F394505

General Info

Members Datasets Scaffolds Average Seq Length
298 206 256 209

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0031070|Ga0501032_0031070_1140_1877
Length 245
Sequence MFHFSPFTSHFFHDSPPSIIHYSLLPIHHYLPYLAAMEITSAKYLISSPGYLKCPPPDRPEYAFIGRSNVGKSSLINMLCNNHKLAKTSASPGKTQMINHFSIESTSENRDMEQWYIVDLPGYGFAKVSQQQRKQWQQMTGDYLCRRPNLMNVFVLVDSRHRPQKADIDFTNQLGEWGVPFSIVFTKADKTTQQEVSKNIKLYLGEMKKYWEFLPASYTTSTVKKLGRNKILDAIGEMNKLFERK

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
7 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
8 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
9 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
10 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
11 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
12 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
13 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
14 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
15 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
16 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
17 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
18 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
19 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
20 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
21 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
22 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
23 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
24 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
25 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
26 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
27 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
28 2818991444 Filimonas endophytica 3197 Isolate Unclassified
29 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
30 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
31 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
32 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
33 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
34 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
35 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
36 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
37 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
38 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
39 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
40 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
41 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
42 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
43 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
46 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
47 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
48 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
137 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
152 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
153 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
199 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.9
Metatranscriptomes 0.67
Isolates 14.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.67
Bulb 0
Endosphere 1.68
Nodule 0.34
Rhizoplane 1.01
Rhizosphere 80.54
Stem 0
Stem Tuber 0
Unclassified 15.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10081154 3300003320 Bacteria 4290
2 rootL2_10032803 3300003322 Bacteria 3995
3 rootH1_10106623 3300003316 Bacteria 8224
4 rootH1_10106623 3300003323 Bacteria 14938
5 rootH1_10378359 3300003323 Bacteria 1027
6 Ga0006562J51391_1007212 3300003578 Bacteria 2090
7 Ga0065714_10002233 3300005288 Bacteria 39932
8 Ga0070658_10059151 3300005327 Bacteria 3121
9 Ga0070658_10107150 3300005327 Bacteria 2313
10 Ga0070658_10110291 3300005327 Bacteria 2279
11 Ga0070658_10248634 3300005327 Bacteria 1508
12 Ga0070658_10837588 3300005327 Bacteria 799
13 Ga0070683_100003565 3300005329 Bacteria 12674
14 Ga0070683_100182102 3300005329 Bacteria 1994
15 Ga0070683_100235177 3300005329 Bacteria 1742
16 Ga0070683_100300831 3300005329 Bacteria 1526
17 Ga0070670_100929584 3300005331 Bacteria 789
18 Ga0070682_100008811 3300005337 Bacteria 5695
19 Ga0070682_100181964 3300005337 Bacteria 1469
20 Ga0070660_100346107 3300005339 Bacteria 1223
21 Ga0070668_100013232 3300005347 Bacteria 6154
22 Ga0070668_100098178 3300005347 Bacteria 2317
23 Ga0070675_100098007 3300005354 Bacteria 2465
24 Ga0070673_100068931 3300005364 Bacteria 2833
25 Ga0070714_100404258 3300005435 Bacteria 1291
26 Ga0070713_100108909 3300005436 Bacteria 2413
27 Ga0070678_100204134 3300005456 Bacteria 1633
28 Ga0070681_10020415 3300005458 Bacteria 6640
29 Ga0070681_10044225 3300005458 Bacteria 4457
30 Ga0070685_10136905 3300005466 Bacteria 1537
31 Ga0070679_100001149 3300005530 Bacteria 23184
32 Ga0070679_100191149 3300005530 Bacteria 2016
33 Ga0070679_100398655 3300005530 Bacteria 1322
34 Ga0070684_100002317 3300005535 Bacteria 14035
35 Ga0070684_100087297 3300005535 Bacteria 2770
36 Ga0070684_100334360 3300005535 Bacteria 1392
37 Ga0068853_100332963 3300005539 Unclassified 1409
38 Ga0068853_100527265 3300005539 Bacteria 1117
39 Ga0070672_100068103 3300005543 Bacteria 2823
40 Ga0068855_100050147 3300005563 Bacteria 4920
41 Ga0068855_100492752 3300005563 Bacteria 1333
42 Ga0070664_100084758 3300005564 Bacteria 2736
43 Ga0068854_100091707 3300005578 Bacteria 2262
44 Ga0068854_100244523 3300005578 Bacteria 1430
45 Ga0068854_100761624 3300005578 Bacteria 841
46 Ga0068856_100011695 3300005614 Bacteria 8514
47 Ga0068856_100222329 3300005614 Unclassified 1904
48 Ga0068856_100345616 3300005614 Bacteria 1506
49 Ga0068852_100000848 3300005616 Bacteria 20294
50 Ga0068852_100020254 3300005616 Bacteria 5287
51 Ga0068852_100309364 3300005616 Bacteria 1532
52 Ga0068859_101014791 3300005617 Bacteria 911
53 Ga0068860_100004119 3300005843 Bacteria 14895
54 Ga0068860_100016515 3300005843 Bacteria 7200
55 Ga0068860_100303192 3300005843 Bacteria 1565
56 Ga0068862_100002988 3300005844 Bacteria 14761
57 Ga0068862_100185051 3300005844 Unclassified 1871
58 Ga0081539_10063003 3300005985 Bacteria 2025
59 Ga0075366_10168157 3300006195 Bacteria 1330
60 Ga0097621_100137674 3300006237 Bacteria 2084
61 Ga0075428_100004281 3300006844 Bacteria 15709
62 Ga0075431_100395542 3300006847 Unclassified 1384
63 Ga0105244_10000029 3300009036 Bacteria 193769
64 Ga0105250_10069119 3300009092 Bacteria 1426
65 Ga0105240_10051078 3300009093 Bacteria 5206
66 Ga0111539_10007155 3300009094 Bacteria 14305
67 Ga0111539_10007459 3300009094 Bacteria 14010
68 Ga0105243_10054023 3300009148 Bacteria 3188
69 Ga0105241_10008820 3300009174 Bacteria 7410
70 Ga0105241_10304264 3300009174 Bacteria 1369
71 Ga0105242_11017167 3300009176 Bacteria 837
72 Ga0105237_10780788 3300009545 Unclassified 962
73 Ga0105237_10982818 3300009545 Bacteria 851
74 Ga0105249_10104154 3300009553 Bacteria 2673
75 Ga0105249_11110251 3300009553 Unclassified 861
76 Ga0105239_10034503 3300010375 Bacteria 5556
77 Ga0157373_10000020 3300013100 Bacteria 166079
78 Ga0157373_10009099 3300013100 Bacteria 7347
79 Ga0157371_10000451 3300013102 Bacteria 50405
80 Ga0157371_10020618 3300013102 Bacteria 4850
81 Ga0157371_10021383 3300013102 Bacteria 4750
82 Ga0157371_10051257 3300013102 Bacteria 2933
83 Ga0157371_10105240 3300013102 Bacteria 2002
84 Ga0157370_10002841 3300013104 Bacteria 20692
85 Ga0157370_10205025 3300013104 Bacteria 1828
86 Ga0157370_10419064 3300013104 Bacteria 1232
87 Ga0157369_10020421 3300013105 Bacteria 7403
88 Ga0157369_10357831 3300013105 Bacteria 1516
89 Ga0157374_10018424 3300013296 Bacteria 6160
90 Ga0163162_10137222 3300013306 Bacteria 2557
91 Ga0163162_10234411 3300013306 Unclassified 1966
92 Ga0157372_10034921 3300013307 Bacteria 5533
93 Ga0157372_10244693 3300013307 Unclassified 2081
94 Ga0157372_10957228 3300013307 Bacteria 992
95 Ga0157375_10015783 3300013308 Bacteria 6767
96 Ga0157375_10467982 3300013308 Bacteria 1426
97 Ga0163163_10000344 3300014325 Bacteria 44689
98 Ga0163163_10422970 3300014325 Bacteria 1391
99 Ga0157380_10185368 3300014326 Bacteria 1832
100 Ga0157380_10467576 3300014326 Bacteria 1216
101 Ga0182008_10000005 3300014497 Bacteria 386556
102 Ga0157379_10342729 3300014968 Bacteria 1367
103 Ga0182006_1000001 3300015261 Bacteria 1091090
104 Ga0213876_10005972 3300021384 Bacteria 6654
105 Ga0209026_1000427 3300025250 Bacteria 35425
106 Ga0209675_1000351 3300025291 Bacteria 39955
107 Ga0207696_1052401 3300025711 Bacteria 1163
108 Ga0207655_1000097 3300025728 Bacteria 193780
109 Ga0207647_10067897 3300025904 Bacteria 2159
110 Ga0207705_10034353 3300025909 Bacteria 3625
111 Ga0207705_10092815 3300025909 Bacteria 2212
112 Ga0207705_10423187 3300025909 Bacteria 1031
113 Ga0207705_10556321 3300025909 Bacteria 892
114 Ga0207705_10682175 3300025909 Bacteria 799
115 Ga0207654_10037300 3300025911 Bacteria 2720
116 Ga0207654_10230349 3300025911 Bacteria 1233
117 Ga0207707_10101109 3300025912 Bacteria 2519
118 Ga0207695_10004070 3300025913 Bacteria 20110
119 Ga0207671_10733922 3300025914 Bacteria 785
120 Ga0207660_10117563 3300025917 Bacteria 2010
121 Ga0207657_10010738 3300025919 Bacteria 9119
122 Ga0207652_10017767 3300025921 Bacteria 5826
123 Ga0207652_10224361 3300025921 Bacteria 1693
124 Ga0207650_10146025 3300025925 Unclassified 1863
125 Ga0207650_10728529 3300025925 Bacteria 838
126 Ga0207659_10112740 3300025926 Bacteria 2070
127 Ga0207700_10257531 3300025928 Bacteria 1493
128 Ga0207664_10331679 3300025929 Bacteria 1344
129 Ga0207686_10794300 3300025934 Bacteria 758
130 Ga0207709_10000044 3300025935 Bacteria 241642
131 Ga0207709_10047025 3300025935 Bacteria 2622
132 Ga0207691_10063391 3300025940 Bacteria 3352
133 Ga0207661_10002486 3300025944 Bacteria 12677
134 Ga0207661_10021073 3300025944 Bacteria 4882
135 Ga0207667_10040941 3300025949 Bacteria 4931
136 Ga0207667_10585863 3300025949 Bacteria 1126
137 Ga0207651_10051351 3300025960 Bacteria 2805
138 Ga0207712_10113641 3300025961 Bacteria 2035
139 Ga0207668_10012287 3300025972 Bacteria 5236
140 Ga0207668_10045522 3300025972 Bacteria 2993
141 Ga0207639_10493914 3300026041 Bacteria 1117
142 Ga0207639_10677106 3300026041 Unclassified 956
143 Ga0207702_10008852 3300026078 Bacteria 8482
144 Ga0207702_10077319 3300026078 Bacteria 2878
145 Ga0207702_10960997 3300026078 Unclassified 847
146 Ga0207675_100241049 3300026118 Bacteria 1747
147 Ga0207698_10003055 3300026142 Bacteria 10033
148 Ga0207698_10129176 3300026142 Bacteria 2156
149 Ga0207698_10178842 3300026142 Bacteria 1877
150 Ga0207428_10014461 3300027907 Bacteria 6856
151 Ga0268264_10015156 3300028381 Bacteria 6323
152 Ga0268264_10021945 3300028381 Bacteria 5210
153 Ga0268264_10039184 3300028381 Bacteria 3915
154 Ga0265334_10147061 3300028573 Unclassified 832
155 Ga0265327_10000288 3300031251 Bacteria 99230
156 Ga0316576_10012978 3300031727 Bacteria 5518
157 Ga0316576_10020184 3300031727 Bacteria 4579
158 Ga0316576_10234383 3300031727 Bacteria 1380
159 Ga0316578_10448358 3300031728 Unclassified 763
160 Ga0307412_10000006 3300031911 Bacteria 506878
161 Ga0307412_10003394 3300031911 Bacteria 8850
162 Ga0307416_100000059 3300032002 Bacteria 103158
163 Ga0307414_10000025 3300032004 Bacteria 199049
164 Ga0307414_10204391 3300032004 Bacteria 1609
165 Ga0307415_100375788 3300032126 Bacteria 1205
166 Ga0395899_0238652 3300037312 Bacteria 1252
167 Ga0395900_0032677 3300037418 Bacteria 5351
168 Ga0395898_0111849 3300037466 Bacteria 2617
169 Ga0395901_0063026 3300038443 Bacteria 3858
170 Ga0400483_030081 3300039062 Bacteria 20143
171 Ga0400483_225615 3300039062 Bacteria 50100
172 Ga0436365_0548634 3300039437 Bacteria 13605
173 Ga0436365_1144642 3300039437 Bacteria 1605
174 Ga0439466_0027324 3300041411 Bacteria 1977
175 Ga0439465_0000844 3300041413 Bacteria 9658
176 Ga0451807_1656814 3300041486 Bacteria 1002
177 Ga0451837_0158293 3300041494 Bacteria 716
178 Ga0451837_1451645 3300041494 Bacteria 2086
179 Ga0451855_0322957 3300041511 Bacteria 825
180 Ga0439445_0000120 3300042004 Bacteria 13385
181 Ga0451577_0238039 3300042876 Unclassified 1647
182 Ga0451577_0353086 3300042876 Bacteria 1334
183 Ga0466969_0000004 3300044656 Bacteria 168068
184 Ga0466972_0183269 3300044658 Bacteria 982
185 Ga0466982_0183199 3300044672 Unclassified 1265
186 Ga0466966_0000075 3300044684 Bacteria 62899
187 Ga0466964_0010304 3300044706 Bacteria 3526
188 Ga0453684_0006110 3300044712 Bacteria 23208
189 Ga0453684_0274628 3300044712 Bacteria 1924
190 Ga0466971_0099535 3300044719 Bacteria 1335
191 Ga0466959_0000004 3300045049 Bacteria 216815
192 Ga0451576_0841878 3300045051 Bacteria 963
193 Ga0495627_000012 3300046453 Bacteria 345654
194 Ga0495627_005285 3300046453 Bacteria 5231
195 Ga0495596_0000997 3300046500 Bacteria 16840
196 Ga0495606_0016066 3300046507 Bacteria 5730
197 Ga0495610_0000005 3300046512 Bacteria 924111
198 Ga0495632_0000339 3300046519 Bacteria 44456
199 Ga0495643_0038888 3300046522 Bacteria 2603
200 Ga0495643_0230252 3300046522 Bacteria 874
201 Ga0495663_0000047 3300046525 Bacteria 58338
202 Ga0495663_0002390 3300046525 Bacteria 5646
203 Ga0495609_0000003 3300046538 Bacteria 711547
204 Ga0495633_0000001 3300046558 Bacteria 801972
205 Ga0495633_0000326 3300046558 Bacteria 53731
206 Ga0495625_0000251 3300046660 Bacteria 84084
207 Ga0495660_0042575 3300046810 Bacteria 2509
208 Ga0495686_0000122 3300047472 Bacteria 162732
209 Ga0495686_0004873 3300047472 Bacteria 10822
210 Ga0495686_0016604 3300047472 Bacteria 4988
211 Ga0496102_0045813 3300048905 Bacteria 3971
212 Ga0496103_0038281 3300048906 Bacteria 2942
213 Ga0496116_0000051 3300048919 Bacteria 305038
214 Ga0496117_0000007 3300048920 Bacteria 720505
215 Ga0496118_0000118 3300048921 Bacteria 144482
216 Ga0496119_0000028 3300048922 Bacteria 244677
217 Ga0496121_0032670 3300048924 Bacteria 4726
218 Ga0496122_0000480 3300048925 Bacteria 82939
219 Ga0496122_0000729 3300048925 Bacteria 64394
220 Ga0496122_0001800 3300048925 Bacteria 32834
221 Ga0496122_0002571 3300048925 Bacteria 25490
222 Ga0496122_0017551 3300048925 Bacteria 6683
223 Ga0496123_0001671 3300048926 Bacteria 29706
224 Ga0496123_0028801 3300048926 Bacteria 4104
225 Ga0496123_0104458 3300048926 Bacteria 1638
226 Ga0496123_0111202 3300048926 Bacteria 1566
227 Ga0496124_0006296 3300048927 Bacteria 12966
228 Ga0496124_0060463 3300048927 Bacteria 3178
229 Ga0496125_0001242 3300048928 Bacteria 38106
230 Ga0496125_0007054 3300048928 Bacteria 12006
231 Ga0496125_0039049 3300048928 Bacteria 4096
232 Ga0496126_0001360 3300048929 Bacteria 38755
233 Ga0496126_0159974 3300048929 Bacteria 1925
234 Ga0496126_0160384 3300048929 Bacteria 1922
235 Ga0501335_003534 3300049551 Bacteria 1328
236 Ga0501032_0031070 3300049569 Bacteria 3663
237 Ga0501034_0145178 3300049571 Bacteria 2350
238 Ga0501043_0544485 3300049579 Bacteria 863
239 Ga0501043_0585391 3300049579 Unclassified 826
240 Ga0501047_0387317 3300049581 Bacteria 1232
241 Ga0501067_0015784 3300049583 Bacteria 4179
242 Ga0501070_0847256 3300049586 Bacteria 716
243 Ga0501259_036685 3300049688 Bacteria 949
244 Ga0501080_0120511 3300049742 Bacteria 2431
245 Ga0501083_0048911 3300049744 Bacteria 2852
246 Ga0501241_000008 3300049758 Bacteria 137909
247 Ga0501269_000081 3300049766 Bacteria 29841
248 Ga0501269_017148 3300049766 Unclassified 895
249 Ga0501044_0068493 3300049823 Bacteria 3615
250 nmdc:mga0k408_295066_c1 3300050493 Bacteria 967
251 nmdc:mga0qj67_440152_c1 3300050509 Bacteria 1050
252 nmdc:mga06r32_1256646_c1 3300050510 Bacteria 685
253 nmdc:mga08y16_55170_c1 3300050511 Bacteria 4153
254 Ga0500646_0019238 3300053090 Bacteria 1806
255 Ga0500646_0020817 3300053090 Bacteria 1744
256 Ga0501082_0211282 3300060353 Bacteria 1688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041494 Ga0451837_0158293 Ga0451837_0158293_51_533 160
2 3300044658 Ga0466972_0183269 Ga0466972_0183269_41_568 162
3 3300050493 nmdc:mga0k408_295066_c1 nmdc:mga0k408_295066_c1_322_879 172
4 3300005435 Ga0070714_100404258 Ga0070714_1004042581 193
5 3300005436 Ga0070713_100108909 Ga0070713_1001089093 193
6 3300025928 Ga0207700_10257531 Ga0207700_102575312 193
7 3300025929 Ga0207664_10331679 Ga0207664_103316792 193
8 3300049688 Ga0501259_036685 Ga0501259_036685_28_633 193
9 3300005331 Ga0070670_100929584 Ga0070670_1009295841 196
10 3300005347 Ga0070668_100098178 Ga0070668_1000981782 196
11 3300005354 Ga0070675_100098007 Ga0070675_1000980072 196
12 3300005364 Ga0070673_100068931 Ga0070673_1000689313 196
13 3300005543 Ga0070672_100068103 Ga0070672_1000681032 196
14 3300025926 Ga0207659_10112740 Ga0207659_101127402 196
15 3300025940 Ga0207691_10063391 Ga0207691_100633914 196
16 3300025960 Ga0207651_10051351 Ga0207651_100513513 196
17 3300026118 Ga0207675_100241049 Ga0207675_1002410492 196
18 3300042876 Ga0451577_0238039 Ga0451577_0238039_48_665 196
19 3300006237 Ga0097621_100137674 Ga0097621_1001376742 197
20 3300006844 Ga0075428_100004281 Ga0075428_10000428115 197
21 3300006847 Ga0075431_100395542 Ga0075431_1003955422 197
22 3300009094 Ga0111539_10007459 Ga0111539_1000745914 197
23 3300050509 nmdc:mga0qj67_440152_c1 nmdc:mga0qj67_440152_c1_428_1021 197
24 3300050510 nmdc:mga06r32_1256646_c1 nmdc:mga06r32_1256646_c1_47_640 197
25 3300050511 nmdc:mga08y16_55170_c1 nmdc:mga08y16_55170_c1_1713_2306 197
26 iso_pu_bacteria 2883068021 2883070684 197
27 3300005985 Ga0081539_10063003 Ga0081539_100630033 198
28 3300031727 Ga0316576_10020184 Ga0316576_100201841 198
29 3300031728 Ga0316578_10448358 Ga0316578_104483581 198
30 3300041511 Ga0451855_0322957 Ga0451855_0322957_28_645 198
31 3300044712 Ga0453684_0274628 Ga0453684_0274628_889_1485 198
32 3300014326 Ga0157380_10185368 Ga0157380_101853681 199
33 iso_pu_bacteria 2833640130 2833640880 199
34 3300005329 Ga0070683_100235177 Ga0070683_1002351773 200
35 3300005466 Ga0070685_10136905 Ga0070685_101369052 200
36 3300005617 Ga0068859_101014791 Ga0068859_1010147911 200
37 3300005843 Ga0068860_100016515 Ga0068860_1000165155 200
38 3300005843 Ga0068860_100303192 Ga0068860_1003031922 200
39 3300005844 Ga0068862_100185051 Ga0068862_1001850513 200
40 3300009553 Ga0105249_11110251 Ga0105249_111102512 200
41 3300013306 Ga0163162_10234411 Ga0163162_102344111 200
42 3300014325 Ga0163163_10000344 Ga0163163_1000034436 200
43 3300014968 Ga0157379_10342729 Ga0157379_103427292 200
44 3300025925 Ga0207650_10146025 Ga0207650_101460252 200
45 3300028381 Ga0268264_10015156 Ga0268264_100151568 200
46 3300028381 Ga0268264_10021945 Ga0268264_100219453 200
47 3300049571 Ga0501034_0145178 Ga0501034_0145178_1300_1929 200
48 3300049579 Ga0501043_0585391 Ga0501043_0585391_70_699 200
49 3300005327 Ga0070658_10107150 Ga0070658_101071503 201
50 3300005327 Ga0070658_10248634 Ga0070658_102486341 201
51 3300005339 Ga0070660_100346107 Ga0070660_1003461072 201
52 3300005530 Ga0070679_100398655 Ga0070679_1003986551 201
53 3300005563 Ga0068855_100492752 Ga0068855_1004927522 201
54 3300005616 Ga0068852_100309364 Ga0068852_1003093642 201
55 3300009174 Ga0105241_10304264 Ga0105241_103042642 201
56 3300013102 Ga0157371_10021383 Ga0157371_100213832 201
57 3300013105 Ga0157369_10357831 Ga0157369_103578311 201
58 3300013296 Ga0157374_10018424 Ga0157374_100184242 201
59 3300013307 Ga0157372_10957228 Ga0157372_109572282 201
60 3300021384 Ga0213876_10005972 Ga0213876_100059727 201
61 3300025904 Ga0207647_10067897 Ga0207647_100678972 201
62 3300025909 Ga0207705_10034353 Ga0207705_100343532 201
63 3300025909 Ga0207705_10092815 Ga0207705_100928153 201
64 3300025949 Ga0207667_10585863 Ga0207667_105858632 201
65 3300026142 Ga0207698_10178842 Ga0207698_101788422 201
66 3300032126 Ga0307415_100375788 Ga0307415_1003757882 201
67 3300037312 Ga0395899_0238652 Ga0395899_0238652_116_751 201
68 3300037418 Ga0395900_0032677 Ga0395900_0032677_1295_1930 201
69 3300037466 Ga0395898_0111849 Ga0395898_0111849_749_1384 201
70 3300038443 Ga0395901_0063026 Ga0395901_0063026_2657_3292 201
71 3300039062 Ga0400483_030081 Ga0400483_030081_6085_6690 201
72 3300039062 Ga0400483_225615 Ga0400483_225615_10605_11210 201
73 3300039437 Ga0436365_0548634 Ga0436365_0548634_9695_10327 201
74 3300053090 Ga0500646_0019238 Ga0500646_0019238_769_1389 201
75 3300053090 Ga0500646_0020817 Ga0500646_0020817_62_670 201
76 iso_pu_bacteria 2738541273 2738698796 201
77 iso_pu_bacteria 2738543014 2739253122 201
78 3300005578 Ga0068854_100244523 Ga0068854_1002445231 202
79 3300009094 Ga0111539_10007155 Ga0111539_100071553 202
80 3300014326 Ga0157380_10467576 Ga0157380_104675762 202
81 3300027907 Ga0207428_10014461 Ga0207428_100144615 202
82 3300031727 Ga0316576_10012978 Ga0316576_100129786 202
83 3300031727 Ga0316576_10234383 Ga0316576_102343831 202
84 iso_pu_bacteria 2523533629 2524006546 202
85 3300005327 Ga0070658_10110291 Ga0070658_101102913 203
86 3300005337 Ga0070682_100008811 Ga0070682_1000088115 203
87 3300005458 Ga0070681_10044225 Ga0070681_100442253 203
88 3300005530 Ga0070679_100191149 Ga0070679_1001911493 203
89 3300005535 Ga0070684_100334360 Ga0070684_1003343601 203
90 3300005539 Ga0068853_100332963 Ga0068853_1003329631 203
91 3300005563 Ga0068855_100050147 Ga0068855_1000501473 203
92 3300005578 Ga0068854_100091707 Ga0068854_1000917072 203
93 3300005578 Ga0068854_100761624 Ga0068854_1007616242 203
94 3300005614 Ga0068856_100011695 Ga0068856_1000116959 203
95 3300005616 Ga0068852_100020254 Ga0068852_1000202548 203
96 3300006195 Ga0075366_10168157 Ga0075366_101681572 203
97 3300009093 Ga0105240_10051078 Ga0105240_100510783 203
98 3300009174 Ga0105241_10008820 Ga0105241_100088204 203
99 3300009545 Ga0105237_10982818 Ga0105237_109828181 203
100 3300010375 Ga0105239_10034503 Ga0105239_100345037 203
101 3300013100 Ga0157373_10009099 Ga0157373_100090997 203
102 3300013102 Ga0157371_10051257 Ga0157371_100512572 203
103 3300013105 Ga0157369_10020421 Ga0157369_100204214 203
104 3300013307 Ga0157372_10034921 Ga0157372_100349213 203
105 3300025909 Ga0207705_10556321 Ga0207705_105563211 203
106 3300025911 Ga0207654_10037300 Ga0207654_100373003 203
107 3300025912 Ga0207707_10101109 Ga0207707_101011094 203
108 3300025913 Ga0207695_10004070 Ga0207695_100040705 203
109 3300025914 Ga0207671_10733922 Ga0207671_107339221 203
110 3300025921 Ga0207652_10224361 Ga0207652_102243612 203
111 3300025949 Ga0207667_10040941 Ga0207667_100409414 203
112 3300026041 Ga0207639_10677106 Ga0207639_106771061 203
113 3300026078 Ga0207702_10077319 Ga0207702_100773194 203
114 3300026142 Ga0207698_10003055 Ga0207698_100030556 203
115 3300039437 Ga0436365_1144642 Ga0436365_1144642_125_763 203
116 3300044656 Ga0466969_0000004 Ga0466969_0000004_91094_91741 203
117 3300044684 Ga0466966_0000075 Ga0466966_0000075_59356_60003 203
118 3300044719 Ga0466971_0099535 Ga0466971_0099535_74_721 203
119 3300045049 Ga0466959_0000004 Ga0466959_0000004_176203_176850 203
120 iso_pu_bacteria 2511231000 2511232366 203
121 iso_pu_bacteria 2582581278 2585143041 203
122 iso_pu_bacteria 2582581281 2585159502 203
123 iso_pu_bacteria 2582581282 2585163750 203
124 iso_pu_bacteria 2582581873 2585426798 203
125 iso_pu_bacteria 2585428045 2587679194 203
126 iso_pu_bacteria 2585428061 2587751893 203
127 iso_pu_bacteria 2585428095 2587866235 203
128 iso_pu_bacteria 2585428115 2587944956 203
129 iso_pu_bacteria 2585428182 2588210867 203
130 iso_pu_bacteria 2585428183 2588215305 203
131 iso_pu_bacteria 2585428184 2588218719 203
132 iso_pu_bacteria 2585428187 2588232372 203
133 iso_pu_bacteria 2588253712 2588446936 203
134 iso_pu_bacteria 2588254255 2590603811 203
135 iso_pu_bacteria 2588254257 2590609589 203
136 iso_pu_bacteria 2728369107 2729201401 203
137 iso_pu_bacteria 2739367874 2740059873 203
138 iso_pu_bacteria 2751185877 2753673666 203
139 iso_pu_bacteria 2765235839 2765575049 203
140 iso_pu_bacteria 2772190705 2772603641 203
141 iso_pu_bacteria 2775506739 2775674820 203
142 iso_pu_bacteria 2816332188 2816874909 203
143 iso_pu_bacteria 2818991444 2819589714 203
144 iso_pu_bacteria 2842083920 2842084462 203
145 iso_pu_bacteria 2871720351 2871723016 203
146 iso_pu_bacteria 2889290771 2889294391 203
147 iso_pu_bacteria 2905999023 2906002274 203
148 iso_pu_bacteria 2919097161 2919098439 203
149 iso_pu_bacteria 2919399522 2919401854 203
150 iso_pu_bacteria 2945924605 2945925127 203
151 iso_pu_bacteria 2946019816 2946023509 203
152 iso_pu_bacteria 2977243572 2977243897 203
153 iso_pu_bacteria 2984572630 2984574123 203
154 iso_pu_bacteria 2984606641 2984607574 203
155 iso_pu_bacteria 2993372514 2993375426 203
156 iso_pu_bacteria 2993480792 2993482280 203
157 3300005329 Ga0070683_100300831 Ga0070683_1003008311 204
158 3300005539 Ga0068853_100527265 Ga0068853_1005272651 204
159 3300009176 Ga0105242_11017167 Ga0105242_110171672 204
160 3300013102 Ga0157371_10105240 Ga0157371_101052403 204
161 3300013307 Ga0157372_10244693 Ga0157372_102446933 204
162 3300025911 Ga0207654_10230349 Ga0207654_102303492 204
163 3300025934 Ga0207686_10794300 Ga0207686_107943002 204
164 3300026041 Ga0207639_10493914 Ga0207639_104939141 204
165 3300031251 Ga0265327_10000288 Ga0265327_1000028864 204
166 3300044706 Ga0466964_0010304 Ga0466964_0010304_1640_2281 204
167 3300005327 Ga0070658_10059151 Ga0070658_100591513 205
168 3300005843 Ga0068860_100004119 Ga0068860_10000411916 205
169 3300005844 Ga0068862_100002988 Ga0068862_1000029882 205
170 3300009553 Ga0105249_10104154 Ga0105249_101041542 205
171 3300013306 Ga0163162_10137222 Ga0163162_101372224 205
172 3300013308 Ga0157375_10467982 Ga0157375_104679821 205
173 3300014325 Ga0163163_10422970 Ga0163163_104229702 205
174 3300025917 Ga0207660_10117563 Ga0207660_101175632 205
175 3300025925 Ga0207650_10728529 Ga0207650_107285291 205
176 3300025961 Ga0207712_10113641 Ga0207712_101136411 205
177 3300026142 Ga0207698_10129176 Ga0207698_101291763 205
178 3300028381 Ga0268264_10039184 Ga0268264_100391842 205
179 3300028573 Ga0265334_10147061 Ga0265334_101470612 205
180 3300041494 Ga0451837_1451645 Ga0451837_1451645_1070_1687 205
181 3300045051 Ga0451576_0841878 Ga0451576_0841878_101_718 205
182 3300049579 Ga0501043_0544485 Ga0501043_0544485_47_691 205
183 3300049581 Ga0501047_0387317 Ga0501047_0387317_469_1113 205
184 3300049583 Ga0501067_0015784 Ga0501067_0015784_699_1343 205
185 3300049586 Ga0501070_0847256 Ga0501070_0847256_59_703 205
186 3300049742 Ga0501080_0120511 Ga0501080_0120511_102_746 205
187 3300049744 Ga0501083_0048911 Ga0501083_0048911_411_1055 205
188 3300049823 Ga0501044_0068493 Ga0501044_0068493_1325_1969 205
189 3300060353 Ga0501082_0211282 Ga0501082_0211282_274_918 205
190 3300009545 Ga0105237_10780788 Ga0105237_107807882 206
191 3300013102 Ga0157371_10000451 Ga0157371_1000045110 206
192 3300044672 Ga0466982_0183199 Ga0466982_0183199_347_967 206
193 3300003322 rootL2_10032803 rootL2_100328032 207
194 3300003323 rootH1_10378359 rootH1_103783591 207
195 3300003578 Ga0006562J51391_1007212 Ga0006562J51391_10072122 207
196 3300005288 Ga0065714_10002233 Ga0065714_1000223316 207
197 3300005327 Ga0070658_10837588 Ga0070658_108375881 207
198 3300005329 Ga0070683_100003565 Ga0070683_1000035656 207
199 3300005329 Ga0070683_100182102 Ga0070683_1001821022 207
200 3300005337 Ga0070682_100181964 Ga0070682_1001819642 207
201 3300005347 Ga0070668_100013232 Ga0070668_1000132326 207
202 3300005456 Ga0070678_100204134 Ga0070678_1002041342 207
203 3300005458 Ga0070681_10020415 Ga0070681_100204154 207
204 3300005530 Ga0070679_100001149 Ga0070679_1000011496 207
205 3300005535 Ga0070684_100002317 Ga0070684_10000231710 207
206 3300005535 Ga0070684_100087297 Ga0070684_1000872973 207
207 3300005564 Ga0070664_100084758 Ga0070664_1000847582 207
208 3300005614 Ga0068856_100222329 Ga0068856_1002223291 207
209 3300005614 Ga0068856_100345616 Ga0068856_1003456162 207
210 3300005616 Ga0068852_100000848 Ga0068852_10000084817 207
211 3300009092 Ga0105250_10069119 Ga0105250_100691192 207
212 3300013100 Ga0157373_10000020 Ga0157373_1000002071 207
213 3300013102 Ga0157371_10020618 Ga0157371_100206183 207
214 3300013104 Ga0157370_10002841 Ga0157370_1000284112 207
215 3300013104 Ga0157370_10205025 Ga0157370_102050253 207
216 3300013104 Ga0157370_10419064 Ga0157370_104190642 207
217 3300013308 Ga0157375_10015783 Ga0157375_100157839 207
218 3300014497 Ga0182008_10000005 Ga0182008_10000005319 207
219 3300015261 Ga0182006_1000001 Ga0182006_1000001263 207
220 3300025250 Ga0209026_1000427 Ga0209026_100042731 207
221 3300025711 Ga0207696_1052401 Ga0207696_10524012 207
222 3300025909 Ga0207705_10423187 Ga0207705_104231872 207
223 3300025909 Ga0207705_10682175 Ga0207705_106821751 207
224 3300025919 Ga0207657_10010738 Ga0207657_100107388 207
225 3300025921 Ga0207652_10017767 Ga0207652_100177673 207
226 3300025935 Ga0207709_10000044 Ga0207709_1000004497 207
227 3300025944 Ga0207661_10002486 Ga0207661_1000248610 207
228 3300025944 Ga0207661_10021073 Ga0207661_100210732 207
229 3300025972 Ga0207668_10045522 Ga0207668_100455223 207
230 3300026078 Ga0207702_10008852 Ga0207702_1000885210 207
231 3300026078 Ga0207702_10960997 Ga0207702_109609971 207
232 3300031911 Ga0307412_10000006 Ga0307412_10000006290 207
233 3300031911 Ga0307412_10003394 Ga0307412_100033942 207
234 3300032002 Ga0307416_100000059 Ga0307416_10000005963 207
235 3300032004 Ga0307414_10000025 Ga0307414_10000025166 207
236 3300041411 Ga0439466_0027324 Ga0439466_0027324_1177_1800 207
237 3300041413 Ga0439465_0000844 Ga0439465_0000844_6391_7014 207
238 3300041486 Ga0451807_1656814 Ga0451807_1656814_361_984 207
239 3300042004 Ga0439445_0000120 Ga0439445_0000120_9663_10286 207
240 3300046453 Ga0495627_000012 Ga0495627_000012_48088_48711 207
241 3300046453 Ga0495627_005285 Ga0495627_005285_2950_3573 207
242 3300046500 Ga0495596_0000997 Ga0495596_0000997_28_651 207
243 3300046512 Ga0495610_0000005 Ga0495610_0000005_818642_819265 207
244 3300046519 Ga0495632_0000339 Ga0495632_0000339_30503_31126 207
245 3300046522 Ga0495643_0038888 Ga0495643_0038888_1201_1824 207
246 3300046525 Ga0495663_0000047 Ga0495663_0000047_22314_22937 207
247 3300046525 Ga0495663_0002390 Ga0495663_0002390_3048_3671 207
248 3300046538 Ga0495609_0000003 Ga0495609_0000003_223811_224434 207
249 3300046558 Ga0495633_0000001 Ga0495633_0000001_277470_278093 207
250 3300046558 Ga0495633_0000326 Ga0495633_0000326_44005_44628 207
251 3300046660 Ga0495625_0000251 Ga0495625_0000251_63293_63916 207
252 3300046810 Ga0495660_0042575 Ga0495660_0042575_1268_1891 207
253 3300047472 Ga0495686_0000122 Ga0495686_0000122_30349_30972 207
254 3300047472 Ga0495686_0004873 Ga0495686_0004873_2806_3453 207
255 3300047472 Ga0495686_0016604 Ga0495686_0016604_2444_3067 207
256 3300048925 Ga0496122_0000480 Ga0496122_0000480_58225_58848 207
257 3300048925 Ga0496122_0000729 Ga0496122_0000729_19890_20513 207
258 3300048925 Ga0496122_0002571 Ga0496122_0002571_21161_21784 207
259 3300048926 Ga0496123_0104458 Ga0496123_0104458_580_1203 207
260 3300048926 Ga0496123_0111202 Ga0496123_0111202_13_636 207
261 3300048927 Ga0496124_0060463 Ga0496124_0060463_1047_1697 207
262 3300048928 Ga0496125_0039049 Ga0496125_0039049_2543_3166 207
263 3300048929 Ga0496126_0159974 Ga0496126_0159974_1276_1899 207
264 3300048929 Ga0496126_0160384 Ga0496126_0160384_508_1131 207
265 3300049551 Ga0501335_003534 Ga0501335_003534_207_830 207
266 3300049758 Ga0501241_000008 Ga0501241_000008_92878_93501 207
267 3300049766 Ga0501269_000081 Ga0501269_000081_10591_11214 207
268 3300049766 Ga0501269_017148 Ga0501269_017148_169_804 207
269 3300042876 Ga0451577_0353086 Ga0451577_0353086_288_917 208
270 3300044712 Ga0453684_0006110 Ga0453684_0006110_11139_11768 208
271 3300049569 Ga0501032_0031070 Ga0501032_0031070_1140_1877 210
272 iso_pu_bacteria 2585428060 2587750139 213
273 3300003320 rootH2_10081154 rootH2_100811544 217
274 3300003323 rootH1_10106623 rootH1_101066236 217
275 3300009036 Ga0105244_10000029 Ga0105244_10000029162 217
276 3300009148 Ga0105243_10054023 Ga0105243_100540233 217
277 3300025291 Ga0209675_1000351 Ga0209675_100035118 217
278 3300025728 Ga0207655_1000097 Ga0207655_100009725 217
279 3300025935 Ga0207709_10047025 Ga0207709_100470252 217
280 3300025972 Ga0207668_10012287 Ga0207668_100122874 217
281 3300032004 Ga0307414_10204391 Ga0307414_102043912 217
282 3300046507 Ga0495606_0016066 Ga0495606_0016066_3656_4309 217
283 3300046522 Ga0495643_0230252 Ga0495643_0230252_76_732 217
284 3300048905 Ga0496102_0045813 Ga0496102_0045813_1429_2082 217
285 3300048906 Ga0496103_0038281 Ga0496103_0038281_1034_1687 217
286 3300048919 Ga0496116_0000051 Ga0496116_0000051_31447_32100 217
287 3300048920 Ga0496117_0000007 Ga0496117_0000007_688355_689008 217
288 3300048921 Ga0496118_0000118 Ga0496118_0000118_31437_32090 217
289 3300048922 Ga0496119_0000028 Ga0496119_0000028_31396_32049 217
290 3300048924 Ga0496121_0032670 Ga0496121_0032670_2223_2876 217
291 3300048925 Ga0496122_0001800 Ga0496122_0001800_31396_32049 217
292 3300048925 Ga0496122_0017551 Ga0496122_0017551_4890_5543 217
293 3300048926 Ga0496123_0001671 Ga0496123_0001671_16515_17168 217
294 3300048926 Ga0496123_0028801 Ga0496123_0028801_2711_3364 217
295 3300048927 Ga0496124_0006296 Ga0496124_0006296_4738_5391 217
296 3300048928 Ga0496125_0001242 Ga0496125_0001242_27697_28350 217
297 3300048928 Ga0496125_0007054 Ga0496125_0007054_2266_2919 217
298 3300048929 Ga0496126_0001360 Ga0496126_0001360_22742_23395 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01926

MMR_HSR1

50S ribosome-binding GTPase

61

187

0.78

PF02421

FeoB_N

Ferrous iron transport protein B

60

228

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pqc-assembly1.cif.gz_A crystal structure of thermotoga maritima ribosome biogenesis gtp-binding protein engb (ysxc/yiha) in complex with gdp 0.9467 12 203
3pr1-assembly1.cif.gz_A crystal structure of apo thermotoga maritima ribosome biogenesis gtp-binding protein engb 0.9466 12 203
1svi-assembly1.cif.gz_A crystal structure of the gtp-binding protein ysxc complexed with gdp 0.9335 11 206
1svw-assembly2.cif.gz_B crystal structure of ysxc complexed with gmppnp 0.9317 11 203
3pqc-assembly1.cif.gz_A crystal structure of thermotoga maritima ribosome biogenesis gtp-binding protein engb (ysxc/yiha) in complex with gdp 0.9278 12 203
ID Description Score Start End Superfamily
af_Q5JM78_110_312_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9642 12 206 3.40.50.300
3pqcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9467 12 203 3.40.50.300
3pr1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9466 12 203 3.40.50.300
af_Q55EM7_210_411_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.946 14 206 3.40.50.300
af_Q8IL49_94_294_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9444 15 203 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3E1P2K2-F1-model_v4 Probable GTP-binding protein EngB 0.9927 11 210 GO:0000917
GO:0005525
GO:0046872
AF-A0A2B7ZZR6-F1-model_v4 GTP-binding protein EngB 0.9925 85 203 GO:0005525
AF-A0A0M3C9E9-F1-model_v4 deleted 0.9919 11 205
AF-A0A848IZ38-F1-model_v4 Probable GTP-binding protein EngB 0.9879 13 206 GO:0000917
GO:0005525
GO:0046872
AF-A0A1V6I1A8-F1-model_v4 Probable GTP-binding protein EngB 0.9875 11 203 GO:0000917
GO:0005525
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.85 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map