F394306

General Info

Members Datasets Scaffolds Average Seq Length
298 221 596 162

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10497809|Ga0207650_104978092
Length 194
Sequence MATASHLQNRARNMRCACNIRLPDPLPWRQDAVKPAKNTICLWYDRDAEEAARFYAKTFPDSAVGAVHRAPGDYPAGKQGDVLTVEFTVMGIPCLGLNGGPQFKHNEAFSFQVATADQAETDRYWNAIVANGGQESECGWCKDRWGLSWQITPVALIQAITDADPAAAKRAFEAMMQMGKIDIAAIEAARRGGS

Samples

Sample ID Description Type Environment
1 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
68 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
150 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
186 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
187 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
188 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
189 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
192 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
193 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
194 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
195 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
196 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
197 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
198 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
199 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
202 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
203 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
204 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
205 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
206 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
207 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
208 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
209 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
221 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.48
Nodule 0.34
Rhizoplane 1.34
Rhizosphere 73.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207650_10497809 3300025925 Bacteria 1018
2 JGI25158J39367_1001674 3300002739 Bacteria 3811
3 JGI25152J39213_1027292 3300002773 Bacteria 921
4 JGI25150J39212_1000836 3300002774 Bacteria 10318
5 JGI25159J45721_1001676 3300002987 Bacteria 8981
6 JGI25151J46595_10019700 3300003187 Bacteria 2860
7 JGI25160J50197_1002292 3300003354 Bacteria 8968
8 JGI25407J50210_10016666 3300003373 Bacteria 1904
9 JGI25161J50226_1000568 3300003374 Bacteria 15639
10 Ga0055526_1001304 3300003771 Bacteria 17872
11 Ga0055526_1027829 3300003771 Bacteria 1732
12 Ga0055537_1000853 3300003773 Bacteria 14833
13 Ga0055537_1018551 3300003773 Bacteria 1108
14 Ga0055537_1018553 3300003773 Bacteria 1107
15 Ga0055524_1003008 3300003775 Bacteria 8354
16 Ga0055524_1003701 3300003775 Bacteria 7317
17 Ga0055534_1000803 3300003784 Bacteria 14593
18 Ga0055534_1030047 3300003784 Bacteria 842
19 Ga0055528_1001770 3300003790 Bacteria 12400
20 Ga0055530_10000609 3300003791 Bacteria 31062
21 Ga0055530_10003535 3300003791 Bacteria 8816
22 Ga0055530_10004995 3300003791 Bacteria 6549
23 Ga0055530_10009948 3300003791 Bacteria 3581
24 Ga0055540_1008801 3300003792 Bacteria 3581
25 Ga0055531_10005239 3300003794 Bacteria 7617
26 Ga0065712_10248741 3300005290 Bacteria 965
27 Ga0070676_10913371 3300005328 Bacteria 655
28 Ga0070683_100156898 3300005329 Bacteria 2158
29 Ga0070690_100000262 3300005330 Bacteria 27093
30 Ga0070690_100297652 3300005330 Bacteria 1156
31 Ga0070670_100012775 3300005331 Bacteria 7186
32 Ga0070680_100110643 3300005336 Bacteria 2287
33 Ga0068868_100761961 3300005338 Bacteria 870
34 Ga0070689_100000033 3300005340 Bacteria 91630
35 Ga0070687_100001489 3300005343 Bacteria 8262
36 Ga0070688_100000037 3300005365 Bacteria 61098
37 Ga0070659_100834229 3300005366 Bacteria 803
38 Ga0070714_100054220 3300005435 Bacteria 3425
39 Ga0070713_100008711 3300005436 Bacteria 7215
40 Ga0070713_100008980 3300005436 Bacteria 7124
41 Ga0070701_10000186 3300005438 Bacteria 19323
42 Ga0070711_100848721 3300005439 Bacteria 777
43 Ga0070700_100002398 3300005441 Bacteria 9553
44 Ga0070663_100384512 3300005455 Bacteria 1144
45 Ga0070662_100077661 3300005457 Bacteria 2464
46 Ga0070662_100249936 3300005457 Bacteria 1425
47 Ga0068867_100002639 3300005459 Bacteria 12647
48 Ga0070685_10000094 3300005466 Bacteria 55308
49 Ga0070679_100062545 3300005530 Bacteria 3711
50 Ga0070684_100003751 3300005535 Bacteria 11467
51 Ga0070686_100000046 3300005544 Bacteria 101202
52 Ga0070693_100077121 3300005547 Bacteria 1977
53 Ga0068855_100094885 3300005563 Bacteria 3439
54 Ga0070664_100080211 3300005564 Bacteria 2810
55 Ga0068856_100239489 3300005614 Bacteria 1830
56 Ga0068852_100353137 3300005616 Bacteria 1436
57 Ga0068859_100000268 3300005617 Bacteria 52155
58 Ga0068859_100097946 3300005617 Bacteria 2986
59 Ga0068859_100583246 3300005617 Bacteria 1212
60 Ga0068864_100011665 3300005618 Bacteria 7257
61 Ga0068861_100128069 3300005719 Bacteria 2057
62 Ga0068863_100042223 3300005841 Bacteria 4333
63 Ga0068863_100147483 3300005841 Bacteria 2251
64 Ga0068858_101296795 3300005842 Bacteria 717
65 Ga0081538_10031709 3300005981 Bacteria 3558
66 Ga0070717_10015715 3300006028 Bacteria 5851
67 Ga0070717_10442312 3300006028 Bacteria 1171
68 Ga0070712_100041484 3300006175 Bacteria 3160
69 Ga0075366_10037928 3300006195 Bacteria 2846
70 Ga0097621_100356648 3300006237 Bacteria 1302
71 Ga0075428_100464800 3300006844 Bacteria 1355
72 Ga0075431_100021689 3300006847 Bacteria 6568
73 Ga0097620_100000268 3300006931 Bacteria 52155
74 Ga0097620_100097944 3300006931 Bacteria 2986
75 Ga0097620_100583235 3300006931 Bacteria 1212
76 Ga0111539_10064550 3300009094 Bacteria 4330
77 Ga0111539_10079223 3300009094 Bacteria 3864
78 Ga0114129_10002944 3300009147 Bacteria 23825
79 Ga0105242_10196645 3300009176 Bacteria 1788
80 Ga0105248_10002064 3300009177 Bacteria 22260
81 Ga0105248_10596394 3300009177 Bacteria 1246
82 Ga0105248_10675513 3300009177 Bacteria 1165
83 Ga0105237_10001355 3300009545 Bacteria 32411
84 Ga0105238_10005762 3300009551 Bacteria 12259
85 Ga0105249_10039878 3300009553 Bacteria 4264
86 Ga0105249_10126411 3300009553 Bacteria 2435
87 Ga0105249_11660503 3300009553 Bacteria 711
88 Ga0105239_10000498 3300010375 Bacteria 56798
89 Ga0157317_1011198 3300012475 Bacteria 696
90 Ga0157324_1025338 3300012506 Bacteria 635
91 Ga0157373_10000087 3300013100 Bacteria 80308
92 Ga0157370_10794545 3300013104 Bacteria 861
93 Ga0157374_10021665 3300013296 Bacteria 5723
94 Ga0157374_10240768 3300013296 Bacteria 1779
95 Ga0157374_10989253 3300013296 Bacteria 860
96 Ga0157374_11713504 3300013296 Bacteria 653
97 Ga0157378_10024420 3300013297 Bacteria 5318
98 Ga0157378_10868117 3300013297 Bacteria 931
99 Ga0163162_11916809 3300013306 Bacteria 678
100 Ga0157372_10002085 3300013307 Bacteria 21727
101 Ga0157375_10013908 3300013308 Bacteria 7176
102 Ga0163163_10031269 3300014325 Bacteria 5137
103 Ga0157380_10357138 3300014326 Bacteria 1370
104 Ga0209436_100322 3300025208 Bacteria 21971
105 Ga0207425_1000354 3300025245 Bacteria 31834
106 Ga0207425_1010066 3300025245 Bacteria 2316
107 Ga0209759_1001764 3300025256 Bacteria 11047
108 Ga0209129_1002425 3300025258 Bacteria 9165
109 Ga0209565_1000102 3300025263 Bacteria 127545
110 Ga0209565_1001107 3300025263 Bacteria 13233
111 Ga0209565_1006292 3300025263 Bacteria 3347
112 Ga0209565_1015255 3300025263 Bacteria 1737
113 Ga0209565_1023472 3300025263 Bacteria 1266
114 Ga0209565_1026518 3300025263 Bacteria 1161
115 Ga0209673_1000305 3300025273 Bacteria 91144
116 Ga0209673_1028871 3300025273 Bacteria 1777
117 Ga0209130_1000134 3300025284 Bacteria 119102
118 Ga0209130_1000493 3300025284 Bacteria 40544
119 Ga0209675_1000358 3300025291 Bacteria 39167
120 Ga0209675_1001649 3300025291 Bacteria 12431
121 Ga0209675_1002650 3300025291 Bacteria 9037
122 Ga0209676_1000145 3300025292 Bacteria 174391
123 Ga0209025_1030790 3300025294 Bacteria 2557
124 Ga0209025_1038419 3300025294 Bacteria 2106
125 Ga0209564_1000098 3300025295 Bacteria 228906
126 Ga0209564_1001063 3300025295 Bacteria 33327
127 Ga0209564_1001955 3300025295 Bacteria 18174
128 Ga0209564_1002748 3300025295 Bacteria 13233
129 Ga0209050_1000023 3300025298 Bacteria 537172
130 Ga0209050_1000183 3300025298 Bacteria 142357
131 Ga0209050_1000939 3300025298 Bacteria 38082
132 Ga0209050_1001801 3300025298 Bacteria 20967
133 Ga0209256_1000003 3300025299 Bacteria 1661127
134 Ga0209256_1001704 3300025299 Bacteria 21157
135 Ga0209256_1013880 3300025299 Bacteria 2954
136 Ga0209256_1019568 3300025299 Bacteria 2149
137 Ga0209256_1041501 3300025299 Bacteria 1169
138 Ga0207426_1001622 3300025302 Bacteria 17766
139 Ga0207426_1016196 3300025302 Bacteria 2683
140 Ga0209051_1000017 3300025303 Bacteria 537172
141 Ga0209257_1000010 3300025304 Bacteria 1158682
142 Ga0209257_1000041 3300025304 Bacteria 537172
143 Ga0209257_1001077 3300025304 Bacteria 35853
144 Ga0209257_1009267 3300025304 Bacteria 5324
145 Ga0207699_10055303 3300025906 Bacteria 2361
146 Ga0207699_10072638 3300025906 Bacteria 2108
147 Ga0207705_10209658 3300025909 Bacteria 1478
148 Ga0207705_10608193 3300025909 Bacteria 850
149 Ga0207695_10012942 3300025913 Bacteria 9978
150 Ga0207695_11448764 3300025913 Bacteria 567
151 Ga0207671_10007284 3300025914 Bacteria 9625
152 Ga0207693_10041286 3300025915 Bacteria 3632
153 Ga0207663_10238762 3300025916 Bacteria 1332
154 Ga0207660_10354147 3300025917 Bacteria 1177
155 Ga0207662_10203444 3300025918 Bacteria 1283
156 Ga0207652_10023008 3300025921 Bacteria 5162
157 Ga0207652_11143422 3300025921 Bacteria 680
158 Ga0207694_10010411 3300025924 Bacteria 7011
159 Ga0207700_10470604 3300025928 Bacteria 1109
160 Ga0207664_10081047 3300025929 Bacteria 2640
161 Ga0207664_10087249 3300025929 Bacteria 2550
162 Ga0207690_10228005 3300025932 Bacteria 1429
163 Ga0207706_10290199 3300025933 Bacteria 1426
164 Ga0207686_10041530 3300025934 Bacteria 2805
165 Ga0207670_10000042 3300025936 Bacteria 98927
166 Ga0207711_10955203 3300025941 Bacteria 796
167 Ga0207679_10059395 3300025945 Bacteria 2837
168 Ga0207679_10265931 3300025945 Bacteria 1465
169 Ga0207667_10256029 3300025949 Bacteria 1790
170 Ga0207712_10270590 3300025961 Bacteria 1382
171 Ga0207703_11635868 3300026035 Bacteria 619
172 Ga0207708_10000084 3300026075 Bacteria 73337
173 Ga0207641_10102757 3300026088 Bacteria 2521
174 Ga0207648_10010139 3300026089 Bacteria 8959
175 Ga0207648_10613269 3300026089 Bacteria 1004
176 Ga0207428_10014921 3300027907 Bacteria 6731
177 Ga0307515_10002157 3300028794 Bacteria 43195
178 Ga0307515_10680646 3300028794 Bacteria 643
179 Ga0316182_1420520 3300030745 Bacteria 572
180 Ga0265331_10099837 3300031250 Bacteria 1337
181 Ga0307408_100000569 3300031548 Bacteria 31764
182 Ga0307408_100001191 3300031548 Bacteria 19661
183 Ga0307408_100013596 3300031548 Bacteria 5404
184 Ga0307408_100066400 3300031548 Bacteria 2649
185 Ga0307408_100691653 3300031548 Bacteria 916
186 Ga0307408_101595257 3300031548 Bacteria 619
187 Ga0307514_10015022 3300031649 Bacteria 6395
188 Ga0307405_10077613 3300031731 Bacteria 2159
189 Ga0307413_10425779 3300031824 Bacteria 1047
190 Ga0307406_10014008 3300031901 Bacteria 4606
191 Ga0307406_10084483 3300031901 Bacteria 2120
192 Ga0307407_10018173 3300031903 Bacteria 3549
193 Ga0307412_10040391 3300031911 Bacteria 3018
194 Ga0307409_100026482 3300031995 Bacteria 4090
195 Ga0307409_101532927 3300031995 Bacteria 694
196 Ga0307416_100010042 3300032002 Bacteria 6235
197 Ga0307414_10668089 3300032004 Bacteria 938
198 Ga0307411_10325585 3300032005 Bacteria 1243
199 Ga0307415_100055296 3300032126 Bacteria 2715
200 Ga0307510_10189848 3300033180 Bacteria 1604
201 Ga0373934_0000119 3300035086 Bacteria 28366
202 Ga0373923_0001485 3300035111 Bacteria 6751
203 Ga0373953_0002820 3300035117 Bacteria 5286
204 Ga0373956_0000530 3300035119 Bacteria 15659
205 Ga0373955_0000423 3300035172 Bacteria 17853
206 Ga0373933_0000326 3300035724 Bacteria 30682
207 Ga0373937_0000220 3300036401 Bacteria 55056
208 Ga0373925_0202390 3300037068 Bacteria 1579
209 Ga0395899_0012585 3300037312 Bacteria 6486
210 Ga0395899_0025744 3300037312 Bacteria 4440
211 Ga0395899_0987300 3300037312 Bacteria 508
212 Ga0395900_0016852 3300037418 Bacteria 7455
213 Ga0395900_0139092 3300037418 Bacteria 2487
214 Ga0395900_0337359 3300037418 Bacteria 1484
215 Ga0395898_0007612 3300037466 Bacteria 11496
216 Ga0395898_0018560 3300037466 Bacteria 7091
217 Ga0395898_0262546 3300037466 Bacteria 1647
218 Ga0395905_0016625 3300037471 Bacteria 6994
219 Ga0395905_0396593 3300037471 Bacteria 1274
220 Ga0395901_0114518 3300038443 Bacteria 2832
221 Ga0436365_0734071 3300039437 Bacteria 1144
222 Ga0439439_0020864 3300041406 Bacteria 1630
223 Ga0451795_1692151 3300041456 Bacteria 597
224 Ga0451576_0000500 3300045051 Bacteria 86034
225 Ga0466967_0007479 3300045976 Bacteria 7884
226 Ga0495592_0000603 3300046454 Bacteria 25336
227 Ga0495629_0003832 3300046459 Bacteria 11345
228 Ga0495653_0000148 3300046463 Bacteria 58325
229 Ga0495585_0000814 3300046492 Bacteria 27169
230 Ga0495608_0001043 3300046511 Bacteria 19489
231 Ga0495618_0119667 3300046514 Bacteria 1687
232 Ga0495628_0000148 3300046516 Bacteria 60692
233 Ga0495652_0000364 3300046529 Bacteria 53798
234 Ga0495665_0015247 3300046531 Bacteria 4141
235 Ga0495640_0417791 3300046533 Bacteria 822
236 Ga0495586_0058712 3300046535 Bacteria 2089
237 Ga0495587_0000431 3300046536 Bacteria 29416
238 Ga0495645_0000649 3300046543 Bacteria 23971
239 Ga0495667_0000332 3300046559 Bacteria 29868
240 Ga0495635_0000156 3300046663 Bacteria 41746
241 Ga0495657_0000732 3300046675 Bacteria 29430
242 Ga0495599_0020678 3300046678 Bacteria 4101
243 Ga0495623_0000027 3300046679 Bacteria 90239
244 Ga0495646_0001449 3300046680 Bacteria 14087
245 Ga0495600_0000091 3300046809 Bacteria 48962
246 Ga0495581_0029241 3300047315 Bacteria 3194
247 Ga0495604_0000535 3300047317 Bacteria 33495
248 Ga0495604_0446042 3300047317 Bacteria 846
249 Ga0495636_0037066 3300047318 Bacteria 2013
250 Ga0495680_0006410 3300047322 Bacteria 10942
251 Ga0495675_0021267 3300047444 Bacteria 4131
252 Ga0495684_0000876 3300047471 Bacteria 24425
253 Ga0495686_0004350 3300047472 Bacteria 11698
254 Ga0495593_0034191 3300047673 Bacteria 2766
255 Ga0495602_0000864 3300048088 Bacteria 29249
256 Ga0495615_0000813 3300048090 Bacteria 4376
257 Ga0496102_0744761 3300048905 Bacteria 903
258 Ga0496114_0148703 3300048917 Bacteria 2031
259 Ga0501290_074036 3300049513 Bacteria 570
260 Ga0501291_000969 3300049514 Bacteria 3303
261 Ga0501202_000394 3300049652 Bacteria 6087
262 Ga0501207_019782 3300049654 Bacteria 1070
263 Ga0501209_010143 3300049656 Bacteria 1926
264 Ga0501217_001172 3300049661 Bacteria 4818
265 Ga0501235_002165 3300049669 Bacteria 4215
266 Ga0501236_006535 3300049670 Bacteria 1435
267 Ga0501239_004555 3300049672 Bacteria 1365
268 Ga0501240_080998 3300049673 Bacteria 601
269 Ga0501242_000398 3300049674 Bacteria 3712
270 Ga0501243_000433 3300049675 Bacteria 5555
271 Ga0501249_000835 3300049679 Bacteria 6807
272 Ga0501256_007399 3300049685 Bacteria 1007
273 Ga0501221_000083 3300049704 Bacteria 10820
274 Ga0501225_0002669 3300049705 Bacteria 5476
275 Ga0501229_019477 3300049706 Bacteria 894
276 Ga0501241_003889 3300049758 Bacteria 2814
277 Ga0501265_001320 3300049762 Bacteria 2794
278 Ga0501268_000039 3300049765 Bacteria 10915
279 Ga0501270_001069 3300049767 Bacteria 2527
280 Ga0501272_051665 3300049769 Bacteria 572
281 Ga0501273_002649 3300049770 Bacteria 1840
282 Ga0501274_002270 3300049771 Bacteria 1504
283 Ga0501275_002776 3300049772 Bacteria 1604
284 nmdc:mga03n38_465179_c1 3300050490 Bacteria 705
285 nmdc:mga0k408_32591_c1 3300050493 Bacteria 2976
286 nmdc:mga05p37_1036200_c1 3300050507 Bacteria 867
287 nmdc:mga05p37_121579_c1 3300050507 Bacteria 3207
288 nmdc:mga09592_85286_c1 3300050508 Bacteria 2694
289 nmdc:mga06r32_38779_c1 3300050510 Bacteria 4517
290 nmdc:mga08y16_134599_c1 3300050511 Bacteria 2569
291 nmdc:mga08y16_168729_c1 3300050511 Bacteria 2274
292 Ga0495601_0055122 3300053077 Bacteria 2516
293 Ga0495612_0001548 3300053078 Bacteria 9477
294 Ga0495619_0000578 3300053085 Bacteria 24364
295 Ga0495619_0990225 3300053085 Bacteria 563
296 Ga0500616_0000614 3300053153 Bacteria 43228
297 2514045907 2513237165 Bacteria 6771773
298 2599903534 2599185292 Bacteria 6290804
299 Ga0207650_10497809
300 JGI25158J39367_1001674
301 JGI25152J39213_1027292
302 JGI25150J39212_1000836
303 JGI25159J45721_1001676
304 JGI25151J46595_10019700
305 JGI25160J50197_1002292
306 JGI25407J50210_10016666
307 JGI25161J50226_1000568
308 Ga0055526_1001304
309 Ga0055526_1027829
310 Ga0055537_1000853
311 Ga0055537_1018551
312 Ga0055537_1018553
313 Ga0055524_1003008
314 Ga0055524_1003701
315 Ga0055534_1000803
316 Ga0055534_1030047
317 Ga0055528_1001770
318 Ga0055530_10000609
319 Ga0055530_10003535
320 Ga0055530_10004995
321 Ga0055530_10009948
322 Ga0055540_1008801
323 Ga0055531_10005239
324 Ga0065712_10248741
325 Ga0070676_10913371
326 Ga0070683_100156898
327 Ga0070690_100000262
328 Ga0070690_100297652
329 Ga0070670_100012775
330 Ga0070680_100110643
331 Ga0068868_100761961
332 Ga0070689_100000033
333 Ga0070687_100001489
334 Ga0070688_100000037
335 Ga0070659_100834229
336 Ga0070714_100054220
337 Ga0070713_100008711
338 Ga0070713_100008980
339 Ga0070701_10000186
340 Ga0070711_100848721
341 Ga0070700_100002398
342 Ga0070663_100384512
343 Ga0070662_100077661
344 Ga0070662_100249936
345 Ga0068867_100002639
346 Ga0070685_10000094
347 Ga0070679_100062545
348 Ga0070684_100003751
349 Ga0070686_100000046
350 Ga0070693_100077121
351 Ga0068855_100094885
352 Ga0070664_100080211
353 Ga0068856_100239489
354 Ga0068852_100353137
355 Ga0068859_100000268
356 Ga0068859_100097946
357 Ga0068859_100583246
358 Ga0068864_100011665
359 Ga0068861_100128069
360 Ga0068863_100042223
361 Ga0068863_100147483
362 Ga0068858_101296795
363 Ga0081538_10031709
364 Ga0070717_10015715
365 Ga0070717_10442312
366 Ga0070712_100041484
367 Ga0075366_10037928
368 Ga0097621_100356648
369 Ga0075428_100464800
370 Ga0075431_100021689
371 Ga0097620_100000268
372 Ga0097620_100097944
373 Ga0097620_100583235
374 Ga0111539_10064550
375 Ga0111539_10079223
376 Ga0114129_10002944
377 Ga0105242_10196645
378 Ga0105248_10002064
379 Ga0105248_10596394
380 Ga0105248_10675513
381 Ga0105237_10001355
382 Ga0105238_10005762
383 Ga0105249_10039878
384 Ga0105249_10126411
385 Ga0105249_11660503
386 Ga0105239_10000498
387 Ga0157317_1011198
388 Ga0157324_1025338
389 Ga0157373_10000087
390 Ga0157370_10794545
391 Ga0157374_10021665
392 Ga0157374_10240768
393 Ga0157374_10989253
394 Ga0157374_11713504
395 Ga0157378_10024420
396 Ga0157378_10868117
397 Ga0163162_11916809
398 Ga0157372_10002085
399 Ga0157375_10013908
400 Ga0163163_10031269
401 Ga0157380_10357138
402 Ga0209436_100322
403 Ga0207425_1000354
404 Ga0207425_1010066
405 Ga0209759_1001764
406 Ga0209129_1002425
407 Ga0209565_1000102
408 Ga0209565_1001107
409 Ga0209565_1006292
410 Ga0209565_1015255
411 Ga0209565_1023472
412 Ga0209565_1026518
413 Ga0209673_1000305
414 Ga0209673_1028871
415 Ga0209130_1000134
416 Ga0209130_1000493
417 Ga0209675_1000358
418 Ga0209675_1001649
419 Ga0209675_1002650
420 Ga0209676_1000145
421 Ga0209025_1030790
422 Ga0209025_1038419
423 Ga0209564_1000098
424 Ga0209564_1001063
425 Ga0209564_1001955
426 Ga0209564_1002748
427 Ga0209050_1000023
428 Ga0209050_1000183
429 Ga0209050_1000939
430 Ga0209050_1001801
431 Ga0209256_1000003
432 Ga0209256_1001704
433 Ga0209256_1013880
434 Ga0209256_1019568
435 Ga0209256_1041501
436 Ga0207426_1001622
437 Ga0207426_1016196
438 Ga0209051_1000017
439 Ga0209257_1000010
440 Ga0209257_1000041
441 Ga0209257_1001077
442 Ga0209257_1009267
443 Ga0207699_10055303
444 Ga0207699_10072638
445 Ga0207705_10209658
446 Ga0207705_10608193
447 Ga0207695_10012942
448 Ga0207695_11448764
449 Ga0207671_10007284
450 Ga0207693_10041286
451 Ga0207663_10238762
452 Ga0207660_10354147
453 Ga0207662_10203444
454 Ga0207652_10023008
455 Ga0207652_11143422
456 Ga0207694_10010411
457 Ga0207700_10470604
458 Ga0207664_10081047
459 Ga0207664_10087249
460 Ga0207690_10228005
461 Ga0207706_10290199
462 Ga0207686_10041530
463 Ga0207670_10000042
464 Ga0207711_10955203
465 Ga0207679_10059395
466 Ga0207679_10265931
467 Ga0207667_10256029
468 Ga0207712_10270590
469 Ga0207703_11635868
470 Ga0207708_10000084
471 Ga0207641_10102757
472 Ga0207648_10010139
473 Ga0207648_10613269
474 Ga0207428_10014921
475 Ga0307515_10002157
476 Ga0307515_10680646
477 Ga0316182_1420520
478 Ga0265331_10099837
479 Ga0307408_100000569
480 Ga0307408_100001191
481 Ga0307408_100013596
482 Ga0307408_100066400
483 Ga0307408_100691653
484 Ga0307408_101595257
485 Ga0307514_10015022
486 Ga0307405_10077613
487 Ga0307413_10425779
488 Ga0307406_10014008
489 Ga0307406_10084483
490 Ga0307407_10018173
491 Ga0307412_10040391
492 Ga0307409_100026482
493 Ga0307409_101532927
494 Ga0307416_100010042
495 Ga0307414_10668089
496 Ga0307411_10325585
497 Ga0307415_100055296
498 Ga0307510_10189848
499 Ga0373934_0000119
500 Ga0373923_0001485
501 Ga0373953_0002820
502 Ga0373956_0000530
503 Ga0373955_0000423
504 Ga0373933_0000326
505 Ga0373937_0000220
506 Ga0373925_0202390
507 Ga0395899_0012585
508 Ga0395899_0025744
509 Ga0395899_0987300
510 Ga0395900_0016852
511 Ga0395900_0139092
512 Ga0395900_0337359
513 Ga0395898_0007612
514 Ga0395898_0018560
515 Ga0395898_0262546
516 Ga0395905_0016625
517 Ga0395905_0396593
518 Ga0395901_0114518
519 Ga0436365_0734071
520 Ga0439439_0020864
521 Ga0451795_1692151
522 Ga0451576_0000500
523 Ga0466967_0007479
524 Ga0495592_0000603
525 Ga0495629_0003832
526 Ga0495653_0000148
527 Ga0495585_0000814
528 Ga0495608_0001043
529 Ga0495618_0119667
530 Ga0495628_0000148
531 Ga0495652_0000364
532 Ga0495665_0015247
533 Ga0495640_0417791
534 Ga0495586_0058712
535 Ga0495587_0000431
536 Ga0495645_0000649
537 Ga0495667_0000332
538 Ga0495635_0000156
539 Ga0495657_0000732
540 Ga0495599_0020678
541 Ga0495623_0000027
542 Ga0495646_0001449
543 Ga0495600_0000091
544 Ga0495581_0029241
545 Ga0495604_0000535
546 Ga0495604_0446042
547 Ga0495636_0037066
548 Ga0495680_0006410
549 Ga0495675_0021267
550 Ga0495684_0000876
551 Ga0495686_0004350
552 Ga0495593_0034191
553 Ga0495602_0000864
554 Ga0495615_0000813
555 Ga0496102_0744761
556 Ga0496114_0148703
557 Ga0501290_074036
558 Ga0501291_000969
559 Ga0501202_000394
560 Ga0501207_019782
561 Ga0501209_010143
562 Ga0501217_001172
563 Ga0501235_002165
564 Ga0501236_006535
565 Ga0501239_004555
566 Ga0501240_080998
567 Ga0501242_000398
568 Ga0501243_000433
569 Ga0501249_000835
570 Ga0501256_007399
571 Ga0501221_000083
572 Ga0501225_0002669
573 Ga0501229_019477
574 Ga0501241_003889
575 Ga0501265_001320
576 Ga0501268_000039
577 Ga0501270_001069
578 Ga0501272_051665
579 Ga0501273_002649
580 Ga0501274_002270
581 Ga0501275_002776
582 nmdc:mga03n38_465179_c1
583 nmdc:mga0k408_32591_c1
584 nmdc:mga05p37_1036200_c1
585 nmdc:mga05p37_121579_c1
586 nmdc:mga09592_85286_c1
587 nmdc:mga06r32_38779_c1
588 nmdc:mga08y16_134599_c1
589 nmdc:mga08y16_168729_c1
590 Ga0495601_0055122
591 Ga0495612_0001548
592 Ga0495619_0000578
593 Ga0495619_0990225
594 Ga0500616_0000614
595 2514045907
596 2599903534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

36

152

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9857 3 157
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9834 3 157
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9741 3 157
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9725 3 157
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9703 3 157
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9818 3 157 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9684 3 157 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8772 75 120 3.30.720.110
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8071 7 66 3.30.720.100
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7377 9 116 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A534H764-F1-model_v4 VOC family protein 1.002 75 158
AF-A0A534H6Z1-F1-model_v4 VOC family protein 1.001 79 161
AF-A0A2M8V7D6-F1-model_v4 deleted 1 52 159
AF-A0A4Q6GFM2-F1-model_v4 deleted 1 82 161
AF-A0A5C7V6H1-F1-model_v4 VOC family protein 0.9992 70 159

Map