F394552

General Info

Members Datasets Scaffolds Average Seq Length
298 183 596 185

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0194204|Ga0501084_0194204_104_685
Length 193
Sequence VILYRCFAWNRAAGSSAPDGPLWFPRQYQGEGRHDNPDLFGCLYLADHAASSVIEQLARFRTQRLTASLLRRRGLPLAIAELALDPEAMLLDLDEPRVLQRERLRPSRVATRNREITQPQARALFAAHPDAAGIRWWSTYEATWINVTLFDRAAARLRLNDVRALTVADAAVVEAAQFFAMQIGPRPAGAAGR

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
96 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
97 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
98 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
99 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
100 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
101 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
102 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
103 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
104 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
105 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
106 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
109 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
117 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 0.34
Rhizosphere 97.99
Stem 0
Stem Tuber 0
Unclassified 15.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0194204 3300054114 Bacteria 1713
2 MBSR1b_contig_7427297 2162886012 Unclassified 819
3 Ga0065715_10041702 3300005293 Bacteria 1224
4 Ga0065715_10327574 3300005293 Bacteria 990
5 Ga0070658_10567979 3300005327 Bacteria 982
6 Ga0070670_100088326 3300005331 Bacteria 2665
7 Ga0070677_10102718 3300005333 Bacteria 1263
8 Ga0070666_10025368 3300005335 Bacteria 3864
9 Ga0070666_10203554 3300005335 Unclassified 1393
10 Ga0070660_100863784 3300005339 Unclassified 762
11 Ga0070687_100121436 3300005343 Bacteria 1495
12 Ga0070661_100301287 3300005344 Bacteria 1248
13 Ga0070669_100005384 3300005353 Bacteria 9231
14 Ga0070675_100068116 3300005354 Archaea 2947
15 Ga0070671_100994773 3300005355 Bacteria 735
16 Ga0070673_100029532 3300005364 Bacteria 4089
17 Ga0070673_100670709 3300005364 Unclassified 950
18 Ga0070688_100082632 3300005365 Bacteria 2082
19 Ga0070659_100188398 3300005366 Bacteria 1695
20 Ga0070659_100319264 3300005366 Unclassified 1298
21 Ga0070667_100014522 3300005367 Bacteria 6507
22 Ga0070667_100378809 3300005367 Bacteria 1285
23 Ga0070667_101172251 3300005367 Bacteria 719
24 Ga0070667_101316332 3300005367 Unclassified 677
25 Ga0070709_10204169 3300005434 Bacteria 1401
26 Ga0070714_100025565 3300005435 Bacteria 4873
27 Ga0070714_100025684 3300005435 Bacteria 4863
28 Ga0070713_100000092 3300005436 Bacteria 57390
29 Ga0070705_100588105 3300005440 Bacteria 859
30 Ga0070662_100133047 3300005457 Bacteria 1920
31 Ga0070681_10387073 3300005458 Bacteria 1309
32 Ga0070679_100406642 3300005530 Bacteria 1307
33 Ga0070672_100191820 3300005543 Bacteria 1706
34 Ga0070672_100919520 3300005543 Bacteria 773
35 Ga0070686_100002631 3300005544 Bacteria 9903
36 Ga0070695_100014696 3300005545 Bacteria 4721
37 Ga0070695_100679580 3300005545 Unclassified 815
38 Ga0070693_100057018 3300005547 Unclassified 2257
39 Ga0070665_100001594 3300005548 Bacteria 26138
40 Ga0070665_100013603 3300005548 Bacteria 8184
41 Ga0070704_100420910 3300005549 Bacteria 1144
42 Ga0070664_100425546 3300005564 Bacteria 1217
43 Ga0070664_100864011 3300005564 Unclassified 847
44 Ga0068857_100147772 3300005577 Bacteria 2127
45 Ga0068854_100007470 3300005578 Bacteria 6984
46 Ga0068859_100027016 3300005617 Bacteria 5757
47 Ga0068864_100403769 3300005618 Bacteria 1299
48 Ga0068864_100415188 3300005618 Bacteria 1281
49 Ga0068861_100713419 3300005719 Bacteria 933
50 Ga0068870_10230913 3300005840 Bacteria 1138
51 Ga0068863_101202033 3300005841 Unclassified 764
52 Ga0068862_100049066 3300005844 Unclassified 3605
53 Ga0068862_100407191 3300005844 Bacteria 1274
54 Ga0068862_100526198 3300005844 Bacteria 1126
55 Ga0070717_10011780 3300006028 Bacteria 6654
56 Ga0070717_10021110 3300006028 Bacteria 5130
57 Ga0070717_10858360 3300006028 Unclassified 826
58 Ga0070712_100000004 3300006175 Bacteria 215464
59 Ga0075428_100084467 3300006844 Bacteria 3464
60 Ga0075428_100280610 3300006844 Bacteria 1792
61 Ga0075428_100537782 3300006844 Unclassified 1249
62 Ga0075430_100057523 3300006846 Bacteria 3270
63 Ga0075431_100049008 3300006847 Bacteria 4357
64 Ga0075431_100279166 3300006847 Bacteria 1691
65 Ga0075431_101250783 3300006847 Unclassified 704
66 Ga0075434_100048221 3300006871 Bacteria 4227
67 Ga0075434_100721311 3300006871 Bacteria 1014
68 Ga0075429_100007394 3300006880 Bacteria 9535
69 Ga0075429_100046700 3300006880 Bacteria 3768
70 Ga0097620_100027016 3300006931 Bacteria 5757
71 Ga0075435_100001160 3300007076 Bacteria 16819
72 Ga0075435_100817475 3300007076 Bacteria 812
73 Ga0105240_10139501 3300009093 Bacteria 2899
74 Ga0111539_10007319 3300009094 Bacteria 14134
75 Ga0111539_10226126 3300009094 Bacteria 2179
76 Ga0114129_10000022 3300009147 Bacteria 119291
77 Ga0114129_10067696 3300009147 Bacteria 4980
78 Ga0114129_10125105 3300009147 Bacteria 3536
79 Ga0105248_10017536 3300009177 Bacteria 7896
80 Ga0105248_10201911 3300009177 Bacteria 2240
81 Ga0105248_10319308 3300009177 Bacteria 1749
82 Ga0105248_10377704 3300009177 Bacteria 1595
83 Ga0105237_11166889 3300009545 Bacteria 777
84 Ga0105238_10098925 3300009551 Bacteria 2900
85 Ga0105249_10001358 3300009553 Bacteria 21391
86 Ga0105249_10830827 3300009553 Bacteria 989
87 Ga0105239_10200927 3300010375 Bacteria 2233
88 Ga0157375_10634450 3300013308 Bacteria 1225
89 Ga0157380_10576539 3300014326 Unclassified 1109
90 Ga0157377_10047230 3300014745 Bacteria 2411
91 Ga0207697_10341528 3300025315 Bacteria 665
92 Ga0207680_10016169 3300025903 Bacteria 3910
93 Ga0207680_10023282 3300025903 Bacteria 3380
94 Ga0207647_10248152 3300025904 Bacteria 1021
95 Ga0207643_10138060 3300025908 Unclassified 1455
96 Ga0207707_10860231 3300025912 Unclassified 752
97 Ga0207693_10000017 3300025915 Bacteria 139308
98 Ga0207662_10415261 3300025918 Bacteria 915
99 Ga0207652_10129490 3300025921 Bacteria 2250
100 Ga0207681_10365293 3300025923 Bacteria 1159
101 Ga0207694_10536263 3300025924 Bacteria 981
102 Ga0207659_10000863 3300025926 Bacteria 18011
103 Ga0207700_10000007 3300025928 Bacteria 345720
104 Ga0207700_10005628 3300025928 Bacteria 7521
105 Ga0207664_10037780 3300025929 Bacteria 3740
106 Ga0207690_10118551 3300025932 Bacteria 1918
107 Ga0207670_10526134 3300025936 Bacteria 963
108 Ga0207691_10231593 3300025940 Bacteria 1600
109 Ga0207691_10348928 3300025940 Bacteria 1266
110 Ga0207679_10181699 3300025945 Unclassified 1741
111 Ga0207712_10076601 3300025961 Bacteria 2422
112 Ga0207640_10219202 3300025981 Unclassified 1455
113 Ga0207658_10004425 3300025986 Bacteria 9772
114 Ga0207658_10496757 3300025986 Bacteria 1086
115 Ga0207658_10532334 3300025986 Bacteria 1050
116 Ga0207708_10080251 3300026075 Bacteria 2507
117 Ga0207676_10356600 3300026095 Bacteria 1354
118 Ga0207674_10334823 3300026116 Bacteria 1463
119 Ga0207675_100497736 3300026118 Bacteria 1213
120 Ga0207683_10565527 3300026121 Bacteria 1052
121 Ga0209971_1096016 3300027682 Bacteria 724
122 Ga0207428_10142523 3300027907 Bacteria 1828
123 Ga0268266_10000406 3300028379 Bacteria 65477
124 Ga0268266_10003015 3300028379 Bacteria 17301
125 Ga0268265_10039848 3300028380 Archaea 3465
126 Ga0268265_10041902 3300028380 Bacteria 3393
127 Ga0268265_10270811 3300028380 Bacteria 1515
128 Ga0268265_10896093 3300028380 Unclassified 871
129 Ga0307413_10477117 3300031824 Bacteria 996
130 Ga0307410_10167936 3300031852 Bacteria 1650
131 Ga0307410_10410944 3300031852 Unclassified 1096
132 Ga0307406_10725002 3300031901 Unclassified 832
133 Ga0307416_100118428 3300032002 Bacteria 2353
134 Ga0307411_10090540 3300032005 Bacteria 2134
135 Ga0307415_100193766 3300032126 Unclassified 1606
136 Ga0316583_10156569 3300032133 Unclassified 793
137 Ga0373958_0001316 3300034819 Bacteria 3321
138 Ga0373959_0000897 3300034820 Bacteria 5027
139 Ga0373938_0000239 3300034957 Bacteria 8565
140 Ga0373928_0004219 3300035084 Bacteria 2741
141 Ga0373929_0000553 3300035085 Bacteria 7202
142 Ga0373940_0001892 3300035088 Bacteria 3941
143 Ga0373949_0003240 3300035090 Bacteria 3933
144 Ga0373951_0006221 3300035091 Bacteria 2734
145 Ga0373952_0001538 3300035092 Bacteria 4202
146 Ga0373932_0001674 3300035112 Bacteria 6050
147 Ga0373939_0004175 3300035114 Bacteria 3406
148 Ga0373941_0000396 3300035115 Bacteria 8654
149 Ga0373960_0001097 3300035121 Bacteria 5846
150 Ga0373942_0005523 3300035207 Bacteria 2930
151 Ga0373961_0001146 3300035241 Bacteria 8311
152 Ga0373962_0001685 3300035242 Bacteria 5250
153 Ga0373931_0137805 3300035691 Bacteria 1410
154 Ga0373933_0385556 3300035724 Bacteria 913
155 Ga0373925_0153188 3300037068 Bacteria 1811
156 Ga0395898_1312329 3300037466 Bacteria 653
157 Ga0439436_0156790 3300041404 Unclassified 643
158 Ga0439435_0002618 3300042436 Plasmid 3608
159 Ga0466966_0123493 3300044684 Bacteria 1589
160 Ga0466961_0144778 3300044693 Bacteria 1486
161 Ga0466957_0076988 3300044842 Unclassified 2072
162 Ga0466957_0236015 3300044842 Bacteria 1212
163 Ga0466959_0551162 3300045049 Bacteria 777
164 Ga0451576_0006871 3300045051 Bacteria 13784
165 Ga0466958_0013330 3300045836 Bacteria 4678
166 Ga0466967_0000015 3300045976 Bacteria 99105
167 Ga0466967_0371765 3300045976 Bacteria 1387
168 Ga0495641_0083017 3300046461 Bacteria 1435
169 Ga0495664_0243344 3300046477 Bacteria 1088
170 Ga0495608_0003380 3300046511 Bacteria 11422
171 Ga0495630_0427405 3300046517 Bacteria 1015
172 Ga0495647_0111124 3300046681 Bacteria 1144
173 Ga0495658_0001551 3300046683 Bacteria 12015
174 Ga0495581_0420380 3300047315 Bacteria 779
175 Ga0496106_0308238 3300048909 Unclassified 1270
176 Ga0496121_0004658 3300048924 Bacteria 18215
177 Ga0496121_0107882 3300048924 Bacteria 2131
178 Ga0496124_0152807 3300048927 Bacteria 1808
179 Ga0496126_0053652 3300048929 Bacteria 3656
180 Ga0501031_0002535 3300049568 Bacteria 11632
181 Ga0501032_0003665 3300049569 Bacteria 11681
182 Ga0501033_0000283 3300049570 Bacteria 48801
183 Ga0501034_0033877 3300049571 Bacteria 5178
184 Ga0501036_0004160 3300049572 Bacteria 11645
185 Ga0501036_0363264 3300049572 Bacteria 1209
186 Ga0501036_0738552 3300049572 Bacteria 812
187 Ga0501037_0003376 3300049573 Bacteria 11606
188 Ga0501038_0000846 3300049574 Bacteria 27134
189 Ga0501039_0022107 3300049575 Bacteria 4881
190 Ga0501039_0378601 3300049575 Bacteria 1112
191 Ga0501040_0014201 3300049576 Bacteria 5244
192 Ga0501040_0051950 3300049576 Bacteria 2805
193 Ga0501042_0057136 3300049578 Bacteria 2785
194 Ga0501042_0118154 3300049578 Bacteria 1909
195 Ga0501042_0126796 3300049578 Bacteria 1838
196 Ga0501042_0236408 3300049578 Bacteria 1318
197 Ga0501042_0265239 3300049578 Unclassified 1240
198 Ga0501042_0555474 3300049578 Unclassified 834
199 Ga0501043_0004280 3300049579 Bacteria 11618
200 Ga0501046_0000313 3300049580 Bacteria 48865
201 Ga0501046_0250077 3300049580 Bacteria 1305
202 Ga0501047_0000452 3300049581 Bacteria 45366
203 Ga0501047_0272243 3300049581 Bacteria 1539
204 Ga0501048_0001275 3300049582 Bacteria 19094
205 Ga0501048_0026596 3300049582 Bacteria 4212
206 Ga0501048_0065084 3300049582 Bacteria 2578
207 Ga0501067_0075747 3300049583 Bacteria 1864
208 Ga0501067_0185237 3300049583 Unclassified 1159
209 Ga0501068_0015666 3300049584 Bacteria 4359
210 Ga0501068_0231830 3300049584 Bacteria 1174
211 Ga0501068_0548134 3300049584 Bacteria 752
212 Ga0501069_0011127 3300049585 Bacteria 4774
213 Ga0501069_0025892 3300049585 Bacteria 3209
214 Ga0501069_0027975 3300049585 Plasmid 3090
215 Ga0501069_0088142 3300049585 Bacteria 1753
216 Ga0501070_0000750 3300049586 Bacteria 29612
217 Ga0501070_0023057 3300049586 Bacteria 5212
218 Ga0501070_0492222 3300049586 Bacteria 985
219 Ga0501070_0734622 3300049586 Bacteria 779
220 Ga0501071_0024517 3300049587 Bacteria 4220
221 Ga0501071_0029581 3300049587 Bacteria 3867
222 Ga0501071_0076074 3300049587 Bacteria 2451
223 Ga0501072_0058992 3300049588 Bacteria 3025
224 Ga0501072_0089577 3300049588 Bacteria 2442
225 Ga0501072_0417481 3300049588 Unclassified 1064
226 Ga0501073_0003825 3300049589 Bacteria 11295
227 Ga0501074_0005335 3300049590 Bacteria 9241
228 Ga0501074_0132637 3300049590 Unclassified 1782
229 Ga0501074_0190688 3300049590 Bacteria 1461
230 Ga0501074_0414529 3300049590 Unclassified 955
231 Ga0501075_0067173 3300049591 Bacteria 2707
232 Ga0501075_0097409 3300049591 Bacteria 2232
233 Ga0501075_0119331 3300049591 Bacteria 2006
234 Ga0501076_0039118 3300049592 Plasmid 3724
235 Ga0501076_0090828 3300049592 Bacteria 2456
236 Ga0501076_0119575 3300049592 Bacteria 2133
237 Ga0501077_0011331 3300049593 Bacteria 5568
238 Ga0501079_0008374 3300049741 Bacteria 7836
239 Ga0501079_0009695 3300049741 Bacteria 7301
240 Ga0501079_0121286 3300049741 Bacteria 2033
241 Ga0501079_0185260 3300049741 Bacteria 1625
242 Ga0501080_0042323 3300049742 Bacteria 4242
243 Ga0501080_0065738 3300049742 Bacteria 3373
244 Ga0501080_0143204 3300049742 Bacteria 2210
245 Ga0501080_0169184 3300049742 Unclassified 2016
246 Ga0501080_0415059 3300049742 Unclassified 1210
247 Ga0501081_0057605 3300049743 Bacteria 2687
248 Ga0501081_0094621 3300049743 Unclassified 2105
249 Ga0501081_0256976 3300049743 Bacteria 1276
250 Ga0501081_0538252 3300049743 Bacteria 872
251 Ga0501083_0003036 3300049744 Bacteria 11667
252 Ga0501083_0024828 3300049744 Bacteria 4151
253 Ga0501035_0000405 3300049822 Bacteria 48987
254 Ga0501044_0000211 3300049823 Bacteria 73920
255 Ga0501044_0500417 3300049823 Bacteria 1116
256 Ga0501045_0018103 3300049824 Bacteria 5005
257 Ga0501045_0056325 3300049824 Bacteria 2875
258 Ga0501045_0096423 3300049824 Bacteria 2188
259 Ga0501045_0190364 3300049824 Bacteria 1529
260 Ga0501045_0264554 3300049824 Unclassified 1280
261 nmdc:mga05p37_27513_c1 3300050507 Bacteria 6922
262 nmdc:mga05p37_810719_c1 3300050507 Bacteria 1022
263 nmdc:mga05p37_83_c1 3300050507 Bacteria 83944
264 nmdc:mga09592_52691_c1 3300050508 Unclassified 3434
265 nmdc:mga09592_79944_c1 3300050508 Bacteria 2784
266 nmdc:mga0qj67_80429_c1 3300050509 Bacteria 2611
267 nmdc:mga06r32_455558_c1 3300050510 Unclassified 1259
268 nmdc:mga06r32_526929_c1 3300050510 Bacteria 1157
269 nmdc:mga06r32_624411_c1 3300050510 Unclassified 1047
270 nmdc:mga08y16_194188_c1 3300050511 Bacteria 2105
271 nmdc:mga08y16_51648_c1 3300050511 Unclassified 4301
272 nmdc:mga0n895_180535_c1 3300050512 Bacteria 2142
273 nmdc:mga0n895_693507_c1 3300050512 Unclassified 1015
274 nmdc:mga0rr50_2582_c1 3300050513 Bacteria 10254
275 nmdc:mga0rr50_26242_c1 3300050513 Bacteria 4061
276 nmdc:mga0rr50_366611_c1 3300050513 Unclassified 1213
277 nmdc:mga0rr50_805535_c1 3300050513 Bacteria 801
278 nmdc:mga0a205_129235_c1 3300050515 Bacteria 2427
279 nmdc:mga0a205_69580_c1 3300050515 Unclassified 3398
280 nmdc:mga0a205_81816_c1 3300050515 Bacteria 3119
281 Ga0495612_0135429 3300053078 Bacteria 1066
282 Ga0495619_0475280 3300053085 Bacteria 861
283 Ga0500595_019589 3300053119 Bacteria 2452
284 Ga0501084_0035109 3300054114 Bacteria 4191
285 Ga0501084_0048340 3300054114 Bacteria 3561
286 Ga0501084_0509411 3300054114 Unclassified 1017
287 Ga0501084_0709474 3300054114 Bacteria 848
288 Ga0590074_000393 3300059423 Bacteria 6248
289 Ga0590075_000738 3300059424 Bacteria 8680
290 Ga0590075_028895 3300059424 Bacteria 1401
291 Ga0590077_000441 3300059426 Bacteria 11650
292 Ga0590077_002521 3300059426 Bacteria 3882
293 Ga0501082_0009677 3300060353 Bacteria 8300
294 Ga0501082_0050257 3300060353 Bacteria 3596
295 Ga0501082_0091399 3300060353 Bacteria 2628
296 Ga0501082_0094328 3300060353 Bacteria 2586
297 Ga0530510_0099947 3300061734 Bacteria 2121
298 Ga0530510_0494394 3300061734 Unclassified 927
299 Ga0501084_0194204
300 MBSR1b_contig_7427297
301 Ga0065715_10041702
302 Ga0065715_10327574
303 Ga0070658_10567979
304 Ga0070670_100088326
305 Ga0070677_10102718
306 Ga0070666_10025368
307 Ga0070666_10203554
308 Ga0070660_100863784
309 Ga0070687_100121436
310 Ga0070661_100301287
311 Ga0070669_100005384
312 Ga0070675_100068116
313 Ga0070671_100994773
314 Ga0070673_100029532
315 Ga0070673_100670709
316 Ga0070688_100082632
317 Ga0070659_100188398
318 Ga0070659_100319264
319 Ga0070667_100014522
320 Ga0070667_100378809
321 Ga0070667_101172251
322 Ga0070667_101316332
323 Ga0070709_10204169
324 Ga0070714_100025565
325 Ga0070714_100025684
326 Ga0070713_100000092
327 Ga0070705_100588105
328 Ga0070662_100133047
329 Ga0070681_10387073
330 Ga0070679_100406642
331 Ga0070672_100191820
332 Ga0070672_100919520
333 Ga0070686_100002631
334 Ga0070695_100014696
335 Ga0070695_100679580
336 Ga0070693_100057018
337 Ga0070665_100001594
338 Ga0070665_100013603
339 Ga0070704_100420910
340 Ga0070664_100425546
341 Ga0070664_100864011
342 Ga0068857_100147772
343 Ga0068854_100007470
344 Ga0068859_100027016
345 Ga0068864_100403769
346 Ga0068864_100415188
347 Ga0068861_100713419
348 Ga0068870_10230913
349 Ga0068863_101202033
350 Ga0068862_100049066
351 Ga0068862_100407191
352 Ga0068862_100526198
353 Ga0070717_10011780
354 Ga0070717_10021110
355 Ga0070717_10858360
356 Ga0070712_100000004
357 Ga0075428_100084467
358 Ga0075428_100280610
359 Ga0075428_100537782
360 Ga0075430_100057523
361 Ga0075431_100049008
362 Ga0075431_100279166
363 Ga0075431_101250783
364 Ga0075434_100048221
365 Ga0075434_100721311
366 Ga0075429_100007394
367 Ga0075429_100046700
368 Ga0097620_100027016
369 Ga0075435_100001160
370 Ga0075435_100817475
371 Ga0105240_10139501
372 Ga0111539_10007319
373 Ga0111539_10226126
374 Ga0114129_10000022
375 Ga0114129_10067696
376 Ga0114129_10125105
377 Ga0105248_10017536
378 Ga0105248_10201911
379 Ga0105248_10319308
380 Ga0105248_10377704
381 Ga0105237_11166889
382 Ga0105238_10098925
383 Ga0105249_10001358
384 Ga0105249_10830827
385 Ga0105239_10200927
386 Ga0157375_10634450
387 Ga0157380_10576539
388 Ga0157377_10047230
389 Ga0207697_10341528
390 Ga0207680_10016169
391 Ga0207680_10023282
392 Ga0207647_10248152
393 Ga0207643_10138060
394 Ga0207707_10860231
395 Ga0207693_10000017
396 Ga0207662_10415261
397 Ga0207652_10129490
398 Ga0207681_10365293
399 Ga0207694_10536263
400 Ga0207659_10000863
401 Ga0207700_10000007
402 Ga0207700_10005628
403 Ga0207664_10037780
404 Ga0207690_10118551
405 Ga0207670_10526134
406 Ga0207691_10231593
407 Ga0207691_10348928
408 Ga0207679_10181699
409 Ga0207712_10076601
410 Ga0207640_10219202
411 Ga0207658_10004425
412 Ga0207658_10496757
413 Ga0207658_10532334
414 Ga0207708_10080251
415 Ga0207676_10356600
416 Ga0207674_10334823
417 Ga0207675_100497736
418 Ga0207683_10565527
419 Ga0209971_1096016
420 Ga0207428_10142523
421 Ga0268266_10000406
422 Ga0268266_10003015
423 Ga0268265_10039848
424 Ga0268265_10041902
425 Ga0268265_10270811
426 Ga0268265_10896093
427 Ga0307413_10477117
428 Ga0307410_10167936
429 Ga0307410_10410944
430 Ga0307406_10725002
431 Ga0307416_100118428
432 Ga0307411_10090540
433 Ga0307415_100193766
434 Ga0316583_10156569
435 Ga0373958_0001316
436 Ga0373959_0000897
437 Ga0373938_0000239
438 Ga0373928_0004219
439 Ga0373929_0000553
440 Ga0373940_0001892
441 Ga0373949_0003240
442 Ga0373951_0006221
443 Ga0373952_0001538
444 Ga0373932_0001674
445 Ga0373939_0004175
446 Ga0373941_0000396
447 Ga0373960_0001097
448 Ga0373942_0005523
449 Ga0373961_0001146
450 Ga0373962_0001685
451 Ga0373931_0137805
452 Ga0373933_0385556
453 Ga0373925_0153188
454 Ga0395898_1312329
455 Ga0439436_0156790
456 Ga0439435_0002618
457 Ga0466966_0123493
458 Ga0466961_0144778
459 Ga0466957_0076988
460 Ga0466957_0236015
461 Ga0466959_0551162
462 Ga0451576_0006871
463 Ga0466958_0013330
464 Ga0466967_0000015
465 Ga0466967_0371765
466 Ga0495641_0083017
467 Ga0495664_0243344
468 Ga0495608_0003380
469 Ga0495630_0427405
470 Ga0495647_0111124
471 Ga0495658_0001551
472 Ga0495581_0420380
473 Ga0496106_0308238
474 Ga0496121_0004658
475 Ga0496121_0107882
476 Ga0496124_0152807
477 Ga0496126_0053652
478 Ga0501031_0002535
479 Ga0501032_0003665
480 Ga0501033_0000283
481 Ga0501034_0033877
482 Ga0501036_0004160
483 Ga0501036_0363264
484 Ga0501036_0738552
485 Ga0501037_0003376
486 Ga0501038_0000846
487 Ga0501039_0022107
488 Ga0501039_0378601
489 Ga0501040_0014201
490 Ga0501040_0051950
491 Ga0501042_0057136
492 Ga0501042_0118154
493 Ga0501042_0126796
494 Ga0501042_0236408
495 Ga0501042_0265239
496 Ga0501042_0555474
497 Ga0501043_0004280
498 Ga0501046_0000313
499 Ga0501046_0250077
500 Ga0501047_0000452
501 Ga0501047_0272243
502 Ga0501048_0001275
503 Ga0501048_0026596
504 Ga0501048_0065084
505 Ga0501067_0075747
506 Ga0501067_0185237
507 Ga0501068_0015666
508 Ga0501068_0231830
509 Ga0501068_0548134
510 Ga0501069_0011127
511 Ga0501069_0025892
512 Ga0501069_0027975
513 Ga0501069_0088142
514 Ga0501070_0000750
515 Ga0501070_0023057
516 Ga0501070_0492222
517 Ga0501070_0734622
518 Ga0501071_0024517
519 Ga0501071_0029581
520 Ga0501071_0076074
521 Ga0501072_0058992
522 Ga0501072_0089577
523 Ga0501072_0417481
524 Ga0501073_0003825
525 Ga0501074_0005335
526 Ga0501074_0132637
527 Ga0501074_0190688
528 Ga0501074_0414529
529 Ga0501075_0067173
530 Ga0501075_0097409
531 Ga0501075_0119331
532 Ga0501076_0039118
533 Ga0501076_0090828
534 Ga0501076_0119575
535 Ga0501077_0011331
536 Ga0501079_0008374
537 Ga0501079_0009695
538 Ga0501079_0121286
539 Ga0501079_0185260
540 Ga0501080_0042323
541 Ga0501080_0065738
542 Ga0501080_0143204
543 Ga0501080_0169184
544 Ga0501080_0415059
545 Ga0501081_0057605
546 Ga0501081_0094621
547 Ga0501081_0256976
548 Ga0501081_0538252
549 Ga0501083_0003036
550 Ga0501083_0024828
551 Ga0501035_0000405
552 Ga0501044_0000211
553 Ga0501044_0500417
554 Ga0501045_0018103
555 Ga0501045_0056325
556 Ga0501045_0096423
557 Ga0501045_0190364
558 Ga0501045_0264554
559 nmdc:mga05p37_27513_c1
560 nmdc:mga05p37_810719_c1
561 nmdc:mga05p37_83_c1
562 nmdc:mga09592_52691_c1
563 nmdc:mga09592_79944_c1
564 nmdc:mga0qj67_80429_c1
565 nmdc:mga06r32_455558_c1
566 nmdc:mga06r32_526929_c1
567 nmdc:mga06r32_624411_c1
568 nmdc:mga08y16_194188_c1
569 nmdc:mga08y16_51648_c1
570 nmdc:mga0n895_180535_c1
571 nmdc:mga0n895_693507_c1
572 nmdc:mga0rr50_2582_c1
573 nmdc:mga0rr50_26242_c1
574 nmdc:mga0rr50_366611_c1
575 nmdc:mga0rr50_805535_c1
576 nmdc:mga0a205_129235_c1
577 nmdc:mga0a205_69580_c1
578 nmdc:mga0a205_81816_c1
579 Ga0495612_0135429
580 Ga0495619_0475280
581 Ga0500595_019589
582 Ga0501084_0035109
583 Ga0501084_0048340
584 Ga0501084_0509411
585 Ga0501084_0709474
586 Ga0590074_000393
587 Ga0590075_000738
588 Ga0590075_028895
589 Ga0590077_000441
590 Ga0590077_002521
591 Ga0501082_0009677
592 Ga0501082_0050257
593 Ga0501082_0091399
594 Ga0501082_0094328
595 Ga0530510_0099947
596 Ga0530510_0494394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08808

RES

RES domain

2

172

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d0h-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars 0.7131 2 166
6d0i-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars. l48m part, semet-substituted complex. 0.7064 1 170
6fkg-assembly1.cif.gz_B crystal structure of the m.tuberculosis mbct-mbca toxin-antitoxin complex. 0.6872 2 180
6d0i-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars. l48m part, semet-substituted complex. 0.6836 1 170
6d0h-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars 0.6712 2 166
ID Description Score Start End Superfamily
af_Q57805_1_214_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5798 1 181 3.90.228.10
af_Q57805_1_214_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5698 1 181 3.90.228.10
af_A0A0P0XQ20_2_206_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.5498 115 144 3.30.565.10
af_Q4CWT9_147_295_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5247 64 166 3.90.228.10
af_K7N1I8_223_462_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.52 130 154 3.30.559.10
ID Description Score Start End GO Terms
AF-A0A2V8HET4-F1-model_v4 RES domain-containing protein 0.9639 1 182
AF-A0A2V8FYK0-F1-model_v4 RES domain-containing protein 0.9628 1 158
AF-A0A2A3LCK3-F1-model_v4 RES domain-containing protein 0.9593 1 182
AF-A0A7V9VRH6-F1-model_v4 deleted 0.9571 1 182
AF-A0A2V8FYK0-F1-model_v4 RES domain-containing protein 0.951 1 158

Map