F394593

General Info

Members Datasets Scaffolds Average Seq Length
298 255 225 328

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8045864390|8045868205
Length 367
Sequence ELDSTGSQARQAESEPRGGEQSPGLPRSDLKRVLVTGGAGFLGSHLCELLLRRGHRVTCVDNLQTGSTANLSRFGASNRFTFIERDICETLPASLEVDEIYNLACAASPPRYQADPVHTMMTCVVGTNNILEIAERCGARLVHASTSEVYGDPLQHPQTETYWGNVNPTGPRACYDEGKRAAETLTFDYLRAGRVDARVVRIFNTYGPRMQPDDGRIVSNLICQALAGDAMTLYGTGEQTRSFCYVTDLIAGIVALMEVEPNPEQPVNLGNPGEFTIRELAEVVVRLTGSRSPIAHLPLPQDDPQRRRPDITLARSLLGWEPKVTLVEGLEPTIAWFSGAQSDENREWSGTRASSKAAYSFAETNLT

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
4 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
5 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
6 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
7 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
8 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
9 2718217927 Rhizobium sp. N324 Isolate Nodule
10 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
11 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
12 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
13 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
14 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
15 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
16 2718218423 Rhizobium sp. N941 Isolate Nodule
17 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
18 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
19 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
20 2721755809 Rhizobium sp. N541 Isolate Nodule
21 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
22 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
23 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
24 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
25 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
26 2791355260 Rhizobium sp. L9 Isolate Nodule
27 2791355267 Rhizobium sp. L18 Isolate Nodule
28 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
29 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
30 2838048938 Rhizobium pisi 27/80 Isolate Nodule
31 2838061910 Rhizobium phaseoli L15 Isolate Nodule
32 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
33 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
34 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
35 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
36 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
37 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
38 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
39 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
40 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
41 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
42 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
43 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
44 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
45 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
46 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
47 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
48 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
49 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
50 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
51 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
52 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
53 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
54 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
55 2933599457 Rhizobium phaseoli M3 Isolate Nodule
56 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
57 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
58 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
62 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
63 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
64 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
65 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
66 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
67 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
68 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
69 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
70 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
71 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
72 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
84 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
85 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
86 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
90 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
91 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
92 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
96 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
239 8005275841 Rhizobium sp. N4311 Isolate Nodule
240 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
241 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
242 8005382845 Rhizobium sp. R634 Isolate Nodule
243 8005395548 Rhizobium sp. R339 Isolate Nodule
244 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
245 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
246 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
247 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
248 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
249 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
250 8018176218 Rhizobium sp. N122 Isolate Nodule
251 8024501048 Rhizobium sp. H4 Isolate Nodule
252 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
253 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
254 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
255 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.82
Metatranscriptomes 2.68
Isolates 24.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.07
Nodule 20.47
Rhizoplane 3.02
Rhizosphere 60.4
Stem 0
Stem Tuber 0
Unclassified 5.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001686 3300002739 Bacteria 3794
2 JGI25152J39213_1004110 3300002773 Bacteria 4703
3 JGI25159J45721_1000593 3300002987 Bacteria 16177
4 JGI25151J46595_10012709 3300003187 Bacteria 3820
5 rootH2_10263051 3300003320 Bacteria 2241
6 JGI25160J50197_1001174 3300003354 Bacteria 13352
7 JGI25161J50226_1000029 3300003374 Bacteria 144998
8 Ga0055526_1013500 3300003771 Bacteria 3447
9 Ga0055524_1001211 3300003775 Bacteria 15291
10 Ga0055528_1040544 3300003790 Bacteria 1049
11 Ga0055540_1000157 3300003792 Bacteria 67204
12 Ga0055543_1000016 3300004625 Bacteria 176117
13 Ga0065165_1002037 3300005262 Bacteria 18769
14 Ga0070676_10004409 3300005328 Bacteria 7404
15 Ga0070683_100005137 3300005329 Bacteria 10886
16 Ga0070683_100361773 3300005329 Bacteria 1382
17 Ga0070690_100005846 3300005330 Bacteria 6932
18 Ga0070690_100046383 3300005330 Bacteria 2762
19 Ga0070680_100113202 3300005336 Bacteria 2260
20 Ga0070682_100215631 3300005337 Bacteria 1363
21 Ga0068868_100241483 3300005338 Bacteria 1518
22 Ga0070689_100019378 3300005340 Bacteria 5031
23 Ga0070689_100032932 3300005340 Bacteria 3946
24 Ga0070689_100048843 3300005340 Bacteria 3265
25 Ga0070669_100293637 3300005353 Bacteria 1305
26 Ga0070675_100532893 3300005354 Bacteria 1060
27 Ga0070671_100227660 3300005355 Bacteria 1582
28 Ga0070673_100032934 3300005364 Bacteria 3908
29 Ga0070688_100018694 3300005365 Bacteria 4004
30 Ga0070709_10265068 3300005434 Bacteria 1243
31 Ga0070710_10042211 3300005437 Bacteria 2521
32 Ga0070711_100225508 3300005439 Bacteria 1459
33 Ga0070705_100194310 3300005440 Bacteria 1386
34 Ga0070700_100002244 3300005441 Bacteria 9835
35 Ga0068867_100433911 3300005459 Bacteria 1116
36 Ga0070685_10093277 3300005466 Bacteria 1826
37 Ga0070685_10252145 3300005466 Bacteria 1169
38 Ga0070706_100152647 3300005467 Bacteria 2156
39 Ga0070698_100020498 3300005471 Bacteria 6930
40 Ga0070699_100000226 3300005518 Bacteria 55613
41 Ga0070699_100000614 3300005518 Bacteria 33674
42 Ga0070679_100009066 3300005530 Bacteria 9386
43 Ga0070679_100091771 3300005530 Bacteria 3025
44 Ga0070679_100214843 3300005530 Bacteria 1886
45 Ga0070684_100002301 3300005535 Bacteria 14094
46 Ga0068853_100147634 3300005539 Bacteria 2114
47 Ga0070672_100024338 3300005543 Bacteria 4473
48 Ga0070686_100006998 3300005544 Bacteria 6285
49 Ga0070686_100037176 3300005544 Bacteria 3019
50 Ga0068855_100024622 3300005563 Bacteria 7201
51 Ga0068856_100015178 3300005614 Bacteria 7441
52 Ga0068856_100420313 3300005614 Bacteria 1357
53 Ga0068859_100006336 3300005617 Bacteria 12002
54 Ga0068861_100073950 3300005719 Bacteria 2649
55 Ga0068863_100014862 3300005841 Bacteria 7479
56 Ga0068863_100080734 3300005841 Bacteria 3081
57 Ga0068858_100301149 3300005842 Bacteria 1530
58 Ga0070717_10114769 3300006028 Bacteria 2301
59 Ga0075429_100000766 3300006880 Bacteria 25329
60 Ga0068865_100022267 3300006881 Bacteria 4131
61 Ga0097620_100006336 3300006931 Bacteria 12002
62 Ga0111539_10007746 3300009094 Bacteria 13714
63 Ga0114129_10057043 3300009147 Bacteria 5468
64 Ga0105237_10225992 3300009545 Bacteria 1872
65 Ga0105238_10124852 3300009551 Bacteria 2553
66 Ga0105238_10326817 3300009551 Bacteria 1520
67 Ga0157374_10070889 3300013296 Bacteria 3285
68 Ga0157378_10287118 3300013297 Bacteria 1588
69 Ga0163163_10099231 3300014325 Bacteria 2934
70 Ga0157379_10168714 3300014968 Bacteria 1976
71 Ga0209436_100003 3300025208 Bacteria 220530
72 Ga0207425_1005937 3300025245 Bacteria 3410
73 Ga0209129_1001134 3300025258 Bacteria 15421
74 Ga0209673_1001180 3300025273 Bacteria 28315
75 Ga0209673_1014435 3300025273 Bacteria 3055
76 Ga0209130_1000051 3300025284 Bacteria 220482
77 Ga0209025_1000496 3300025294 Bacteria 75601
78 Ga0209564_1001136 3300025295 Bacteria 31269
79 Ga0209050_1001362 3300025298 Bacteria 26749
80 Ga0209256_1001136 3300025299 Bacteria 30339
81 Ga0209256_1002750 3300025299 Bacteria 13590
82 Ga0207426_1000043 3300025302 Bacteria 432827
83 Ga0207426_1001061 3300025302 Bacteria 26031
84 Ga0209051_1000032 3300025303 Bacteria 383445
85 Ga0209051_1030795 3300025303 Bacteria 2077
86 Ga0209257_1005776 3300025304 Bacteria 8435
87 Ga0209257_1034655 3300025304 Bacteria 1572
88 Ga0207692_10039784 3300025898 Bacteria 2316
89 Ga0207645_10001196 3300025907 Bacteria 21420
90 Ga0207684_10191025 3300025910 Bacteria 1767
91 Ga0207662_10029570 3300025918 Bacteria 3175
92 Ga0207652_10025900 3300025921 Bacteria 4880
93 Ga0207652_10085774 3300025921 Bacteria 2760
94 Ga0207681_10000585 3300025923 Bacteria 24828
95 Ga0207694_10010377 3300025924 Bacteria 7021
96 Ga0207670_10102415 3300025936 Bacteria 2047
97 Ga0207691_10023577 3300025940 Bacteria 5794
98 Ga0207691_10106406 3300025940 Bacteria 2498
99 Ga0207661_10013367 3300025944 Bacteria 5996
100 Ga0207661_10357974 3300025944 Bacteria 1318
101 Ga0207667_10057650 3300025949 Bacteria 4076
102 Ga0207639_10095670 3300026041 Bacteria 2387
103 Ga0207639_10167661 3300026041 Bacteria 1857
104 Ga0207708_10000630 3300026075 Bacteria 27098
105 Ga0207702_10101668 3300026078 Bacteria 2539
106 Ga0207641_10071677 3300026088 Bacteria 2981
107 Ga0207648_10082004 3300026089 Bacteria 2812
108 Ga0207675_100078546 3300026118 Bacteria 3092
109 Ga0207675_100185643 3300026118 Bacteria 1993
110 Ga0209281_1000514 3300027111 Bacteria 50622
111 Ga0207428_10029566 3300027907 Bacteria 4539
112 Ga0268266_10045617 3300028379 Bacteria 3750
113 Ga0265336_10019642 3300028666 Bacteria 2178
114 Ga0265338_10063202 3300028800 Bacteria 3229
115 Ga0265332_10053400 3300031238 Bacteria 1734
116 Ga0265332_10081396 3300031238 Bacteria 1373
117 Ga0265328_10003154 3300031239 Bacteria 7334
118 Ga0265320_10003883 3300031240 Bacteria 9892
119 Ga0265329_10035580 3300031242 Bacteria 1607
120 Ga0265340_10041792 3300031247 Bacteria 2253
121 Ga0265339_10006817 3300031249 Bacteria 7449
122 Ga0265339_10064065 3300031249 Bacteria 1972
123 Ga0265314_10000205 3300031711 Bacteria 87156
124 Ga0265314_10002294 3300031711 Bacteria 19784
125 Ga0265314_10010573 3300031711 Bacteria 7681
126 Ga0265342_10000171 3300031712 Bacteria 71706
127 Ga0265342_10001286 3300031712 Bacteria 23595
128 Ga0307405_10121144 3300031731 Bacteria 1790
129 Ga0307406_10088583 3300031901 Bacteria 2077
130 Ga0307416_100144319 3300032002 Bacteria 2170
131 Ga0373953_0124073 3300035117 Bacteria 1098
132 Ga0373954_0009901 3300035118 Bacteria 4198
133 Ga0373956_0009099 3300035119 Bacteria 4028
134 Ga0373956_0043456 3300035119 Bacteria 2001
135 Ga0373943_0002825 3300035170 Bacteria 7886
136 Ga0373955_0100721 3300035172 Bacteria 1658
137 Ga0373955_0100771 3300035172 Bacteria 1658
138 Ga0373927_0299689 3300035695 Bacteria 1058
139 Ga0373933_0062091 3300035724 Bacteria 2256
140 Ga0373933_0155441 3300035724 Bacteria 1450
141 Ga0373937_0014115 3300036401 Bacteria 7045
142 Ga0373937_0020981 3300036401 Bacteria 5859
143 Ga0373937_0218637 3300036401 Bacteria 1793
144 Ga0373925_0093620 3300037068 Bacteria 2300
145 Ga0373925_0132325 3300037068 Bacteria 1946
146 Ga0373925_0299967 3300037068 Bacteria 1297
147 Ga0395900_0027238 3300037418 Bacteria 5853
148 Ga0395898_0002612 3300037466 Bacteria 20986
149 Ga0395901_0027239 3300038443 Bacteria 5871
150 Ga0436365_1809956 3300039437 Bacteria 5401
151 Ga0439465_0000227 3300041413 Bacteria 15183
152 Ga0451843_0515067 3300041509 Bacteria 8287
153 Ga0451853_0912432 3300041512 Bacteria 11739
154 Ga0451576_0095165 3300045051 Bacteria 3098
155 Ga0495638_0159034 3300046460 Bacteria 1305
156 Ga0495641_0109486 3300046461 Bacteria 1232
157 Ga0495606_0029830 3300046507 Bacteria 3822
158 Ga0495610_0000518 3300046512 Bacteria 38760
159 Ga0495620_0022284 3300046515 Bacteria 3055
160 Ga0495630_0021831 3300046517 Bacteria 4727
161 Ga0495632_0009788 3300046519 Bacteria 5743
162 Ga0495643_0002657 3300046522 Bacteria 13855
163 Ga0495643_0027410 3300046522 Bacteria 3202
164 Ga0495586_0025230 3300046535 Bacteria 3179
165 Ga0495597_0013308 3300046542 Bacteria 3946
166 Ga0495622_0121484 3300046557 Bacteria 1192
167 Ga0495667_0134315 3300046559 Bacteria 1595
168 Ga0495634_0034342 3300046642 Bacteria 3481
169 Ga0495625_0068701 3300046660 Bacteria 2490
170 Ga0495599_0218216 3300046678 Bacteria 1168
171 Ga0495649_0000467 3300046694 Bacteria 34802
172 Ga0495660_0005149 3300046810 Bacteria 7857
173 Ga0495604_0230312 3300047317 Bacteria 1271
174 Ga0495674_0003047 3300047319 Bacteria 16301
175 Ga0495680_0083780 3300047322 Bacteria 2404
176 Ga0495686_0037332 3300047472 Bacteria 3113
177 Ga0495686_0055674 3300047472 Bacteria 2472
178 Ga0496107_0051959 3300048910 Bacteria 2957
179 Ga0496108_0415856 3300048911 Bacteria 1174
180 Ga0496109_0216231 3300048912 Bacteria 1802
181 Ga0496110_0521332 3300048913 Bacteria 1081
182 Ga0496112_0337574 3300048915 Bacteria 1450
183 Ga0496114_0005958 3300048917 Bacteria 9586
184 Ga0496114_0195198 3300048917 Bacteria 1772
185 Ga0496115_0031232 3300048918 Bacteria 4195
186 Ga0496115_0040698 3300048918 Bacteria 3696
187 Ga0496122_0000074 3300048925 Bacteria 219900
188 Ga0496123_0000062 3300048926 Bacteria 219882
189 Ga0501037_0018084 3300049573 Bacteria 5192
190 Ga0501039_0113718 3300049575 Bacteria 2117
191 Ga0501047_0062391 3300049581 Bacteria 3595
192 Ga0501068_0017667 3300049584 Bacteria 4127
193 Ga0501069_0012161 3300049585 Bacteria 4571
194 Ga0501070_0000007 3300049586 Bacteria 219869
195 Ga0501071_0364499 3300049587 Bacteria 1101
196 Ga0501073_0015088 3300049589 Bacteria 5605
197 Ga0501073_0034141 3300049589 Bacteria 3621
198 Ga0501074_0060448 3300049590 Bacteria 2730
199 Ga0501077_0009198 3300049593 Bacteria 6135
200 Ga0501083_0001063 3300049744 Bacteria 18310
201 Ga0501083_0001643 3300049744 Bacteria 15265
202 Ga0501241_007395 3300049758 Bacteria 2011
203 Ga0501044_0058557 3300049823 Bacteria 3950
204 nmdc:mga05p37_86365_c1 3300050507 Bacteria 3866
205 nmdc:mga09592_1511_c1 3300050508 Bacteria 18731
206 nmdc:mga08y16_1823_c1 3300050511 Bacteria 12393
207 Ga0495601_0040090 3300053077 Bacteria 2933
208 Ga0500618_004035 3300053125 Bacteria 4829
209 Ga0500616_0084920 3300053153 Bacteria 1582
210 Ga0500622_0000064 3300053156 Bacteria 127531
211 Ga0500627_0005208 3300053158 Bacteria 4292
212 Ga0501084_0009706 3300054114 Bacteria 7960
213 Ga0587073_0000237 3300059492 Bacteria 4382
214 Ga0587083_0005805 3300059505 Bacteria 1805
215 Ga0587088_000319 3300059508 Bacteria 3669
216 Ga0587089_003116 3300059509 Bacteria 1737
217 Ga0587090_003632 3300059510 Bacteria 1807
218 Ga0587091_004968 3300059511 Bacteria 1783
219 Ga0587107_001936 3300059652 Bacteria 1782
220 Ga0587114_000120 3300059655 Bacteria 3814
221 Ga0501082_0012651 3300060353 Bacteria 7253
222 Ga0501082_0017704 3300060353 Bacteria 6136
223 Ga0501082_0019570 3300060353 Bacteria 5838
224 Ga0501082_0173200 3300060353 Bacteria 1877
225 Ga0530510_0041791 3300061734 Bacteria 3311

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031238 Ga0265332_10053400 Ga0265332_100534002 284
2 3300031247 Ga0265340_10041792 Ga0265340_100417923 284
3 3300035172 Ga0373955_0100771 Ga0373955_0100771_746_1621 290
4 3300035724 Ga0373933_0062091 Ga0373933_0062091_1187_2065 291
5 3300048911 Ga0496108_0415856 Ga0496108_0415856_284_1162 291
6 3300025918 Ga0207662_10029570 Ga0207662_100295701 295
7 iso_pu_bacteria 2933016740 2933022792 295
8 3300003771 Ga0055526_1013500 Ga0055526_10135003 303
9 3300003775 Ga0055524_1001211 Ga0055524_10012117 303
10 3300003790 Ga0055528_1040544 Ga0055528_10405441 303
11 3300025273 Ga0209673_1001180 Ga0209673_100118019 303
12 3300025295 Ga0209564_1001136 Ga0209564_100113624 303
13 3300025299 Ga0209256_1001136 Ga0209256_10011367 303
14 3300005543 Ga0070672_100024338 Ga0070672_1000243382 307
15 3300006028 Ga0070717_10114769 Ga0070717_101147692 307
16 3300025940 Ga0207691_10106406 Ga0207691_101064063 307
17 3300037068 Ga0373925_0299967 Ga0373925_0299967_202_1128 307
18 3300047317 Ga0495604_0230312 Ga0495604_0230312_334_1260 307
19 3300006880 Ga0075429_100000766 Ga0075429_10000076623 309
20 3300009147 Ga0114129_10057043 Ga0114129_100570436 309
21 3300050507 nmdc:mga05p37_86365_c1 nmdc:mga05p37_86365_c1_2126_3055 309
22 3300050508 nmdc:mga09592_1511_c1 nmdc:mga09592_1511_c1_5934_6863 309
23 3300049581 Ga0501047_0062391 Ga0501047_0062391_664_1605 310
24 3300049744 Ga0501083_0001063 Ga0501083_0001063_15099_16040 310
25 3300054114 Ga0501084_0009706 Ga0501084_0009706_3871_4812 310
26 3300060353 Ga0501082_0019570 Ga0501082_0019570_3253_4194 310
27 3300005440 Ga0070705_100194310 Ga0070705_1001943102 311
28 3300005467 Ga0070706_100152647 Ga0070706_1001526472 311
29 3300005471 Ga0070698_100020498 Ga0070698_1000204982 311
30 3300005518 Ga0070699_100000226 Ga0070699_10000022643 311
31 3300005518 Ga0070699_100000614 Ga0070699_10000061433 311
32 3300005841 Ga0068863_100014862 Ga0068863_1000148624 311
33 3300014325 Ga0163163_10099231 Ga0163163_100992312 311
34 3300014968 Ga0157379_10168714 Ga0157379_101687142 311
35 3300025910 Ga0207684_10191025 Ga0207684_101910252 311
36 3300031711 Ga0265314_10000205 Ga0265314_1000020578 311
37 3300049593 Ga0501077_0009198 Ga0501077_0009198_2213_3148 311
38 3300032002 Ga0307416_100144319 Ga0307416_1001443192 312
39 3300049584 Ga0501068_0017667 Ga0501068_0017667_2874_3815 312
40 3300049586 Ga0501070_0000007 Ga0501070_0000007_147486_148427 312
41 3300049589 Ga0501073_0034141 Ga0501073_0034141_788_1729 312
42 3300049590 Ga0501074_0060448 Ga0501074_0060448_56_997 312
43 3300049744 Ga0501083_0001643 Ga0501083_0001643_12270_13211 312
44 3300060353 Ga0501082_0012651 Ga0501082_0012651_4984_5925 312
45 3300060353 Ga0501082_0017704 Ga0501082_0017704_4425_5366 312
46 3300061734 Ga0530510_0041791 Ga0530510_0041791_2291_3232 312
47 3300005328 Ga0070676_10004409 Ga0070676_100044091 313
48 3300005329 Ga0070683_100005137 Ga0070683_1000051378 313
49 3300005329 Ga0070683_100361773 Ga0070683_1003617732 313
50 3300005330 Ga0070690_100005846 Ga0070690_1000058462 313
51 3300005330 Ga0070690_100046383 Ga0070690_1000463831 313
52 3300005337 Ga0070682_100215631 Ga0070682_1002156311 313
53 3300005338 Ga0068868_100241483 Ga0068868_1002414832 313
54 3300005340 Ga0070689_100019378 Ga0070689_1000193784 313
55 3300005340 Ga0070689_100032932 Ga0070689_1000329323 313
56 3300005340 Ga0070689_100048843 Ga0070689_1000488432 313
57 3300005353 Ga0070669_100293637 Ga0070669_1002936371 313
58 3300005354 Ga0070675_100532893 Ga0070675_1005328931 313
59 3300005355 Ga0070671_100227660 Ga0070671_1002276602 313
60 3300005364 Ga0070673_100032934 Ga0070673_1000329342 313
61 3300005365 Ga0070688_100018694 Ga0070688_1000186942 313
62 3300005441 Ga0070700_100002244 Ga0070700_1000022442 313
63 3300005459 Ga0068867_100433911 Ga0068867_1004339111 313
64 3300005466 Ga0070685_10093277 Ga0070685_100932772 313
65 3300005466 Ga0070685_10252145 Ga0070685_102521451 313
66 3300005530 Ga0070679_100009066 Ga0070679_1000090665 313
67 3300005530 Ga0070679_100214843 Ga0070679_1002148432 313
68 3300005535 Ga0070684_100002301 Ga0070684_1000023017 313
69 3300005539 Ga0068853_100147634 Ga0068853_1001476342 313
70 3300005544 Ga0070686_100006998 Ga0070686_1000069984 313
71 3300005544 Ga0070686_100037176 Ga0070686_1000371761 313
72 3300005614 Ga0068856_100420313 Ga0068856_1004203131 313
73 3300005719 Ga0068861_100073950 Ga0068861_1000739503 313
74 3300005841 Ga0068863_100080734 Ga0068863_1000807342 313
75 3300005842 Ga0068858_100301149 Ga0068858_1003011492 313
76 3300006881 Ga0068865_100022267 Ga0068865_1000222673 313
77 3300009094 Ga0111539_10007746 Ga0111539_1000774611 313
78 3300009551 Ga0105238_10124852 Ga0105238_101248522 313
79 3300013296 Ga0157374_10070889 Ga0157374_100708894 313
80 3300013297 Ga0157378_10287118 Ga0157378_102871182 313
81 3300025907 Ga0207645_10001196 Ga0207645_1000119617 313
82 3300025921 Ga0207652_10025900 Ga0207652_100259005 313
83 3300025923 Ga0207681_10000585 Ga0207681_1000058511 313
84 3300025936 Ga0207670_10102415 Ga0207670_101024152 313
85 3300025940 Ga0207691_10023577 Ga0207691_100235771 313
86 3300025944 Ga0207661_10013367 Ga0207661_100133673 313
87 3300025944 Ga0207661_10357974 Ga0207661_103579742 313
88 3300026041 Ga0207639_10167661 Ga0207639_101676612 313
89 3300026075 Ga0207708_10000630 Ga0207708_1000063017 313
90 3300026088 Ga0207641_10071677 Ga0207641_100716772 313
91 3300026089 Ga0207648_10082004 Ga0207648_100820042 313
92 3300026118 Ga0207675_100078546 Ga0207675_1000785463 313
93 3300026118 Ga0207675_100185643 Ga0207675_1001856432 313
94 3300027907 Ga0207428_10029566 Ga0207428_100295661 313
95 3300028800 Ga0265338_10063202 Ga0265338_100632022 313
96 3300031239 Ga0265328_10003154 Ga0265328_100031542 313
97 3300031240 Ga0265320_10003883 Ga0265320_100038839 313
98 3300031242 Ga0265329_10035580 Ga0265329_100355802 313
99 3300031249 Ga0265339_10006817 Ga0265339_100068177 313
100 3300031711 Ga0265314_10002294 Ga0265314_1000229416 313
101 3300031712 Ga0265342_10001286 Ga0265342_1000128610 313
102 3300035118 Ga0373954_0009901 Ga0373954_0009901_1310_2254 313
103 3300035119 Ga0373956_0043456 Ga0373956_0043456_706_1650 313
104 3300035170 Ga0373943_0002825 Ga0373943_0002825_2888_3832 313
105 3300035695 Ga0373927_0299689 Ga0373927_0299689_49_993 313
106 3300035724 Ga0373933_0155441 Ga0373933_0155441_358_1302 313
107 3300036401 Ga0373937_0020981 Ga0373937_0020981_4384_5328 313
108 3300036401 Ga0373937_0218637 Ga0373937_0218637_314_1258 313
109 3300037068 Ga0373925_0093620 Ga0373925_0093620_951_1895 313
110 3300037068 Ga0373925_0132325 Ga0373925_0132325_687_1637 313
111 3300039437 Ga0436365_1809956 Ga0436365_1809956_1746_2690 313
112 3300045051 Ga0451576_0095165 Ga0451576_0095165_1888_2832 313
113 3300046461 Ga0495641_0109486 Ga0495641_0109486_40_984 313
114 3300046517 Ga0495630_0021831 Ga0495630_0021831_1953_2900 313
115 3300046535 Ga0495586_0025230 Ga0495586_0025230_1322_2269 313
116 3300046557 Ga0495622_0121484 Ga0495622_0121484_218_1162 313
117 3300046559 Ga0495667_0134315 Ga0495667_0134315_604_1548 313
118 3300046642 Ga0495634_0034342 Ga0495634_0034342_1539_2486 313
119 3300046678 Ga0495599_0218216 Ga0495599_0218216_176_1123 313
120 3300047319 Ga0495674_0003047 Ga0495674_0003047_6817_7764 313
121 3300047322 Ga0495680_0083780 Ga0495680_0083780_295_1239 313
122 3300048910 Ga0496107_0051959 Ga0496107_0051959_1908_2855 313
123 3300048912 Ga0496109_0216231 Ga0496109_0216231_150_1094 313
124 3300048913 Ga0496110_0521332 Ga0496110_0521332_10_954 313
125 3300048915 Ga0496112_0337574 Ga0496112_0337574_28_972 313
126 3300048917 Ga0496114_0005958 Ga0496114_0005958_3606_4550 313
127 3300048917 Ga0496114_0195198 Ga0496114_0195198_296_1240 313
128 3300048918 Ga0496115_0031232 Ga0496115_0031232_1538_2482 313
129 3300048918 Ga0496115_0040698 Ga0496115_0040698_1386_2330 313
130 3300049585 Ga0501069_0012161 Ga0501069_0012161_3210_4154 313
131 3300049589 Ga0501073_0015088 Ga0501073_0015088_289_1233 313
132 3300050511 nmdc:mga08y16_1823_c1 nmdc:mga08y16_1823_c1_103_1047 313
133 3300053077 Ga0495601_0040090 Ga0495601_0040090_1458_2402 313
134 3300005434 Ga0070709_10265068 Ga0070709_102650682 314
135 3300026041 Ga0207639_10095670 Ga0207639_100956702 314
136 3300005336 Ga0070680_100113202 Ga0070680_1001132022 315
137 3300005530 Ga0070679_100091771 Ga0070679_1000917712 315
138 3300025921 Ga0207652_10085774 Ga0207652_100857742 315
139 iso_pu_bacteria 2524023250 2524609282 316
140 3300005437 Ga0070710_10042211 Ga0070710_100422112 317
141 3300005439 Ga0070711_100225508 Ga0070711_1002255082 317
142 3300005563 Ga0068855_100024622 Ga0068855_1000246224 317
143 3300009551 Ga0105238_10326817 Ga0105238_103268172 317
144 3300025898 Ga0207692_10039784 Ga0207692_100397843 317
145 3300049587 Ga0501071_0364499 Ga0501071_0364499_118_1074 318
146 3300028666 Ga0265336_10019642 Ga0265336_100196423 320
147 3300031238 Ga0265332_10081396 Ga0265332_100813962 320
148 3300031249 Ga0265339_10064065 Ga0265339_100640653 320
149 3300031711 Ga0265314_10010573 Ga0265314_100105732 320
150 3300031712 Ga0265342_10000171 Ga0265342_1000017131 320
151 3300035117 Ga0373953_0124073 Ga0373953_0124073_18_992 320
152 3300035119 Ga0373956_0009099 Ga0373956_0009099_1883_2857 320
153 3300035172 Ga0373955_0100721 Ga0373955_0100721_82_1056 320
154 3300036401 Ga0373937_0014115 Ga0373937_0014115_5282_6256 320
155 3300060353 Ga0501082_0173200 Ga0501082_0173200_484_1632 320
156 3300005614 Ga0068856_100015178 Ga0068856_1000151783 321
157 3300009545 Ga0105237_10225992 Ga0105237_102259922 321
158 3300026078 Ga0207702_10101668 Ga0207702_101016682 321
159 3300005617 Ga0068859_100006336 Ga0068859_1000063364 323
160 3300006931 Ga0097620_100006336 Ga0097620_1000063364 323
161 3300025924 Ga0207694_10010377 Ga0207694_100103772 323
162 3300025949 Ga0207667_10057650 Ga0207667_100576502 323
163 3300053125 Ga0500618_004035 Ga0500618_004035_1850_2824 324
164 iso_pu_bacteria 8057132660 8057135907 326
165 3300031901 Ga0307406_10088583 Ga0307406_100885832 329
166 3300037418 Ga0395900_0027238 Ga0395900_0027238_4428_5435 329
167 3300037466 Ga0395898_0002612 Ga0395898_0002612_2884_3891 329
168 3300038443 Ga0395901_0027239 Ga0395901_0027239_4708_5715 329
169 iso_pu_bacteria 2978969890 2978975054 333
170 3300046519 Ga0495632_0009788 Ga0495632_0009788_2890_3909 335
171 3300046522 Ga0495643_0002657 Ga0495643_0002657_4112_5131 335
172 3300046660 Ga0495625_0068701 Ga0495625_0068701_1209_2228 335
173 3300046694 Ga0495649_0000467 Ga0495649_0000467_9127_10146 335
174 3300053153 Ga0500616_0084920 Ga0500616_0084920_402_1421 335
175 3300053156 Ga0500622_0000064 Ga0500622_0000064_90581_91600 335
176 iso_pu_bacteria 2894232714 2894233536 335
177 3300003187 JGI25151J46595_10012709 JGI25151J46595_100127097 338
178 3300025294 Ga0209025_1000496 Ga0209025_100049657 338
179 iso_pu_bacteria 2854916844 2854921091 338
180 iso_pu_bacteria 2524023209 2524457387 339
181 iso_pu_bacteria 2842298080 2842299056 339
182 iso_pu_bacteria 2842357229 2842358521 339
183 iso_pu_bacteria 8055431914 8055432529 339
184 iso_pu_bacteria 2842495871 2842501507 340
185 iso_pu_bacteria 8024501048 8024501973 340
186 3300003792 Ga0055540_1000157 Ga0055540_100015751 341
187 3300025298 Ga0209050_1001362 Ga0209050_100136214 341
188 3300025303 Ga0209051_1000032 Ga0209051_1000032115 341
189 3300025304 Ga0209257_1005776 Ga0209257_10057767 341
190 iso_pu_bacteria 2509276021 2509386374 341
191 iso_pu_bacteria 2615840624 2616294504 341
192 iso_pu_bacteria 2718217927 2719388806 341
193 iso_pu_bacteria 2718217997 2719668572 341
194 iso_pu_bacteria 2718218199 2720489265 341
195 iso_pu_bacteria 2718218232 2720609946 341
196 iso_pu_bacteria 2718218233 2720617370 341
197 iso_pu_bacteria 2718218235 2720628516 341
198 iso_pu_bacteria 2718218269 2720772465 341
199 iso_pu_bacteria 2718218423 2721402495 341
200 iso_pu_bacteria 2721755556 2723029901 341
201 iso_pu_bacteria 2721755684 2723564310 341
202 iso_pu_bacteria 2721755685 2723570049 341
203 iso_pu_bacteria 2721755809 2724034561 341
204 iso_pu_bacteria 2721755819 2724092494 341
205 iso_pu_bacteria 2721755822 2724101596 341
206 iso_pu_bacteria 2721755823 2724112871 341
207 iso_pu_bacteria 2728369352 2730110434 341
208 iso_pu_bacteria 2791355259 2793317091 341
209 iso_pu_bacteria 2791355260 2793322605 341
210 iso_pu_bacteria 2791355267 2793370988 341
211 iso_pu_bacteria 2838016132 2838016223 341
212 iso_pu_bacteria 2838022645 2838024682 341
213 iso_pu_bacteria 2838048938 2838049687 341
214 iso_pu_bacteria 2838061910 2838061954 341
215 iso_pu_bacteria 2838068647 2838068756 341
216 iso_pu_bacteria 2842198810 2842200213 341
217 iso_pu_bacteria 2842264693 2842265093 341
218 iso_pu_bacteria 2842285085 2842288196 341
219 iso_pu_bacteria 2842311132 2842315712 341
220 iso_pu_bacteria 2842402390 2842405462 341
221 iso_pu_bacteria 2842409023 2842411781 341
222 iso_pu_bacteria 2842415677 2842418692 341
223 iso_pu_bacteria 2842422224 2842422902 341
224 iso_pu_bacteria 2842428310 2842428853 341
225 iso_pu_bacteria 2842434925 2842435466 341
226 iso_pu_bacteria 2842441272 2842441671 341
227 iso_pu_bacteria 2842447887 2842448287 341
228 iso_pu_bacteria 2842462802 2842463277 341
229 iso_pu_bacteria 2842469257 2842469797 341
230 iso_pu_bacteria 2933599457 2933600374 341
231 iso_pu_bacteria 8005275841 8005276217 341
232 iso_pu_bacteria 8005282627 8005288598 341
233 iso_pu_bacteria 8005289223 8005292283 341
234 iso_pu_bacteria 8005382845 8005384283 341
235 iso_pu_bacteria 8005395548 8005401634 341
236 iso_pu_bacteria 8005430974 8005431517 341
237 iso_pu_bacteria 8005497431 8005502821 341
238 iso_pu_bacteria 8005619151 8005623969 341
239 iso_pu_bacteria 8005626139 8005629234 341
240 iso_pu_bacteria 8005668836 8005674251 341
241 iso_pu_bacteria 8018127388 8018129094 341
242 iso_pu_bacteria 8018176218 8018179342 341
243 3300028379 Ga0268266_10045617 Ga0268266_100456171 342
244 3300048925 Ga0496122_0000074 Ga0496122_0000074_203375_204415 342
245 3300048926 Ga0496123_0000062 Ga0496123_0000062_203357_204397 342
246 iso_pu_bacteria 2917554339 2917556987 342
247 3300031731 Ga0307405_10121144 Ga0307405_101211441 343
248 3300059492 Ga0587073_0000237 Ga0587073_0000237_2094_3125 343
249 3300059505 Ga0587083_0005805 Ga0587083_0005805_611_1642 343
250 3300059508 Ga0587088_000319 Ga0587088_000319_1118_2149 343
251 3300059509 Ga0587089_003116 Ga0587089_003116_579_1610 343
252 3300059510 Ga0587090_003632 Ga0587090_003632_560_1591 343
253 3300059511 Ga0587091_004968 Ga0587091_004968_673_1704 343
254 3300059652 Ga0587107_001936 Ga0587107_001936_611_1642 343
255 3300059655 Ga0587114_000120 Ga0587114_000120_1471_2502 343
256 iso_pu_bacteria 2510065019 2510135569 343
257 iso_pu_bacteria 2517093000 2517100031 343
258 iso_pu_bacteria 2517287029 2517409665 343
259 iso_pu_bacteria 2585427526 2585530144 343
260 iso_pu_bacteria 2857516855 2857521457 343
261 iso_pu_bacteria 8056875544 8056877704 343
262 3300027111 Ga0209281_1000514 Ga0209281_100051427 346
263 3300046512 Ga0495610_0000518 Ga0495610_0000518_21130_22173 346
264 3300046515 Ga0495620_0022284 Ga0495620_0022284_1679_2722 346
265 3300047472 Ga0495686_0037332 Ga0495686_0037332_1708_2751 346
266 iso_pu_bacteria 8045864390 8045868205 346
267 3300002739 JGI25158J39367_1001686 JGI25158J39367_10016862 347
268 3300002773 JGI25152J39213_1004110 JGI25152J39213_10041104 347
269 3300002987 JGI25159J45721_1000593 JGI25159J45721_10005937 347
270 3300003320 rootH2_10263051 rootH2_102630512 347
271 3300003354 JGI25160J50197_1001174 JGI25160J50197_10011744 347
272 3300003374 JGI25161J50226_1000029 JGI25161J50226_1000029167 347
273 3300004625 Ga0055543_1000016 Ga0055543_100001680 347
274 3300005262 Ga0065165_1002037 Ga0065165_100203712 347
275 3300025208 Ga0209436_100003 Ga0209436_100003235 347
276 3300025245 Ga0207425_1005937 Ga0207425_10059373 347
277 3300025258 Ga0209129_1001134 Ga0209129_100113412 347
278 3300025273 Ga0209673_1014435 Ga0209673_10144352 347
279 3300025284 Ga0209130_1000051 Ga0209130_1000051103 347
280 3300025299 Ga0209256_1002750 Ga0209256_100275012 347
281 3300025302 Ga0207426_1000043 Ga0207426_1000043321 347
282 3300025302 Ga0207426_1001061 Ga0207426_100106113 347
283 3300025303 Ga0209051_1030795 Ga0209051_10307952 347
284 3300025304 Ga0209257_1034655 Ga0209257_10346551 347
285 3300041413 Ga0439465_0000227 Ga0439465_0000227_11342_12385 347
286 3300041509 Ga0451843_0515067 Ga0451843_0515067_3296_4354 347
287 3300041512 Ga0451853_0912432 Ga0451853_0912432_6860_7918 347
288 3300046460 Ga0495638_0159034 Ga0495638_0159034_43_1101 347
289 3300046507 Ga0495606_0029830 Ga0495606_0029830_2609_3667 347
290 3300046522 Ga0495643_0027410 Ga0495643_0027410_1966_3024 347
291 3300046542 Ga0495597_0013308 Ga0495597_0013308_15_1073 347
292 3300046810 Ga0495660_0005149 Ga0495660_0005149_2044_3102 347
293 3300047472 Ga0495686_0055674 Ga0495686_0055674_1401_2459 347
294 3300049573 Ga0501037_0018084 Ga0501037_0018084_3381_4445 347
295 3300049575 Ga0501039_0113718 Ga0501039_0113718_564_1628 347
296 3300049758 Ga0501241_007395 Ga0501241_007395_95_1138 347
297 3300049823 Ga0501044_0058557 Ga0501044_0058557_1183_2247 347
298 3300053158 Ga0500627_0005208 Ga0500627_0005208_2096_3154 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

270

0.91

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

34

333

0.87

PF04321

RmlD_sub_bind

RmlD substrate binding domain

31

317

0.82

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

33

149

0.78

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

34

272

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lk3-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236a substitution 0.9711 11 322
4m55-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236h substitution 0.9705 11 320
2b69-assembly1.cif.gz_A crystal structure of human udp-glucoronic acid decarboxylase 0.969 11 322
4lk3-assembly1.cif.gz_C crystal structure of human udp-xylose synthase r236a substitution 0.9686 11 322
4lk3-assembly1.cif.gz_B crystal structure of human udp-xylose synthase r236a substitution 0.9676 11 322
ID Description Score Start End Superfamily
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9726 11 322 3.40.50.720
af_A0A1D6N7M5_279_504_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9721 100 322 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9719 133 321 3.40.50.720
4lk3E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9634 11 322 3.40.50.720
af_B7ZXP4_113_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9631 9 136 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A520Y571-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.986 11 324 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A1F6M884-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9841 11 321 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A2W7KEV9-F1-model_v4 deleted 0.9828 10 322
AF-A0A1R1I760-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9828 10 320 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A7R7THY1-F1-model_v4 deleted 0.9828 12 322

Feature Viewer

pLDDT pTM Quality
86.02 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map