F394593
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 298 | 255 | 225 | 328 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8045864390|8045868205 |
| Length | 367 |
| Sequence | ELDSTGSQARQAESEPRGGEQSPGLPRSDLKRVLVTGGAGFLGSHLCELLLRRGHRVTCVDNLQTGSTANLSRFGASNRFTFIERDICETLPASLEVDEIYNLACAASPPRYQADPVHTMMTCVVGTNNILEIAERCGARLVHASTSEVYGDPLQHPQTETYWGNVNPTGPRACYDEGKRAAETLTFDYLRAGRVDARVVRIFNTYGPRMQPDDGRIVSNLICQALAGDAMTLYGTGEQTRSFCYVTDLIAGIVALMEVEPNPEQPVNLGNPGEFTIRELAEVVVRLTGSRSPIAHLPLPQDDPQRRRPDITLARSLLGWEPKVTLVEGLEPTIAWFSGAQSDENREWSGTRASSKAAYSFAETNLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 2 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 3 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 4 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 5 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 6 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 7 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 8 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 9 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 10 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 11 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 12 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 13 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 14 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 15 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 16 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 17 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 18 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 19 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 20 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 21 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 22 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 23 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 24 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 25 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 26 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 27 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 28 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 29 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 30 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 31 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 32 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 33 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 34 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 35 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 36 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 37 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 38 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 39 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 40 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 41 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 42 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 43 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 44 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 45 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 46 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 47 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 48 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 49 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 50 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 51 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 52 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 53 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 54 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 55 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 56 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 57 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 58 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 59 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 60 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 61 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 62 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 63 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 64 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 70 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 76 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 82 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 88 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 95 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 154 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 174 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 199 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 205 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 206 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 207 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 219 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 226 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 227 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 228 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 239 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 240 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 241 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 242 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 243 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 244 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 245 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 246 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 247 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 248 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 249 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 250 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 251 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 252 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 253 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 254 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 255 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.82 |
| Metatranscriptomes | 2.68 |
| Isolates | 24.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.07 |
| Nodule | 20.47 |
| Rhizoplane | 3.02 |
| Rhizosphere | 60.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1001686 | 3300002739 | Bacteria | 3794 |
| 2 | JGI25152J39213_1004110 | 3300002773 | Bacteria | 4703 |
| 3 | JGI25159J45721_1000593 | 3300002987 | Bacteria | 16177 |
| 4 | JGI25151J46595_10012709 | 3300003187 | Bacteria | 3820 |
| 5 | rootH2_10263051 | 3300003320 | Bacteria | 2241 |
| 6 | JGI25160J50197_1001174 | 3300003354 | Bacteria | 13352 |
| 7 | JGI25161J50226_1000029 | 3300003374 | Bacteria | 144998 |
| 8 | Ga0055526_1013500 | 3300003771 | Bacteria | 3447 |
| 9 | Ga0055524_1001211 | 3300003775 | Bacteria | 15291 |
| 10 | Ga0055528_1040544 | 3300003790 | Bacteria | 1049 |
| 11 | Ga0055540_1000157 | 3300003792 | Bacteria | 67204 |
| 12 | Ga0055543_1000016 | 3300004625 | Bacteria | 176117 |
| 13 | Ga0065165_1002037 | 3300005262 | Bacteria | 18769 |
| 14 | Ga0070676_10004409 | 3300005328 | Bacteria | 7404 |
| 15 | Ga0070683_100005137 | 3300005329 | Bacteria | 10886 |
| 16 | Ga0070683_100361773 | 3300005329 | Bacteria | 1382 |
| 17 | Ga0070690_100005846 | 3300005330 | Bacteria | 6932 |
| 18 | Ga0070690_100046383 | 3300005330 | Bacteria | 2762 |
| 19 | Ga0070680_100113202 | 3300005336 | Bacteria | 2260 |
| 20 | Ga0070682_100215631 | 3300005337 | Bacteria | 1363 |
| 21 | Ga0068868_100241483 | 3300005338 | Bacteria | 1518 |
| 22 | Ga0070689_100019378 | 3300005340 | Bacteria | 5031 |
| 23 | Ga0070689_100032932 | 3300005340 | Bacteria | 3946 |
| 24 | Ga0070689_100048843 | 3300005340 | Bacteria | 3265 |
| 25 | Ga0070669_100293637 | 3300005353 | Bacteria | 1305 |
| 26 | Ga0070675_100532893 | 3300005354 | Bacteria | 1060 |
| 27 | Ga0070671_100227660 | 3300005355 | Bacteria | 1582 |
| 28 | Ga0070673_100032934 | 3300005364 | Bacteria | 3908 |
| 29 | Ga0070688_100018694 | 3300005365 | Bacteria | 4004 |
| 30 | Ga0070709_10265068 | 3300005434 | Bacteria | 1243 |
| 31 | Ga0070710_10042211 | 3300005437 | Bacteria | 2521 |
| 32 | Ga0070711_100225508 | 3300005439 | Bacteria | 1459 |
| 33 | Ga0070705_100194310 | 3300005440 | Bacteria | 1386 |
| 34 | Ga0070700_100002244 | 3300005441 | Bacteria | 9835 |
| 35 | Ga0068867_100433911 | 3300005459 | Bacteria | 1116 |
| 36 | Ga0070685_10093277 | 3300005466 | Bacteria | 1826 |
| 37 | Ga0070685_10252145 | 3300005466 | Bacteria | 1169 |
| 38 | Ga0070706_100152647 | 3300005467 | Bacteria | 2156 |
| 39 | Ga0070698_100020498 | 3300005471 | Bacteria | 6930 |
| 40 | Ga0070699_100000226 | 3300005518 | Bacteria | 55613 |
| 41 | Ga0070699_100000614 | 3300005518 | Bacteria | 33674 |
| 42 | Ga0070679_100009066 | 3300005530 | Bacteria | 9386 |
| 43 | Ga0070679_100091771 | 3300005530 | Bacteria | 3025 |
| 44 | Ga0070679_100214843 | 3300005530 | Bacteria | 1886 |
| 45 | Ga0070684_100002301 | 3300005535 | Bacteria | 14094 |
| 46 | Ga0068853_100147634 | 3300005539 | Bacteria | 2114 |
| 47 | Ga0070672_100024338 | 3300005543 | Bacteria | 4473 |
| 48 | Ga0070686_100006998 | 3300005544 | Bacteria | 6285 |
| 49 | Ga0070686_100037176 | 3300005544 | Bacteria | 3019 |
| 50 | Ga0068855_100024622 | 3300005563 | Bacteria | 7201 |
| 51 | Ga0068856_100015178 | 3300005614 | Bacteria | 7441 |
| 52 | Ga0068856_100420313 | 3300005614 | Bacteria | 1357 |
| 53 | Ga0068859_100006336 | 3300005617 | Bacteria | 12002 |
| 54 | Ga0068861_100073950 | 3300005719 | Bacteria | 2649 |
| 55 | Ga0068863_100014862 | 3300005841 | Bacteria | 7479 |
| 56 | Ga0068863_100080734 | 3300005841 | Bacteria | 3081 |
| 57 | Ga0068858_100301149 | 3300005842 | Bacteria | 1530 |
| 58 | Ga0070717_10114769 | 3300006028 | Bacteria | 2301 |
| 59 | Ga0075429_100000766 | 3300006880 | Bacteria | 25329 |
| 60 | Ga0068865_100022267 | 3300006881 | Bacteria | 4131 |
| 61 | Ga0097620_100006336 | 3300006931 | Bacteria | 12002 |
| 62 | Ga0111539_10007746 | 3300009094 | Bacteria | 13714 |
| 63 | Ga0114129_10057043 | 3300009147 | Bacteria | 5468 |
| 64 | Ga0105237_10225992 | 3300009545 | Bacteria | 1872 |
| 65 | Ga0105238_10124852 | 3300009551 | Bacteria | 2553 |
| 66 | Ga0105238_10326817 | 3300009551 | Bacteria | 1520 |
| 67 | Ga0157374_10070889 | 3300013296 | Bacteria | 3285 |
| 68 | Ga0157378_10287118 | 3300013297 | Bacteria | 1588 |
| 69 | Ga0163163_10099231 | 3300014325 | Bacteria | 2934 |
| 70 | Ga0157379_10168714 | 3300014968 | Bacteria | 1976 |
| 71 | Ga0209436_100003 | 3300025208 | Bacteria | 220530 |
| 72 | Ga0207425_1005937 | 3300025245 | Bacteria | 3410 |
| 73 | Ga0209129_1001134 | 3300025258 | Bacteria | 15421 |
| 74 | Ga0209673_1001180 | 3300025273 | Bacteria | 28315 |
| 75 | Ga0209673_1014435 | 3300025273 | Bacteria | 3055 |
| 76 | Ga0209130_1000051 | 3300025284 | Bacteria | 220482 |
| 77 | Ga0209025_1000496 | 3300025294 | Bacteria | 75601 |
| 78 | Ga0209564_1001136 | 3300025295 | Bacteria | 31269 |
| 79 | Ga0209050_1001362 | 3300025298 | Bacteria | 26749 |
| 80 | Ga0209256_1001136 | 3300025299 | Bacteria | 30339 |
| 81 | Ga0209256_1002750 | 3300025299 | Bacteria | 13590 |
| 82 | Ga0207426_1000043 | 3300025302 | Bacteria | 432827 |
| 83 | Ga0207426_1001061 | 3300025302 | Bacteria | 26031 |
| 84 | Ga0209051_1000032 | 3300025303 | Bacteria | 383445 |
| 85 | Ga0209051_1030795 | 3300025303 | Bacteria | 2077 |
| 86 | Ga0209257_1005776 | 3300025304 | Bacteria | 8435 |
| 87 | Ga0209257_1034655 | 3300025304 | Bacteria | 1572 |
| 88 | Ga0207692_10039784 | 3300025898 | Bacteria | 2316 |
| 89 | Ga0207645_10001196 | 3300025907 | Bacteria | 21420 |
| 90 | Ga0207684_10191025 | 3300025910 | Bacteria | 1767 |
| 91 | Ga0207662_10029570 | 3300025918 | Bacteria | 3175 |
| 92 | Ga0207652_10025900 | 3300025921 | Bacteria | 4880 |
| 93 | Ga0207652_10085774 | 3300025921 | Bacteria | 2760 |
| 94 | Ga0207681_10000585 | 3300025923 | Bacteria | 24828 |
| 95 | Ga0207694_10010377 | 3300025924 | Bacteria | 7021 |
| 96 | Ga0207670_10102415 | 3300025936 | Bacteria | 2047 |
| 97 | Ga0207691_10023577 | 3300025940 | Bacteria | 5794 |
| 98 | Ga0207691_10106406 | 3300025940 | Bacteria | 2498 |
| 99 | Ga0207661_10013367 | 3300025944 | Bacteria | 5996 |
| 100 | Ga0207661_10357974 | 3300025944 | Bacteria | 1318 |
| 101 | Ga0207667_10057650 | 3300025949 | Bacteria | 4076 |
| 102 | Ga0207639_10095670 | 3300026041 | Bacteria | 2387 |
| 103 | Ga0207639_10167661 | 3300026041 | Bacteria | 1857 |
| 104 | Ga0207708_10000630 | 3300026075 | Bacteria | 27098 |
| 105 | Ga0207702_10101668 | 3300026078 | Bacteria | 2539 |
| 106 | Ga0207641_10071677 | 3300026088 | Bacteria | 2981 |
| 107 | Ga0207648_10082004 | 3300026089 | Bacteria | 2812 |
| 108 | Ga0207675_100078546 | 3300026118 | Bacteria | 3092 |
| 109 | Ga0207675_100185643 | 3300026118 | Bacteria | 1993 |
| 110 | Ga0209281_1000514 | 3300027111 | Bacteria | 50622 |
| 111 | Ga0207428_10029566 | 3300027907 | Bacteria | 4539 |
| 112 | Ga0268266_10045617 | 3300028379 | Bacteria | 3750 |
| 113 | Ga0265336_10019642 | 3300028666 | Bacteria | 2178 |
| 114 | Ga0265338_10063202 | 3300028800 | Bacteria | 3229 |
| 115 | Ga0265332_10053400 | 3300031238 | Bacteria | 1734 |
| 116 | Ga0265332_10081396 | 3300031238 | Bacteria | 1373 |
| 117 | Ga0265328_10003154 | 3300031239 | Bacteria | 7334 |
| 118 | Ga0265320_10003883 | 3300031240 | Bacteria | 9892 |
| 119 | Ga0265329_10035580 | 3300031242 | Bacteria | 1607 |
| 120 | Ga0265340_10041792 | 3300031247 | Bacteria | 2253 |
| 121 | Ga0265339_10006817 | 3300031249 | Bacteria | 7449 |
| 122 | Ga0265339_10064065 | 3300031249 | Bacteria | 1972 |
| 123 | Ga0265314_10000205 | 3300031711 | Bacteria | 87156 |
| 124 | Ga0265314_10002294 | 3300031711 | Bacteria | 19784 |
| 125 | Ga0265314_10010573 | 3300031711 | Bacteria | 7681 |
| 126 | Ga0265342_10000171 | 3300031712 | Bacteria | 71706 |
| 127 | Ga0265342_10001286 | 3300031712 | Bacteria | 23595 |
| 128 | Ga0307405_10121144 | 3300031731 | Bacteria | 1790 |
| 129 | Ga0307406_10088583 | 3300031901 | Bacteria | 2077 |
| 130 | Ga0307416_100144319 | 3300032002 | Bacteria | 2170 |
| 131 | Ga0373953_0124073 | 3300035117 | Bacteria | 1098 |
| 132 | Ga0373954_0009901 | 3300035118 | Bacteria | 4198 |
| 133 | Ga0373956_0009099 | 3300035119 | Bacteria | 4028 |
| 134 | Ga0373956_0043456 | 3300035119 | Bacteria | 2001 |
| 135 | Ga0373943_0002825 | 3300035170 | Bacteria | 7886 |
| 136 | Ga0373955_0100721 | 3300035172 | Bacteria | 1658 |
| 137 | Ga0373955_0100771 | 3300035172 | Bacteria | 1658 |
| 138 | Ga0373927_0299689 | 3300035695 | Bacteria | 1058 |
| 139 | Ga0373933_0062091 | 3300035724 | Bacteria | 2256 |
| 140 | Ga0373933_0155441 | 3300035724 | Bacteria | 1450 |
| 141 | Ga0373937_0014115 | 3300036401 | Bacteria | 7045 |
| 142 | Ga0373937_0020981 | 3300036401 | Bacteria | 5859 |
| 143 | Ga0373937_0218637 | 3300036401 | Bacteria | 1793 |
| 144 | Ga0373925_0093620 | 3300037068 | Bacteria | 2300 |
| 145 | Ga0373925_0132325 | 3300037068 | Bacteria | 1946 |
| 146 | Ga0373925_0299967 | 3300037068 | Bacteria | 1297 |
| 147 | Ga0395900_0027238 | 3300037418 | Bacteria | 5853 |
| 148 | Ga0395898_0002612 | 3300037466 | Bacteria | 20986 |
| 149 | Ga0395901_0027239 | 3300038443 | Bacteria | 5871 |
| 150 | Ga0436365_1809956 | 3300039437 | Bacteria | 5401 |
| 151 | Ga0439465_0000227 | 3300041413 | Bacteria | 15183 |
| 152 | Ga0451843_0515067 | 3300041509 | Bacteria | 8287 |
| 153 | Ga0451853_0912432 | 3300041512 | Bacteria | 11739 |
| 154 | Ga0451576_0095165 | 3300045051 | Bacteria | 3098 |
| 155 | Ga0495638_0159034 | 3300046460 | Bacteria | 1305 |
| 156 | Ga0495641_0109486 | 3300046461 | Bacteria | 1232 |
| 157 | Ga0495606_0029830 | 3300046507 | Bacteria | 3822 |
| 158 | Ga0495610_0000518 | 3300046512 | Bacteria | 38760 |
| 159 | Ga0495620_0022284 | 3300046515 | Bacteria | 3055 |
| 160 | Ga0495630_0021831 | 3300046517 | Bacteria | 4727 |
| 161 | Ga0495632_0009788 | 3300046519 | Bacteria | 5743 |
| 162 | Ga0495643_0002657 | 3300046522 | Bacteria | 13855 |
| 163 | Ga0495643_0027410 | 3300046522 | Bacteria | 3202 |
| 164 | Ga0495586_0025230 | 3300046535 | Bacteria | 3179 |
| 165 | Ga0495597_0013308 | 3300046542 | Bacteria | 3946 |
| 166 | Ga0495622_0121484 | 3300046557 | Bacteria | 1192 |
| 167 | Ga0495667_0134315 | 3300046559 | Bacteria | 1595 |
| 168 | Ga0495634_0034342 | 3300046642 | Bacteria | 3481 |
| 169 | Ga0495625_0068701 | 3300046660 | Bacteria | 2490 |
| 170 | Ga0495599_0218216 | 3300046678 | Bacteria | 1168 |
| 171 | Ga0495649_0000467 | 3300046694 | Bacteria | 34802 |
| 172 | Ga0495660_0005149 | 3300046810 | Bacteria | 7857 |
| 173 | Ga0495604_0230312 | 3300047317 | Bacteria | 1271 |
| 174 | Ga0495674_0003047 | 3300047319 | Bacteria | 16301 |
| 175 | Ga0495680_0083780 | 3300047322 | Bacteria | 2404 |
| 176 | Ga0495686_0037332 | 3300047472 | Bacteria | 3113 |
| 177 | Ga0495686_0055674 | 3300047472 | Bacteria | 2472 |
| 178 | Ga0496107_0051959 | 3300048910 | Bacteria | 2957 |
| 179 | Ga0496108_0415856 | 3300048911 | Bacteria | 1174 |
| 180 | Ga0496109_0216231 | 3300048912 | Bacteria | 1802 |
| 181 | Ga0496110_0521332 | 3300048913 | Bacteria | 1081 |
| 182 | Ga0496112_0337574 | 3300048915 | Bacteria | 1450 |
| 183 | Ga0496114_0005958 | 3300048917 | Bacteria | 9586 |
| 184 | Ga0496114_0195198 | 3300048917 | Bacteria | 1772 |
| 185 | Ga0496115_0031232 | 3300048918 | Bacteria | 4195 |
| 186 | Ga0496115_0040698 | 3300048918 | Bacteria | 3696 |
| 187 | Ga0496122_0000074 | 3300048925 | Bacteria | 219900 |
| 188 | Ga0496123_0000062 | 3300048926 | Bacteria | 219882 |
| 189 | Ga0501037_0018084 | 3300049573 | Bacteria | 5192 |
| 190 | Ga0501039_0113718 | 3300049575 | Bacteria | 2117 |
| 191 | Ga0501047_0062391 | 3300049581 | Bacteria | 3595 |
| 192 | Ga0501068_0017667 | 3300049584 | Bacteria | 4127 |
| 193 | Ga0501069_0012161 | 3300049585 | Bacteria | 4571 |
| 194 | Ga0501070_0000007 | 3300049586 | Bacteria | 219869 |
| 195 | Ga0501071_0364499 | 3300049587 | Bacteria | 1101 |
| 196 | Ga0501073_0015088 | 3300049589 | Bacteria | 5605 |
| 197 | Ga0501073_0034141 | 3300049589 | Bacteria | 3621 |
| 198 | Ga0501074_0060448 | 3300049590 | Bacteria | 2730 |
| 199 | Ga0501077_0009198 | 3300049593 | Bacteria | 6135 |
| 200 | Ga0501083_0001063 | 3300049744 | Bacteria | 18310 |
| 201 | Ga0501083_0001643 | 3300049744 | Bacteria | 15265 |
| 202 | Ga0501241_007395 | 3300049758 | Bacteria | 2011 |
| 203 | Ga0501044_0058557 | 3300049823 | Bacteria | 3950 |
| 204 | nmdc:mga05p37_86365_c1 | 3300050507 | Bacteria | 3866 |
| 205 | nmdc:mga09592_1511_c1 | 3300050508 | Bacteria | 18731 |
| 206 | nmdc:mga08y16_1823_c1 | 3300050511 | Bacteria | 12393 |
| 207 | Ga0495601_0040090 | 3300053077 | Bacteria | 2933 |
| 208 | Ga0500618_004035 | 3300053125 | Bacteria | 4829 |
| 209 | Ga0500616_0084920 | 3300053153 | Bacteria | 1582 |
| 210 | Ga0500622_0000064 | 3300053156 | Bacteria | 127531 |
| 211 | Ga0500627_0005208 | 3300053158 | Bacteria | 4292 |
| 212 | Ga0501084_0009706 | 3300054114 | Bacteria | 7960 |
| 213 | Ga0587073_0000237 | 3300059492 | Bacteria | 4382 |
| 214 | Ga0587083_0005805 | 3300059505 | Bacteria | 1805 |
| 215 | Ga0587088_000319 | 3300059508 | Bacteria | 3669 |
| 216 | Ga0587089_003116 | 3300059509 | Bacteria | 1737 |
| 217 | Ga0587090_003632 | 3300059510 | Bacteria | 1807 |
| 218 | Ga0587091_004968 | 3300059511 | Bacteria | 1783 |
| 219 | Ga0587107_001936 | 3300059652 | Bacteria | 1782 |
| 220 | Ga0587114_000120 | 3300059655 | Bacteria | 3814 |
| 221 | Ga0501082_0012651 | 3300060353 | Bacteria | 7253 |
| 222 | Ga0501082_0017704 | 3300060353 | Bacteria | 6136 |
| 223 | Ga0501082_0019570 | 3300060353 | Bacteria | 5838 |
| 224 | Ga0501082_0173200 | 3300060353 | Bacteria | 1877 |
| 225 | Ga0530510_0041791 | 3300061734 | Bacteria | 3311 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031238 | Ga0265332_10053400 | Ga0265332_100534002 | 284 |
| 2 | 3300031247 | Ga0265340_10041792 | Ga0265340_100417923 | 284 |
| 3 | 3300035172 | Ga0373955_0100771 | Ga0373955_0100771_746_1621 | 290 |
| 4 | 3300035724 | Ga0373933_0062091 | Ga0373933_0062091_1187_2065 | 291 |
| 5 | 3300048911 | Ga0496108_0415856 | Ga0496108_0415856_284_1162 | 291 |
| 6 | 3300025918 | Ga0207662_10029570 | Ga0207662_100295701 | 295 |
| 7 | iso_pu_bacteria | 2933016740 | 2933022792 | 295 |
| 8 | 3300003771 | Ga0055526_1013500 | Ga0055526_10135003 | 303 |
| 9 | 3300003775 | Ga0055524_1001211 | Ga0055524_10012117 | 303 |
| 10 | 3300003790 | Ga0055528_1040544 | Ga0055528_10405441 | 303 |
| 11 | 3300025273 | Ga0209673_1001180 | Ga0209673_100118019 | 303 |
| 12 | 3300025295 | Ga0209564_1001136 | Ga0209564_100113624 | 303 |
| 13 | 3300025299 | Ga0209256_1001136 | Ga0209256_10011367 | 303 |
| 14 | 3300005543 | Ga0070672_100024338 | Ga0070672_1000243382 | 307 |
| 15 | 3300006028 | Ga0070717_10114769 | Ga0070717_101147692 | 307 |
| 16 | 3300025940 | Ga0207691_10106406 | Ga0207691_101064063 | 307 |
| 17 | 3300037068 | Ga0373925_0299967 | Ga0373925_0299967_202_1128 | 307 |
| 18 | 3300047317 | Ga0495604_0230312 | Ga0495604_0230312_334_1260 | 307 |
| 19 | 3300006880 | Ga0075429_100000766 | Ga0075429_10000076623 | 309 |
| 20 | 3300009147 | Ga0114129_10057043 | Ga0114129_100570436 | 309 |
| 21 | 3300050507 | nmdc:mga05p37_86365_c1 | nmdc:mga05p37_86365_c1_2126_3055 | 309 |
| 22 | 3300050508 | nmdc:mga09592_1511_c1 | nmdc:mga09592_1511_c1_5934_6863 | 309 |
| 23 | 3300049581 | Ga0501047_0062391 | Ga0501047_0062391_664_1605 | 310 |
| 24 | 3300049744 | Ga0501083_0001063 | Ga0501083_0001063_15099_16040 | 310 |
| 25 | 3300054114 | Ga0501084_0009706 | Ga0501084_0009706_3871_4812 | 310 |
| 26 | 3300060353 | Ga0501082_0019570 | Ga0501082_0019570_3253_4194 | 310 |
| 27 | 3300005440 | Ga0070705_100194310 | Ga0070705_1001943102 | 311 |
| 28 | 3300005467 | Ga0070706_100152647 | Ga0070706_1001526472 | 311 |
| 29 | 3300005471 | Ga0070698_100020498 | Ga0070698_1000204982 | 311 |
| 30 | 3300005518 | Ga0070699_100000226 | Ga0070699_10000022643 | 311 |
| 31 | 3300005518 | Ga0070699_100000614 | Ga0070699_10000061433 | 311 |
| 32 | 3300005841 | Ga0068863_100014862 | Ga0068863_1000148624 | 311 |
| 33 | 3300014325 | Ga0163163_10099231 | Ga0163163_100992312 | 311 |
| 34 | 3300014968 | Ga0157379_10168714 | Ga0157379_101687142 | 311 |
| 35 | 3300025910 | Ga0207684_10191025 | Ga0207684_101910252 | 311 |
| 36 | 3300031711 | Ga0265314_10000205 | Ga0265314_1000020578 | 311 |
| 37 | 3300049593 | Ga0501077_0009198 | Ga0501077_0009198_2213_3148 | 311 |
| 38 | 3300032002 | Ga0307416_100144319 | Ga0307416_1001443192 | 312 |
| 39 | 3300049584 | Ga0501068_0017667 | Ga0501068_0017667_2874_3815 | 312 |
| 40 | 3300049586 | Ga0501070_0000007 | Ga0501070_0000007_147486_148427 | 312 |
| 41 | 3300049589 | Ga0501073_0034141 | Ga0501073_0034141_788_1729 | 312 |
| 42 | 3300049590 | Ga0501074_0060448 | Ga0501074_0060448_56_997 | 312 |
| 43 | 3300049744 | Ga0501083_0001643 | Ga0501083_0001643_12270_13211 | 312 |
| 44 | 3300060353 | Ga0501082_0012651 | Ga0501082_0012651_4984_5925 | 312 |
| 45 | 3300060353 | Ga0501082_0017704 | Ga0501082_0017704_4425_5366 | 312 |
| 46 | 3300061734 | Ga0530510_0041791 | Ga0530510_0041791_2291_3232 | 312 |
| 47 | 3300005328 | Ga0070676_10004409 | Ga0070676_100044091 | 313 |
| 48 | 3300005329 | Ga0070683_100005137 | Ga0070683_1000051378 | 313 |
| 49 | 3300005329 | Ga0070683_100361773 | Ga0070683_1003617732 | 313 |
| 50 | 3300005330 | Ga0070690_100005846 | Ga0070690_1000058462 | 313 |
| 51 | 3300005330 | Ga0070690_100046383 | Ga0070690_1000463831 | 313 |
| 52 | 3300005337 | Ga0070682_100215631 | Ga0070682_1002156311 | 313 |
| 53 | 3300005338 | Ga0068868_100241483 | Ga0068868_1002414832 | 313 |
| 54 | 3300005340 | Ga0070689_100019378 | Ga0070689_1000193784 | 313 |
| 55 | 3300005340 | Ga0070689_100032932 | Ga0070689_1000329323 | 313 |
| 56 | 3300005340 | Ga0070689_100048843 | Ga0070689_1000488432 | 313 |
| 57 | 3300005353 | Ga0070669_100293637 | Ga0070669_1002936371 | 313 |
| 58 | 3300005354 | Ga0070675_100532893 | Ga0070675_1005328931 | 313 |
| 59 | 3300005355 | Ga0070671_100227660 | Ga0070671_1002276602 | 313 |
| 60 | 3300005364 | Ga0070673_100032934 | Ga0070673_1000329342 | 313 |
| 61 | 3300005365 | Ga0070688_100018694 | Ga0070688_1000186942 | 313 |
| 62 | 3300005441 | Ga0070700_100002244 | Ga0070700_1000022442 | 313 |
| 63 | 3300005459 | Ga0068867_100433911 | Ga0068867_1004339111 | 313 |
| 64 | 3300005466 | Ga0070685_10093277 | Ga0070685_100932772 | 313 |
| 65 | 3300005466 | Ga0070685_10252145 | Ga0070685_102521451 | 313 |
| 66 | 3300005530 | Ga0070679_100009066 | Ga0070679_1000090665 | 313 |
| 67 | 3300005530 | Ga0070679_100214843 | Ga0070679_1002148432 | 313 |
| 68 | 3300005535 | Ga0070684_100002301 | Ga0070684_1000023017 | 313 |
| 69 | 3300005539 | Ga0068853_100147634 | Ga0068853_1001476342 | 313 |
| 70 | 3300005544 | Ga0070686_100006998 | Ga0070686_1000069984 | 313 |
| 71 | 3300005544 | Ga0070686_100037176 | Ga0070686_1000371761 | 313 |
| 72 | 3300005614 | Ga0068856_100420313 | Ga0068856_1004203131 | 313 |
| 73 | 3300005719 | Ga0068861_100073950 | Ga0068861_1000739503 | 313 |
| 74 | 3300005841 | Ga0068863_100080734 | Ga0068863_1000807342 | 313 |
| 75 | 3300005842 | Ga0068858_100301149 | Ga0068858_1003011492 | 313 |
| 76 | 3300006881 | Ga0068865_100022267 | Ga0068865_1000222673 | 313 |
| 77 | 3300009094 | Ga0111539_10007746 | Ga0111539_1000774611 | 313 |
| 78 | 3300009551 | Ga0105238_10124852 | Ga0105238_101248522 | 313 |
| 79 | 3300013296 | Ga0157374_10070889 | Ga0157374_100708894 | 313 |
| 80 | 3300013297 | Ga0157378_10287118 | Ga0157378_102871182 | 313 |
| 81 | 3300025907 | Ga0207645_10001196 | Ga0207645_1000119617 | 313 |
| 82 | 3300025921 | Ga0207652_10025900 | Ga0207652_100259005 | 313 |
| 83 | 3300025923 | Ga0207681_10000585 | Ga0207681_1000058511 | 313 |
| 84 | 3300025936 | Ga0207670_10102415 | Ga0207670_101024152 | 313 |
| 85 | 3300025940 | Ga0207691_10023577 | Ga0207691_100235771 | 313 |
| 86 | 3300025944 | Ga0207661_10013367 | Ga0207661_100133673 | 313 |
| 87 | 3300025944 | Ga0207661_10357974 | Ga0207661_103579742 | 313 |
| 88 | 3300026041 | Ga0207639_10167661 | Ga0207639_101676612 | 313 |
| 89 | 3300026075 | Ga0207708_10000630 | Ga0207708_1000063017 | 313 |
| 90 | 3300026088 | Ga0207641_10071677 | Ga0207641_100716772 | 313 |
| 91 | 3300026089 | Ga0207648_10082004 | Ga0207648_100820042 | 313 |
| 92 | 3300026118 | Ga0207675_100078546 | Ga0207675_1000785463 | 313 |
| 93 | 3300026118 | Ga0207675_100185643 | Ga0207675_1001856432 | 313 |
| 94 | 3300027907 | Ga0207428_10029566 | Ga0207428_100295661 | 313 |
| 95 | 3300028800 | Ga0265338_10063202 | Ga0265338_100632022 | 313 |
| 96 | 3300031239 | Ga0265328_10003154 | Ga0265328_100031542 | 313 |
| 97 | 3300031240 | Ga0265320_10003883 | Ga0265320_100038839 | 313 |
| 98 | 3300031242 | Ga0265329_10035580 | Ga0265329_100355802 | 313 |
| 99 | 3300031249 | Ga0265339_10006817 | Ga0265339_100068177 | 313 |
| 100 | 3300031711 | Ga0265314_10002294 | Ga0265314_1000229416 | 313 |
| 101 | 3300031712 | Ga0265342_10001286 | Ga0265342_1000128610 | 313 |
| 102 | 3300035118 | Ga0373954_0009901 | Ga0373954_0009901_1310_2254 | 313 |
| 103 | 3300035119 | Ga0373956_0043456 | Ga0373956_0043456_706_1650 | 313 |
| 104 | 3300035170 | Ga0373943_0002825 | Ga0373943_0002825_2888_3832 | 313 |
| 105 | 3300035695 | Ga0373927_0299689 | Ga0373927_0299689_49_993 | 313 |
| 106 | 3300035724 | Ga0373933_0155441 | Ga0373933_0155441_358_1302 | 313 |
| 107 | 3300036401 | Ga0373937_0020981 | Ga0373937_0020981_4384_5328 | 313 |
| 108 | 3300036401 | Ga0373937_0218637 | Ga0373937_0218637_314_1258 | 313 |
| 109 | 3300037068 | Ga0373925_0093620 | Ga0373925_0093620_951_1895 | 313 |
| 110 | 3300037068 | Ga0373925_0132325 | Ga0373925_0132325_687_1637 | 313 |
| 111 | 3300039437 | Ga0436365_1809956 | Ga0436365_1809956_1746_2690 | 313 |
| 112 | 3300045051 | Ga0451576_0095165 | Ga0451576_0095165_1888_2832 | 313 |
| 113 | 3300046461 | Ga0495641_0109486 | Ga0495641_0109486_40_984 | 313 |
| 114 | 3300046517 | Ga0495630_0021831 | Ga0495630_0021831_1953_2900 | 313 |
| 115 | 3300046535 | Ga0495586_0025230 | Ga0495586_0025230_1322_2269 | 313 |
| 116 | 3300046557 | Ga0495622_0121484 | Ga0495622_0121484_218_1162 | 313 |
| 117 | 3300046559 | Ga0495667_0134315 | Ga0495667_0134315_604_1548 | 313 |
| 118 | 3300046642 | Ga0495634_0034342 | Ga0495634_0034342_1539_2486 | 313 |
| 119 | 3300046678 | Ga0495599_0218216 | Ga0495599_0218216_176_1123 | 313 |
| 120 | 3300047319 | Ga0495674_0003047 | Ga0495674_0003047_6817_7764 | 313 |
| 121 | 3300047322 | Ga0495680_0083780 | Ga0495680_0083780_295_1239 | 313 |
| 122 | 3300048910 | Ga0496107_0051959 | Ga0496107_0051959_1908_2855 | 313 |
| 123 | 3300048912 | Ga0496109_0216231 | Ga0496109_0216231_150_1094 | 313 |
| 124 | 3300048913 | Ga0496110_0521332 | Ga0496110_0521332_10_954 | 313 |
| 125 | 3300048915 | Ga0496112_0337574 | Ga0496112_0337574_28_972 | 313 |
| 126 | 3300048917 | Ga0496114_0005958 | Ga0496114_0005958_3606_4550 | 313 |
| 127 | 3300048917 | Ga0496114_0195198 | Ga0496114_0195198_296_1240 | 313 |
| 128 | 3300048918 | Ga0496115_0031232 | Ga0496115_0031232_1538_2482 | 313 |
| 129 | 3300048918 | Ga0496115_0040698 | Ga0496115_0040698_1386_2330 | 313 |
| 130 | 3300049585 | Ga0501069_0012161 | Ga0501069_0012161_3210_4154 | 313 |
| 131 | 3300049589 | Ga0501073_0015088 | Ga0501073_0015088_289_1233 | 313 |
| 132 | 3300050511 | nmdc:mga08y16_1823_c1 | nmdc:mga08y16_1823_c1_103_1047 | 313 |
| 133 | 3300053077 | Ga0495601_0040090 | Ga0495601_0040090_1458_2402 | 313 |
| 134 | 3300005434 | Ga0070709_10265068 | Ga0070709_102650682 | 314 |
| 135 | 3300026041 | Ga0207639_10095670 | Ga0207639_100956702 | 314 |
| 136 | 3300005336 | Ga0070680_100113202 | Ga0070680_1001132022 | 315 |
| 137 | 3300005530 | Ga0070679_100091771 | Ga0070679_1000917712 | 315 |
| 138 | 3300025921 | Ga0207652_10085774 | Ga0207652_100857742 | 315 |
| 139 | iso_pu_bacteria | 2524023250 | 2524609282 | 316 |
| 140 | 3300005437 | Ga0070710_10042211 | Ga0070710_100422112 | 317 |
| 141 | 3300005439 | Ga0070711_100225508 | Ga0070711_1002255082 | 317 |
| 142 | 3300005563 | Ga0068855_100024622 | Ga0068855_1000246224 | 317 |
| 143 | 3300009551 | Ga0105238_10326817 | Ga0105238_103268172 | 317 |
| 144 | 3300025898 | Ga0207692_10039784 | Ga0207692_100397843 | 317 |
| 145 | 3300049587 | Ga0501071_0364499 | Ga0501071_0364499_118_1074 | 318 |
| 146 | 3300028666 | Ga0265336_10019642 | Ga0265336_100196423 | 320 |
| 147 | 3300031238 | Ga0265332_10081396 | Ga0265332_100813962 | 320 |
| 148 | 3300031249 | Ga0265339_10064065 | Ga0265339_100640653 | 320 |
| 149 | 3300031711 | Ga0265314_10010573 | Ga0265314_100105732 | 320 |
| 150 | 3300031712 | Ga0265342_10000171 | Ga0265342_1000017131 | 320 |
| 151 | 3300035117 | Ga0373953_0124073 | Ga0373953_0124073_18_992 | 320 |
| 152 | 3300035119 | Ga0373956_0009099 | Ga0373956_0009099_1883_2857 | 320 |
| 153 | 3300035172 | Ga0373955_0100721 | Ga0373955_0100721_82_1056 | 320 |
| 154 | 3300036401 | Ga0373937_0014115 | Ga0373937_0014115_5282_6256 | 320 |
| 155 | 3300060353 | Ga0501082_0173200 | Ga0501082_0173200_484_1632 | 320 |
| 156 | 3300005614 | Ga0068856_100015178 | Ga0068856_1000151783 | 321 |
| 157 | 3300009545 | Ga0105237_10225992 | Ga0105237_102259922 | 321 |
| 158 | 3300026078 | Ga0207702_10101668 | Ga0207702_101016682 | 321 |
| 159 | 3300005617 | Ga0068859_100006336 | Ga0068859_1000063364 | 323 |
| 160 | 3300006931 | Ga0097620_100006336 | Ga0097620_1000063364 | 323 |
| 161 | 3300025924 | Ga0207694_10010377 | Ga0207694_100103772 | 323 |
| 162 | 3300025949 | Ga0207667_10057650 | Ga0207667_100576502 | 323 |
| 163 | 3300053125 | Ga0500618_004035 | Ga0500618_004035_1850_2824 | 324 |
| 164 | iso_pu_bacteria | 8057132660 | 8057135907 | 326 |
| 165 | 3300031901 | Ga0307406_10088583 | Ga0307406_100885832 | 329 |
| 166 | 3300037418 | Ga0395900_0027238 | Ga0395900_0027238_4428_5435 | 329 |
| 167 | 3300037466 | Ga0395898_0002612 | Ga0395898_0002612_2884_3891 | 329 |
| 168 | 3300038443 | Ga0395901_0027239 | Ga0395901_0027239_4708_5715 | 329 |
| 169 | iso_pu_bacteria | 2978969890 | 2978975054 | 333 |
| 170 | 3300046519 | Ga0495632_0009788 | Ga0495632_0009788_2890_3909 | 335 |
| 171 | 3300046522 | Ga0495643_0002657 | Ga0495643_0002657_4112_5131 | 335 |
| 172 | 3300046660 | Ga0495625_0068701 | Ga0495625_0068701_1209_2228 | 335 |
| 173 | 3300046694 | Ga0495649_0000467 | Ga0495649_0000467_9127_10146 | 335 |
| 174 | 3300053153 | Ga0500616_0084920 | Ga0500616_0084920_402_1421 | 335 |
| 175 | 3300053156 | Ga0500622_0000064 | Ga0500622_0000064_90581_91600 | 335 |
| 176 | iso_pu_bacteria | 2894232714 | 2894233536 | 335 |
| 177 | 3300003187 | JGI25151J46595_10012709 | JGI25151J46595_100127097 | 338 |
| 178 | 3300025294 | Ga0209025_1000496 | Ga0209025_100049657 | 338 |
| 179 | iso_pu_bacteria | 2854916844 | 2854921091 | 338 |
| 180 | iso_pu_bacteria | 2524023209 | 2524457387 | 339 |
| 181 | iso_pu_bacteria | 2842298080 | 2842299056 | 339 |
| 182 | iso_pu_bacteria | 2842357229 | 2842358521 | 339 |
| 183 | iso_pu_bacteria | 8055431914 | 8055432529 | 339 |
| 184 | iso_pu_bacteria | 2842495871 | 2842501507 | 340 |
| 185 | iso_pu_bacteria | 8024501048 | 8024501973 | 340 |
| 186 | 3300003792 | Ga0055540_1000157 | Ga0055540_100015751 | 341 |
| 187 | 3300025298 | Ga0209050_1001362 | Ga0209050_100136214 | 341 |
| 188 | 3300025303 | Ga0209051_1000032 | Ga0209051_1000032115 | 341 |
| 189 | 3300025304 | Ga0209257_1005776 | Ga0209257_10057767 | 341 |
| 190 | iso_pu_bacteria | 2509276021 | 2509386374 | 341 |
| 191 | iso_pu_bacteria | 2615840624 | 2616294504 | 341 |
| 192 | iso_pu_bacteria | 2718217927 | 2719388806 | 341 |
| 193 | iso_pu_bacteria | 2718217997 | 2719668572 | 341 |
| 194 | iso_pu_bacteria | 2718218199 | 2720489265 | 341 |
| 195 | iso_pu_bacteria | 2718218232 | 2720609946 | 341 |
| 196 | iso_pu_bacteria | 2718218233 | 2720617370 | 341 |
| 197 | iso_pu_bacteria | 2718218235 | 2720628516 | 341 |
| 198 | iso_pu_bacteria | 2718218269 | 2720772465 | 341 |
| 199 | iso_pu_bacteria | 2718218423 | 2721402495 | 341 |
| 200 | iso_pu_bacteria | 2721755556 | 2723029901 | 341 |
| 201 | iso_pu_bacteria | 2721755684 | 2723564310 | 341 |
| 202 | iso_pu_bacteria | 2721755685 | 2723570049 | 341 |
| 203 | iso_pu_bacteria | 2721755809 | 2724034561 | 341 |
| 204 | iso_pu_bacteria | 2721755819 | 2724092494 | 341 |
| 205 | iso_pu_bacteria | 2721755822 | 2724101596 | 341 |
| 206 | iso_pu_bacteria | 2721755823 | 2724112871 | 341 |
| 207 | iso_pu_bacteria | 2728369352 | 2730110434 | 341 |
| 208 | iso_pu_bacteria | 2791355259 | 2793317091 | 341 |
| 209 | iso_pu_bacteria | 2791355260 | 2793322605 | 341 |
| 210 | iso_pu_bacteria | 2791355267 | 2793370988 | 341 |
| 211 | iso_pu_bacteria | 2838016132 | 2838016223 | 341 |
| 212 | iso_pu_bacteria | 2838022645 | 2838024682 | 341 |
| 213 | iso_pu_bacteria | 2838048938 | 2838049687 | 341 |
| 214 | iso_pu_bacteria | 2838061910 | 2838061954 | 341 |
| 215 | iso_pu_bacteria | 2838068647 | 2838068756 | 341 |
| 216 | iso_pu_bacteria | 2842198810 | 2842200213 | 341 |
| 217 | iso_pu_bacteria | 2842264693 | 2842265093 | 341 |
| 218 | iso_pu_bacteria | 2842285085 | 2842288196 | 341 |
| 219 | iso_pu_bacteria | 2842311132 | 2842315712 | 341 |
| 220 | iso_pu_bacteria | 2842402390 | 2842405462 | 341 |
| 221 | iso_pu_bacteria | 2842409023 | 2842411781 | 341 |
| 222 | iso_pu_bacteria | 2842415677 | 2842418692 | 341 |
| 223 | iso_pu_bacteria | 2842422224 | 2842422902 | 341 |
| 224 | iso_pu_bacteria | 2842428310 | 2842428853 | 341 |
| 225 | iso_pu_bacteria | 2842434925 | 2842435466 | 341 |
| 226 | iso_pu_bacteria | 2842441272 | 2842441671 | 341 |
| 227 | iso_pu_bacteria | 2842447887 | 2842448287 | 341 |
| 228 | iso_pu_bacteria | 2842462802 | 2842463277 | 341 |
| 229 | iso_pu_bacteria | 2842469257 | 2842469797 | 341 |
| 230 | iso_pu_bacteria | 2933599457 | 2933600374 | 341 |
| 231 | iso_pu_bacteria | 8005275841 | 8005276217 | 341 |
| 232 | iso_pu_bacteria | 8005282627 | 8005288598 | 341 |
| 233 | iso_pu_bacteria | 8005289223 | 8005292283 | 341 |
| 234 | iso_pu_bacteria | 8005382845 | 8005384283 | 341 |
| 235 | iso_pu_bacteria | 8005395548 | 8005401634 | 341 |
| 236 | iso_pu_bacteria | 8005430974 | 8005431517 | 341 |
| 237 | iso_pu_bacteria | 8005497431 | 8005502821 | 341 |
| 238 | iso_pu_bacteria | 8005619151 | 8005623969 | 341 |
| 239 | iso_pu_bacteria | 8005626139 | 8005629234 | 341 |
| 240 | iso_pu_bacteria | 8005668836 | 8005674251 | 341 |
| 241 | iso_pu_bacteria | 8018127388 | 8018129094 | 341 |
| 242 | iso_pu_bacteria | 8018176218 | 8018179342 | 341 |
| 243 | 3300028379 | Ga0268266_10045617 | Ga0268266_100456171 | 342 |
| 244 | 3300048925 | Ga0496122_0000074 | Ga0496122_0000074_203375_204415 | 342 |
| 245 | 3300048926 | Ga0496123_0000062 | Ga0496123_0000062_203357_204397 | 342 |
| 246 | iso_pu_bacteria | 2917554339 | 2917556987 | 342 |
| 247 | 3300031731 | Ga0307405_10121144 | Ga0307405_101211441 | 343 |
| 248 | 3300059492 | Ga0587073_0000237 | Ga0587073_0000237_2094_3125 | 343 |
| 249 | 3300059505 | Ga0587083_0005805 | Ga0587083_0005805_611_1642 | 343 |
| 250 | 3300059508 | Ga0587088_000319 | Ga0587088_000319_1118_2149 | 343 |
| 251 | 3300059509 | Ga0587089_003116 | Ga0587089_003116_579_1610 | 343 |
| 252 | 3300059510 | Ga0587090_003632 | Ga0587090_003632_560_1591 | 343 |
| 253 | 3300059511 | Ga0587091_004968 | Ga0587091_004968_673_1704 | 343 |
| 254 | 3300059652 | Ga0587107_001936 | Ga0587107_001936_611_1642 | 343 |
| 255 | 3300059655 | Ga0587114_000120 | Ga0587114_000120_1471_2502 | 343 |
| 256 | iso_pu_bacteria | 2510065019 | 2510135569 | 343 |
| 257 | iso_pu_bacteria | 2517093000 | 2517100031 | 343 |
| 258 | iso_pu_bacteria | 2517287029 | 2517409665 | 343 |
| 259 | iso_pu_bacteria | 2585427526 | 2585530144 | 343 |
| 260 | iso_pu_bacteria | 2857516855 | 2857521457 | 343 |
| 261 | iso_pu_bacteria | 8056875544 | 8056877704 | 343 |
| 262 | 3300027111 | Ga0209281_1000514 | Ga0209281_100051427 | 346 |
| 263 | 3300046512 | Ga0495610_0000518 | Ga0495610_0000518_21130_22173 | 346 |
| 264 | 3300046515 | Ga0495620_0022284 | Ga0495620_0022284_1679_2722 | 346 |
| 265 | 3300047472 | Ga0495686_0037332 | Ga0495686_0037332_1708_2751 | 346 |
| 266 | iso_pu_bacteria | 8045864390 | 8045868205 | 346 |
| 267 | 3300002739 | JGI25158J39367_1001686 | JGI25158J39367_10016862 | 347 |
| 268 | 3300002773 | JGI25152J39213_1004110 | JGI25152J39213_10041104 | 347 |
| 269 | 3300002987 | JGI25159J45721_1000593 | JGI25159J45721_10005937 | 347 |
| 270 | 3300003320 | rootH2_10263051 | rootH2_102630512 | 347 |
| 271 | 3300003354 | JGI25160J50197_1001174 | JGI25160J50197_10011744 | 347 |
| 272 | 3300003374 | JGI25161J50226_1000029 | JGI25161J50226_1000029167 | 347 |
| 273 | 3300004625 | Ga0055543_1000016 | Ga0055543_100001680 | 347 |
| 274 | 3300005262 | Ga0065165_1002037 | Ga0065165_100203712 | 347 |
| 275 | 3300025208 | Ga0209436_100003 | Ga0209436_100003235 | 347 |
| 276 | 3300025245 | Ga0207425_1005937 | Ga0207425_10059373 | 347 |
| 277 | 3300025258 | Ga0209129_1001134 | Ga0209129_100113412 | 347 |
| 278 | 3300025273 | Ga0209673_1014435 | Ga0209673_10144352 | 347 |
| 279 | 3300025284 | Ga0209130_1000051 | Ga0209130_1000051103 | 347 |
| 280 | 3300025299 | Ga0209256_1002750 | Ga0209256_100275012 | 347 |
| 281 | 3300025302 | Ga0207426_1000043 | Ga0207426_1000043321 | 347 |
| 282 | 3300025302 | Ga0207426_1001061 | Ga0207426_100106113 | 347 |
| 283 | 3300025303 | Ga0209051_1030795 | Ga0209051_10307952 | 347 |
| 284 | 3300025304 | Ga0209257_1034655 | Ga0209257_10346551 | 347 |
| 285 | 3300041413 | Ga0439465_0000227 | Ga0439465_0000227_11342_12385 | 347 |
| 286 | 3300041509 | Ga0451843_0515067 | Ga0451843_0515067_3296_4354 | 347 |
| 287 | 3300041512 | Ga0451853_0912432 | Ga0451853_0912432_6860_7918 | 347 |
| 288 | 3300046460 | Ga0495638_0159034 | Ga0495638_0159034_43_1101 | 347 |
| 289 | 3300046507 | Ga0495606_0029830 | Ga0495606_0029830_2609_3667 | 347 |
| 290 | 3300046522 | Ga0495643_0027410 | Ga0495643_0027410_1966_3024 | 347 |
| 291 | 3300046542 | Ga0495597_0013308 | Ga0495597_0013308_15_1073 | 347 |
| 292 | 3300046810 | Ga0495660_0005149 | Ga0495660_0005149_2044_3102 | 347 |
| 293 | 3300047472 | Ga0495686_0055674 | Ga0495686_0055674_1401_2459 | 347 |
| 294 | 3300049573 | Ga0501037_0018084 | Ga0501037_0018084_3381_4445 | 347 |
| 295 | 3300049575 | Ga0501039_0113718 | Ga0501039_0113718_564_1628 | 347 |
| 296 | 3300049758 | Ga0501241_007395 | Ga0501241_007395_95_1138 | 347 |
| 297 | 3300049823 | Ga0501044_0058557 | Ga0501044_0058557_1183_2247 | 347 |
| 298 | 3300053158 | Ga0500627_0005208 | Ga0500627_0005208_2096_3154 | 347 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lk3-assembly1.cif.gz_D | crystal structure of human udp-xylose synthase r236a substitution | 0.9711 | 11 | 322 |
| 4m55-assembly1.cif.gz_D | crystal structure of human udp-xylose synthase r236h substitution | 0.9705 | 11 | 320 |
| 2b69-assembly1.cif.gz_A | crystal structure of human udp-glucoronic acid decarboxylase | 0.969 | 11 | 322 |
| 4lk3-assembly1.cif.gz_C | crystal structure of human udp-xylose synthase r236a substitution | 0.9686 | 11 | 322 |
| 4lk3-assembly1.cif.gz_B | crystal structure of human udp-xylose synthase r236a substitution | 0.9676 | 11 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4E0S3_8_323_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9726 | 11 | 322 | 3.40.50.720 |
| af_A0A1D6N7M5_279_504_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9721 | 100 | 322 | 3.40.50.720 |
| af_A0A0R0KMW5_231_418_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9719 | 133 | 321 | 3.40.50.720 |
| 4lk3E00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9634 | 11 | 322 | 3.40.50.720 |
| af_B7ZXP4_113_239_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9631 | 9 | 136 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520Y571-F1-model_v4 | UDP-glucuronate decarboxylase (EC 4.1.1.35) | 0.986 | 11 | 324 |
GO:0005737
GO:0016020 GO:0033320 GO:0042732 GO:0048040 GO:0070403 |
| AF-A0A1F6M884-F1-model_v4 | UDP-glucuronate decarboxylase (EC 4.1.1.35) | 0.9841 | 11 | 321 |
GO:0005737
GO:0016020 GO:0033320 GO:0042732 GO:0048040 GO:0070403 |
| AF-A0A2W7KEV9-F1-model_v4 | deleted | 0.9828 | 10 | 322 |
|
| AF-A0A1R1I760-F1-model_v4 | UDP-glucuronate decarboxylase (EC 4.1.1.35) | 0.9828 | 10 | 320 |
GO:0005737
GO:0016020 GO:0033320 GO:0042732 GO:0048040 GO:0070403 |
| AF-A0A7R7THY1-F1-model_v4 | deleted | 0.9828 | 12 | 322 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar