 3300011119 | Ga0105246_10003031 | Ga0105246_100030312 | 222 |
| 254 | 3300013102 | Ga0157371_10321879 | Ga0157371_103218792 | 222 |
| 255 | 3300013105 | Ga0157369_10079332 | Ga0157369_100793322 | 222 |
| 256 | 3300013306 | Ga0163162_10020305 | Ga0163162_100203053 | 222 |
| 257 | 3300013307 | Ga0157372_10007574 | Ga0157372_100075747 | 222 |
| 258 | 3300013307 | Ga0157372_10142493 | Ga0157372_101424932 | 222 |
| 259 | 3300014325 | Ga0163163_10022224 | Ga0163163_100222243 | 222 |
| 260 | 3300014968 | Ga0157379_10007080 | Ga0157379_100070802 | 222 |
| 261 | 3300025901 | Ga0207688_10022337 | Ga0207688_100223372 | 222 |
| 262 | 3300025904 | Ga0207647_10015332 | Ga0207647_100153322 | 222 |
| 263 | 3300025908 | Ga0207643_10065043 | Ga0207643_100650432 | 222 |
| 264 | 3300025919 | Ga0207657_10050636 | Ga0207657_100506361 | 222 |
| 265 | 3300025927 | Ga0207687_10007350 | Ga0207687_100073506 | 222 |
| 266 | 3300025932 | Ga0207690_10012612 | Ga0207690_100126122 | 222 |
| 267 | 3300025934 | Ga0207686_10087247 | Ga0207686_100872472 | 222 |
| 268 | 3300025937 | Ga0207669_10398863 | Ga0207669_103988632 | 222 |
| 269 | 3300025938 | Ga0207704_10093274 | Ga0207704_100932742 | 222 |
| 270 | 3300025941 | Ga0207711_10419532 | Ga0207711_104195321 | 222 |
| 271 | 3300025961 | Ga0207712_10021607 | Ga0207712_100216072 | 222 |
| 272 | 3300026023 | Ga0207677_10583074 | Ga0207677_105830742 | 222 |
| 273 | 3300026078 | Ga0207702_10052086 | Ga0207702_100520862 | 222 |
| 274 | 3300026095 | Ga0207676_10031921 | Ga0207676_100319213 | 222 |
| 275 | 3300026116 | Ga0207674_10027411 | Ga0207674_100274113 | 222 |
| 276 | 3300026118 | Ga0207675_100081253 | Ga0207675_1000812534 | 222 |
| 277 | 3300028379 | Ga0268266_10413590 | Ga0268266_104135902 | 222 |
| 278 | 3300028381 | Ga0268264_10019309 | Ga0268264_100193092 | 222 |
| 279 | 3300048904 | Ga0496101_0271943 | Ga0496101_0271943_76_744 | 222 |
| 280 | 3300048905 | Ga0496102_0006639 | Ga0496102_0006639_6894_7562 | 222 |
| 281 | 3300048906 | Ga0496103_0155552 | Ga0496103_0155552_424_1092 | 222 |
| 282 | 3300048911 | Ga0496108_0017221 | Ga0496108_0017221_3908_4576 | 222 |
| 283 | 3300048912 | Ga0496109_0010791 | Ga0496109_0010791_2326_2994 | 222 |
| 284 | 3300048912 | Ga0496109_0715876 | Ga0496109_0715876_12_746 | 222 |
| 285 | 3300048913 | Ga0496110_0074563 | Ga0496110_0074563_2031_2699 | 222 |
| 286 | 3300048914 | Ga0496111_0218688 | Ga0496111_0218688_269_937 | 222 |
| 287 | 3300048916 | Ga0496113_0109965 | Ga0496113_0109965_11_679 | 222 |
| 288 | 3300048917 | Ga0496114_0696118 | Ga0496114_0696118_48_776 | 222 |
| 289 | 3300049569 | Ga0501032_0147329 | Ga0501032_0147329_456_1205 | 222 |
| 290 | 3300049572 | Ga0501036_0144827 | Ga0501036_0144827_1024_1737 | 222 |
| 291 | 3300049574 | Ga0501038_0077472 | Ga0501038_0077472_1263_1976 | 222 |
| 292 | 3300049575 | Ga0501039_0014821 | Ga0501039_0014821_1286_1999 | 222 |
| 293 | 3300049578 | Ga0501042_0229709 | Ga0501042_0229709_449_1162 | 222 |
| 294 | 3300049583 | Ga0501067_0188992 | Ga0501067_0188992_187_900 | 222 |
| 295 | 3300049587 | Ga0501071_0150430 | Ga0501071_0150430_748_1461 | 222 |
| 296 | 3300049590 | Ga0501074_0524237 | Ga0501074_0524237_61_774 | 222 |
| 297 | 3300050492 | nmdc:mga0yw44_88258_c1 | nmdc:mga0yw44_88258_c1_1045_1836 | 222 |
| 298 | 3300060353 | Ga0501082_0613530 | Ga0501082_0613530_88_801 | 222 |
| 299 | iso_pu_bacteria | 2855386786 | 2855387529 | 222 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lrd-assembly1.cif.gz_B | self-assembly of spider silk proteins is controlled by a ph-sensitive relay | 0.3845 | 54 | 208 |
| 3lrd-assembly1.cif.gz_B | self-assembly of spider silk proteins is controlled by a ph-sensitive relay | 0.3733 | 54 | 208 |
| 5wuf-assembly1.cif.gz_A | structural basis for conductance through tric cation channels | 0.3268 | 29 | 183 |
| 6ysf-assembly1.cif.gz_D | structure of the flagellar motab stator complex from clostridium sporogenes | 0.3126 | 71 | 160 |
| 7m1t-assembly1.cif.gz_B | crystal structure of an archaeal cnnm, mtcorb, with c-terminal deletion in complex with mg2+-atp | 0.3063 | 25 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2E2_1_187_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7249 | 23 | 212 | 1.10.1760.20 |
| af_Q2G2E2_1_187_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7218 | 23 | 212 | 1.10.1760.20 |
| af_A0A1D6EFQ3_11_126_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.3491 | 33 | 178 | 1.10.3730.20 |
| af_A0A1D6EFQ3_11_126_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.3425 | 33 | 178 | 1.10.3730.20 |
| af_Q22816_108_427_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.317 | 28 | 147 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H7SNL7-F1-model_v4 | Uncharacterized membrane protein YczE | 0.996 | 25 | 213 |
GO:0016020
|
| AF-A0A1Q9SNN4-F1-model_v4 | Membrane protein YczE | 0.9949 | 24 | 213 |
GO:0016020
|
| AF-A0A285E2M7-F1-model_v4 | deleted | 0.9942 | 24 | 208 |
|
| AF-A0A235G7U8-F1-model_v4 | Putative membrane protein YczE | 0.9933 | 25 | 207 |
GO:0016020
|
| AF-A0A2C8Z414-F1-model_v4 | Uncharacterized membrane protein YczE | 0.9925 | 25 | 213 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar