F394240
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 298 | 180 | 298 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10711807|Ga0114129_107118072 |
| Length | 217 |
| Sequence | MTTLVMFSGGLDSTAMLLKLLAGPGEEMRTELRVHHVRMVNREGRDRAESRAVESIVSYCRARYRPFRYSESALDFSGLEAVPIDYLSIAFVACQVAIDTPGCDRIAVGALSTDTDIVNRCARQRRVFDAMYECYRARKLGEPRVEWLYPVYDTPKAELAAALPPELLDLTWSCRRPIDGYRPCLACKACIAREKAKNPAGRQDLHSPAAPAHNRAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 2 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 3 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 88 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 90 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 91 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 92 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 93 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 94 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 95 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 96 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 97 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 98 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 99 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 100 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 101 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 102 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 103 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 105 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 106 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 107 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 108 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 109 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 110 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 111 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 112 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 113 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 114 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 115 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 145 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 100 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068869_100041911 | 3300005334 | Bacteria | 3280 |
| 2 | Ga0070680_100010047 | 3300005336 | Bacteria | 7291 |
| 3 | Ga0070680_100058226 | 3300005336 | Bacteria | 3160 |
| 4 | Ga0070680_100063916 | 3300005336 | Bacteria | 3016 |
| 5 | Ga0070680_100164032 | 3300005336 | Bacteria | 1868 |
| 6 | Ga0070689_100272514 | 3300005340 | Bacteria | 1401 |
| 7 | Ga0070689_100420317 | 3300005340 | Bacteria | 1133 |
| 8 | Ga0070691_10065318 | 3300005341 | Bacteria | 1757 |
| 9 | Ga0070692_10041953 | 3300005345 | Bacteria | 2346 |
| 10 | Ga0070668_100090583 | 3300005347 | Bacteria | 2409 |
| 11 | Ga0070675_100031320 | 3300005354 | Bacteria | 4299 |
| 12 | Ga0070674_100064893 | 3300005356 | Bacteria | 2561 |
| 13 | Ga0070673_100272131 | 3300005364 | Bacteria | 1483 |
| 14 | Ga0070673_100452922 | 3300005364 | Bacteria | 1155 |
| 15 | Ga0070673_100482766 | 3300005364 | Bacteria | 1119 |
| 16 | Ga0070673_100650358 | 3300005364 | Bacteria | 965 |
| 17 | Ga0070709_10246094 | 3300005434 | Bacteria | 1286 |
| 18 | Ga0070714_100430057 | 3300005435 | Bacteria | 1252 |
| 19 | Ga0070713_100679813 | 3300005436 | Bacteria | 982 |
| 20 | Ga0070701_10369733 | 3300005438 | Bacteria | 901 |
| 21 | Ga0070701_10457230 | 3300005438 | Bacteria | 821 |
| 22 | Ga0070705_100004332 | 3300005440 | Bacteria | 6913 |
| 23 | Ga0070700_100013789 | 3300005441 | Bacteria | 4546 |
| 24 | Ga0070700_100187575 | 3300005441 | Bacteria | 1443 |
| 25 | Ga0070694_100018420 | 3300005444 | Bacteria | 4431 |
| 26 | Ga0070708_100181957 | 3300005445 | Bacteria | 1965 |
| 27 | Ga0070678_100895891 | 3300005456 | Bacteria | 811 |
| 28 | Ga0070662_100496118 | 3300005457 | Bacteria | 1018 |
| 29 | Ga0070681_10026128 | 3300005458 | Bacteria | 5871 |
| 30 | Ga0070681_10464266 | 3300005458 | Bacteria | 1178 |
| 31 | Ga0068867_100002232 | 3300005459 | Bacteria | 13609 |
| 32 | Ga0070707_100911102 | 3300005468 | Bacteria | 844 |
| 33 | Ga0070698_100260859 | 3300005471 | Bacteria | 1665 |
| 34 | Ga0070699_100005306 | 3300005518 | Bacteria | 11305 |
| 35 | Ga0070699_100077516 | 3300005518 | Bacteria | 2894 |
| 36 | Ga0070679_100130060 | 3300005530 | Bacteria | 2499 |
| 37 | Ga0070697_100002467 | 3300005536 | Bacteria | 14224 |
| 38 | Ga0070697_100750034 | 3300005536 | Bacteria | 863 |
| 39 | Ga0070672_100449523 | 3300005543 | Bacteria | 1110 |
| 40 | Ga0070695_100011896 | 3300005545 | Bacteria | 5209 |
| 41 | Ga0070695_100018622 | 3300005545 | Bacteria | 4217 |
| 42 | Ga0070695_100055453 | 3300005545 | Bacteria | 2554 |
| 43 | Ga0070695_100406402 | 3300005545 | Bacteria | 1033 |
| 44 | Ga0070696_100003728 | 3300005546 | Bacteria | 10171 |
| 45 | Ga0070696_100534747 | 3300005546 | Bacteria | 937 |
| 46 | Ga0070693_100378366 | 3300005547 | Bacteria | 976 |
| 47 | Ga0070704_100002202 | 3300005549 | Bacteria | 10863 |
| 48 | Ga0070704_100108049 | 3300005549 | Bacteria | 2111 |
| 49 | Ga0070704_100174074 | 3300005549 | Bacteria | 1715 |
| 50 | Ga0070704_100214040 | 3300005549 | Bacteria | 1563 |
| 51 | Ga0070704_100232172 | 3300005549 | Bacteria | 1506 |
| 52 | Ga0070702_100304145 | 3300005615 | Bacteria | 1105 |
| 53 | Ga0068861_100026879 | 3300005719 | Bacteria | 4187 |
| 54 | Ga0068861_100203647 | 3300005719 | Bacteria | 1662 |
| 55 | Ga0068870_10069528 | 3300005840 | Bacteria | 1916 |
| 56 | Ga0068870_10213969 | 3300005840 | Bacteria | 1176 |
| 57 | Ga0068863_101310602 | 3300005841 | Bacteria | 731 |
| 58 | Ga0068862_100017502 | 3300005844 | Bacteria | 5970 |
| 59 | Ga0081539_10002623 | 3300005985 | Bacteria | 24577 |
| 60 | Ga0097621_100404769 | 3300006237 | Bacteria | 1222 |
| 61 | Ga0075428_100362614 | 3300006844 | Bacteria | 1554 |
| 62 | Ga0075430_100003485 | 3300006846 | Bacteria | 13164 |
| 63 | Ga0075430_100008481 | 3300006846 | Bacteria | 8682 |
| 64 | Ga0075430_100096777 | 3300006846 | Bacteria | 2467 |
| 65 | Ga0075430_100277985 | 3300006846 | Bacteria | 1385 |
| 66 | Ga0075431_100142607 | 3300006847 | Bacteria | 2470 |
| 67 | Ga0075431_100148503 | 3300006847 | Bacteria | 2414 |
| 68 | Ga0075431_100210940 | 3300006847 | Bacteria | 1984 |
| 69 | Ga0075431_100699382 | 3300006847 | Bacteria | 991 |
| 70 | Ga0075433_10136586 | 3300006852 | Bacteria | 2180 |
| 71 | Ga0075433_10484133 | 3300006852 | Bacteria | 1090 |
| 72 | Ga0075434_100000065 | 3300006871 | Bacteria | 54115 |
| 73 | Ga0075434_100049777 | 3300006871 | Bacteria | 4161 |
| 74 | Ga0075434_100768834 | 3300006871 | Bacteria | 980 |
| 75 | Ga0075429_100016813 | 3300006880 | Bacteria | 6331 |
| 76 | Ga0075429_100097839 | 3300006880 | Bacteria | 2560 |
| 77 | Ga0068865_100256776 | 3300006881 | Bacteria | 1382 |
| 78 | Ga0068865_100597966 | 3300006881 | Bacteria | 932 |
| 79 | Ga0075436_100000392 | 3300006914 | Bacteria | 28103 |
| 80 | Ga0075436_100029313 | 3300006914 | Bacteria | 3784 |
| 81 | Ga0075436_100040959 | 3300006914 | Bacteria | 3196 |
| 82 | Ga0075436_100121346 | 3300006914 | Bacteria | 1829 |
| 83 | Ga0075436_100147803 | 3300006914 | Bacteria | 1652 |
| 84 | Ga0075436_100565266 | 3300006914 | Bacteria | 836 |
| 85 | Ga0075435_100006010 | 3300007076 | Bacteria | 8544 |
| 86 | Ga0075435_100241829 | 3300007076 | Bacteria | 1535 |
| 87 | Ga0075435_100591732 | 3300007076 | Bacteria | 962 |
| 88 | Ga0075435_100739983 | 3300007076 | Bacteria | 855 |
| 89 | Ga0099794_10147253 | 3300007265 | Bacteria | 1194 |
| 90 | Ga0111539_10349145 | 3300009094 | Bacteria | 1722 |
| 91 | Ga0105245_10240759 | 3300009098 | Bacteria | 1754 |
| 92 | Ga0114129_10016784 | 3300009147 | Bacteria | 10423 |
| 93 | Ga0114129_10067912 | 3300009147 | Bacteria | 4971 |
| 94 | Ga0114129_10711807 | 3300009147 | Bacteria | 1289 |
| 95 | Ga0114129_11380352 | 3300009147 | Bacteria | 870 |
| 96 | Ga0105242_10637387 | 3300009176 | Unclassified | 1035 |
| 97 | Ga0105249_10006734 | 3300009553 | Bacteria | 10011 |
| 98 | Ga0163162_10212226 | 3300013306 | Bacteria | 2066 |
| 99 | Ga0157375_10625632 | 3300013308 | Bacteria | 1234 |
| 100 | Ga0157380_10004851 | 3300014326 | Bacteria | 9367 |
| 101 | Ga0157377_10137880 | 3300014745 | Bacteria | 1496 |
| 102 | Ga0207699_10340014 | 3300025906 | Bacteria | 1057 |
| 103 | Ga0207699_10401697 | 3300025906 | Bacteria | 976 |
| 104 | Ga0207643_10008266 | 3300025908 | Bacteria | 5587 |
| 105 | Ga0207643_10199462 | 3300025908 | Bacteria | 1218 |
| 106 | Ga0207707_10027621 | 3300025912 | Bacteria | 4961 |
| 107 | Ga0207663_10441171 | 3300025916 | Bacteria | 1003 |
| 108 | Ga0207660_10022162 | 3300025917 | Bacteria | 4278 |
| 109 | Ga0207660_10153313 | 3300025917 | Bacteria | 1772 |
| 110 | Ga0207660_10166412 | 3300025917 | Bacteria | 1704 |
| 111 | Ga0207660_10279807 | 3300025917 | Bacteria | 1324 |
| 112 | Ga0207652_10086133 | 3300025921 | Bacteria | 2754 |
| 113 | Ga0207646_10475788 | 3300025922 | Bacteria | 1126 |
| 114 | Ga0207659_10028115 | 3300025926 | Bacteria | 3817 |
| 115 | Ga0207664_10601508 | 3300025929 | Bacteria | 987 |
| 116 | Ga0207706_10050248 | 3300025933 | Bacteria | 3685 |
| 117 | Ga0207709_10019131 | 3300025935 | Bacteria | 3845 |
| 118 | Ga0207670_10202747 | 3300025936 | Bacteria | 1508 |
| 119 | Ga0207669_10374392 | 3300025937 | Bacteria | 1108 |
| 120 | Ga0207704_10009561 | 3300025938 | Bacteria | 4683 |
| 121 | Ga0207704_10548764 | 3300025938 | Bacteria | 939 |
| 122 | Ga0207665_10764566 | 3300025939 | Bacteria | 762 |
| 123 | Ga0207691_10149497 | 3300025940 | Bacteria | 2054 |
| 124 | Ga0207689_10024495 | 3300025942 | Bacteria | 5064 |
| 125 | Ga0207651_10322305 | 3300025960 | Bacteria | 1292 |
| 126 | Ga0207712_10005266 | 3300025961 | Bacteria | 8178 |
| 127 | Ga0207668_10049704 | 3300025972 | Bacteria | 2884 |
| 128 | Ga0207708_10006893 | 3300026075 | Bacteria | 8405 |
| 129 | Ga0207708_10058327 | 3300026075 | Bacteria | 2945 |
| 130 | Ga0207708_10454295 | 3300026075 | Bacteria | 1067 |
| 131 | Ga0207708_10550055 | 3300026075 | Bacteria | 973 |
| 132 | Ga0207648_10002662 | 3300026089 | Bacteria | 19053 |
| 133 | Ga0207676_10037870 | 3300026095 | Bacteria | 3679 |
| 134 | Ga0207675_100010009 | 3300026118 | Bacteria | 8885 |
| 135 | Ga0207675_100285144 | 3300026118 | Bacteria | 1605 |
| 136 | Ga0207683_10595060 | 3300026121 | Bacteria | 1024 |
| 137 | Ga0207683_10632662 | 3300026121 | Bacteria | 991 |
| 138 | Ga0209996_1010785 | 3300027395 | Bacteria | 1215 |
| 139 | Ga0209999_1003859 | 3300027543 | Bacteria | 2695 |
| 140 | Ga0209983_1041901 | 3300027665 | Bacteria | 991 |
| 141 | Ga0209974_10035372 | 3300027876 | Bacteria | 1659 |
| 142 | Ga0207428_10050086 | 3300027907 | Bacteria | 3343 |
| 143 | Ga0207428_10091282 | 3300027907 | Bacteria | 2364 |
| 144 | Ga0207428_10434310 | 3300027907 | Bacteria | 958 |
| 145 | Ga0268265_10001132 | 3300028380 | Bacteria | 23559 |
| 146 | Ga0268265_10224432 | 3300028380 | Bacteria | 1646 |
| 147 | Ga0268265_10312513 | 3300028380 | Bacteria | 1419 |
| 148 | Ga0307408_100035582 | 3300031548 | Bacteria | 3496 |
| 149 | Ga0307408_100198580 | 3300031548 | Bacteria | 1622 |
| 150 | Ga0307408_100543706 | 3300031548 | Bacteria | 1024 |
| 151 | Ga0307407_10098675 | 3300031903 | Bacteria | 1808 |
| 152 | Ga0307416_100347935 | 3300032002 | Bacteria | 1498 |
| 153 | Ga0307416_100355035 | 3300032002 | Bacteria | 1485 |
| 154 | Ga0307416_100561210 | 3300032002 | Bacteria | 1216 |
| 155 | Ga0307416_100680875 | 3300032002 | Bacteria | 1116 |
| 156 | Ga0373938_0008300 | 3300034957 | Bacteria | 1852 |
| 157 | Ga0373949_0011001 | 3300035090 | Bacteria | 1990 |
| 158 | Ga0373939_0018147 | 3300035114 | Bacteria | 1880 |
| 159 | Ga0373941_0002659 | 3300035115 | Bacteria | 3962 |
| 160 | Ga0373953_0031099 | 3300035117 | Bacteria | 2075 |
| 161 | Ga0373954_0000094 | 3300035118 | Bacteria | 30419 |
| 162 | Ga0373956_0093843 | 3300035119 | Bacteria | 1386 |
| 163 | Ga0373961_0021061 | 3300035241 | Bacteria | 1731 |
| 164 | Ga0373931_0026316 | 3300035691 | Bacteria | 2960 |
| 165 | Ga0373935_0209956 | 3300035692 | Bacteria | 1349 |
| 166 | Ga0373933_0048323 | 3300035724 | Bacteria | 2533 |
| 167 | Ga0373937_0000449 | 3300036401 | Bacteria | 37990 |
| 168 | Ga0439453_0000656 | 3300041408 | Bacteria | 3943 |
| 169 | Ga0439453_0016640 | 3300041408 | Bacteria | 1285 |
| 170 | Ga0439431_0036390 | 3300041997 | Bacteria | 1240 |
| 171 | Ga0439441_000395 | 3300042001 | Bacteria | 4555 |
| 172 | Ga0439441_007900 | 3300042001 | Bacteria | 1726 |
| 173 | Ga0439443_003819 | 3300042003 | Bacteria | 1928 |
| 174 | Ga0439456_030392 | 3300042013 | Bacteria | 1156 |
| 175 | Ga0439435_0000783 | 3300042436 | Bacteria | 5358 |
| 176 | Ga0439444_0000585 | 3300042437 | Bacteria | 4177 |
| 177 | Ga0439444_0003720 | 3300042437 | Bacteria | 2173 |
| 178 | Ga0439460_0002711 | 3300042461 | Bacteria | 4270 |
| 179 | Ga0466964_0097927 | 3300044706 | Bacteria | 1288 |
| 180 | Ga0466968_0227118 | 3300044735 | Bacteria | 881 |
| 181 | Ga0466960_0549266 | 3300044901 | Bacteria | 681 |
| 182 | Ga0495641_0143926 | 3300046461 | Bacteria | 1065 |
| 183 | Ga0495651_0545356 | 3300046462 | Unclassified | 737 |
| 184 | Ga0495653_0423228 | 3300046463 | Bacteria | 842 |
| 185 | Ga0495662_0004818 | 3300046476 | Bacteria | 6763 |
| 186 | Ga0495662_0016532 | 3300046476 | Bacteria | 3574 |
| 187 | Ga0495608_0010394 | 3300046511 | Bacteria | 6495 |
| 188 | Ga0495618_0111941 | 3300046514 | Bacteria | 1748 |
| 189 | Ga0495628_0006337 | 3300046516 | Bacteria | 10341 |
| 190 | Ga0495628_0178517 | 3300046516 | Bacteria | 1607 |
| 191 | Ga0495630_0001124 | 3300046517 | Bacteria | 18441 |
| 192 | Ga0495630_0090836 | 3300046517 | Bacteria | 2307 |
| 193 | Ga0495642_0075626 | 3300046528 | Bacteria | 1413 |
| 194 | Ga0495652_0052066 | 3300046529 | Bacteria | 3493 |
| 195 | Ga0495652_0261542 | 3300046529 | Bacteria | 1277 |
| 196 | Ga0495640_0001398 | 3300046533 | Bacteria | 18997 |
| 197 | Ga0495640_0021347 | 3300046533 | Bacteria | 4755 |
| 198 | Ga0495586_0001311 | 3300046535 | Bacteria | 13836 |
| 199 | Ga0495586_0188338 | 3300046535 | Bacteria | 1168 |
| 200 | Ga0495587_0006712 | 3300046536 | Bacteria | 7496 |
| 201 | Ga0495621_0052507 | 3300046539 | Bacteria | 1461 |
| 202 | Ga0495645_0030431 | 3300046543 | Bacteria | 3931 |
| 203 | Ga0495667_0017435 | 3300046559 | Bacteria | 4850 |
| 204 | Ga0495634_0004109 | 3300046642 | Bacteria | 11527 |
| 205 | Ga0495634_0142005 | 3300046642 | Bacteria | 1524 |
| 206 | Ga0495635_0062968 | 3300046663 | Bacteria | 2547 |
| 207 | Ga0495635_0422987 | 3300046663 | Bacteria | 883 |
| 208 | Ga0495657_0044941 | 3300046675 | Bacteria | 3000 |
| 209 | Ga0495599_0000904 | 3300046678 | Bacteria | 16610 |
| 210 | Ga0495599_0243013 | 3300046678 | Bacteria | 1097 |
| 211 | Ga0495623_0099248 | 3300046679 | Bacteria | 1776 |
| 212 | Ga0495658_0027285 | 3300046683 | Bacteria | 3071 |
| 213 | Ga0495658_0088377 | 3300046683 | Bacteria | 1831 |
| 214 | Ga0495658_0245945 | 3300046683 | Bacteria | 1124 |
| 215 | Ga0495669_0006201 | 3300046684 | Bacteria | 4989 |
| 216 | Ga0495613_0014125 | 3300046689 | Bacteria | 5925 |
| 217 | Ga0495624_0016753 | 3300046690 | Bacteria | 4932 |
| 218 | Ga0495600_0022288 | 3300046809 | Bacteria | 4066 |
| 219 | Ga0495600_0305314 | 3300046809 | Bacteria | 1003 |
| 220 | Ga0495604_0001361 | 3300047317 | Bacteria | 20003 |
| 221 | Ga0495604_0057287 | 3300047317 | Bacteria | 2996 |
| 222 | Ga0495636_0015775 | 3300047318 | Bacteria | 3012 |
| 223 | Ga0495674_0392114 | 3300047319 | Bacteria | 1122 |
| 224 | Ga0501292_045736 | 3300049515 | Bacteria | 766 |
| 225 | Ga0501033_0251225 | 3300049570 | Bacteria | 1253 |
| 226 | Ga0501037_0264364 | 3300049573 | Bacteria | 1202 |
| 227 | Ga0501038_0037170 | 3300049574 | Bacteria | 4271 |
| 228 | Ga0501039_0013115 | 3300049575 | Bacteria | 6337 |
| 229 | Ga0501039_0019978 | 3300049575 | Bacteria | 5134 |
| 230 | Ga0501039_0331892 | 3300049575 | Bacteria | 1195 |
| 231 | Ga0501040_0089937 | 3300049576 | Bacteria | 2133 |
| 232 | Ga0501040_0173907 | 3300049576 | Bacteria | 1525 |
| 233 | Ga0501041_0016937 | 3300049577 | Bacteria | 4336 |
| 234 | Ga0501041_0060408 | 3300049577 | Bacteria | 2320 |
| 235 | Ga0501041_0206981 | 3300049577 | Bacteria | 1230 |
| 236 | Ga0501042_0141993 | 3300049578 | Bacteria | 1731 |
| 237 | Ga0501042_0561202 | 3300049578 | Bacteria | 830 |
| 238 | Ga0501043_0332768 | 3300049579 | Bacteria | 1156 |
| 239 | Ga0501043_0416466 | 3300049579 | Bacteria | 1013 |
| 240 | Ga0501043_0641212 | 3300049579 | Bacteria | 781 |
| 241 | Ga0501046_0094882 | 3300049580 | Bacteria | 2292 |
| 242 | Ga0501048_0046144 | 3300049582 | Bacteria | 3111 |
| 243 | Ga0501067_0167581 | 3300049583 | Bacteria | 1223 |
| 244 | Ga0501068_0103998 | 3300049584 | Bacteria | 1762 |
| 245 | Ga0501069_0178864 | 3300049585 | Bacteria | 1226 |
| 246 | Ga0501071_0032113 | 3300049587 | Bacteria | 3726 |
| 247 | Ga0501071_0226774 | 3300049587 | Bacteria | 1407 |
| 248 | Ga0501072_0009825 | 3300049588 | Bacteria | 7274 |
| 249 | Ga0501075_0008633 | 3300049591 | Bacteria | 7104 |
| 250 | Ga0501076_0002070 | 3300049592 | Bacteria | 13739 |
| 251 | Ga0501076_0116551 | 3300049592 | Bacteria | 2162 |
| 252 | Ga0501077_0044299 | 3300049593 | Bacteria | 2827 |
| 253 | Ga0501077_0345342 | 3300049593 | Bacteria | 949 |
| 254 | Ga0501079_0012688 | 3300049741 | Bacteria | 6436 |
| 255 | Ga0501079_0039583 | 3300049741 | Bacteria | 3636 |
| 256 | Ga0501080_0065143 | 3300049742 | Bacteria | 3390 |
| 257 | Ga0501081_0014040 | 3300049743 | Bacteria | 5275 |
| 258 | Ga0501081_0169959 | 3300049743 | Bacteria | 1574 |
| 259 | Ga0501045_0028852 | 3300049824 | Bacteria | 4005 |
| 260 | Ga0501045_0108557 | 3300049824 | Bacteria | 2057 |
| 261 | nmdc:mga05p37_38831_c1 | 3300050507 | Bacteria | 5841 |
| 262 | nmdc:mga05p37_39253_c1 | 3300050507 | Bacteria | 5811 |
| 263 | nmdc:mga05p37_531766_c1 | 3300050507 | Bacteria | 1342 |
| 264 | nmdc:mga05p37_718779_c1 | 3300050507 | Bacteria | 1106 |
| 265 | nmdc:mga09592_26266_c1 | 3300050508 | Bacteria | 4823 |
| 266 | nmdc:mga09592_681896_c1 | 3300050508 | Bacteria | 876 |
| 267 | nmdc:mga0qj67_199328_c1 | 3300050509 | Bacteria | 1627 |
| 268 | nmdc:mga0qj67_2114_c1 | 3300050509 | Bacteria | 14162 |
| 269 | nmdc:mga0qj67_23602_c1 | 3300050509 | Bacteria | 4733 |
| 270 | nmdc:mga0qj67_38306_c1 | 3300050509 | Bacteria | 3761 |
| 271 | nmdc:mga06r32_596752_c1 | 3300050510 | Bacteria | 1075 |
| 272 | nmdc:mga08y16_174056_c1 | 3300050511 | Bacteria | 2235 |
| 273 | nmdc:mga08y16_287966_c1 | 3300050511 | Bacteria | 1694 |
| 274 | nmdc:mga08y16_404940_c1 | 3300050511 | Bacteria | 1396 |
| 275 | nmdc:mga08y16_621086_c1 | 3300050511 | Bacteria | 1088 |
| 276 | nmdc:mga08y16_82757_c1 | 3300050511 | Bacteria | 3346 |
| 277 | nmdc:mga0n895_291477_c1 | 3300050512 | Bacteria | 1655 |
| 278 | nmdc:mga0n895_84_c1 | 3300050512 | Bacteria | 54345 |
| 279 | nmdc:mga0n895_895173_c1 | 3300050512 | Bacteria | 873 |
| 280 | nmdc:mga0rr50_11216_c1 | 3300050513 | Bacteria | 5722 |
| 281 | nmdc:mga0rr50_183122_c1 | 3300050513 | Bacteria | 1713 |
| 282 | nmdc:mga0rr50_328900_c1 | 3300050513 | Bacteria | 1283 |
| 283 | nmdc:mga0rr50_663799_c1 | 3300050513 | Bacteria | 890 |
| 284 | nmdc:mga08x19_15334_c1 | 3300050514 | Bacteria | 4662 |
| 285 | nmdc:mga08x19_26816_c1 | 3300050514 | Bacteria | 3598 |
| 286 | nmdc:mga08x19_296295_c1 | 3300050514 | Bacteria | 1123 |
| 287 | nmdc:mga08x19_316882_c1 | 3300050514 | Bacteria | 1085 |
| 288 | nmdc:mga08x19_37191_c1 | 3300050514 | Bacteria | 3088 |
| 289 | nmdc:mga08x19_533452_c1 | 3300050514 | Bacteria | 830 |
| 290 | nmdc:mga0a205_196133_c1 | 3300050515 | Bacteria | 1910 |
| 291 | nmdc:mga0a205_200555_c1 | 3300050515 | Bacteria | 1886 |
| 292 | nmdc:mga0a205_314916_c1 | 3300050515 | Bacteria | 1436 |
| 293 | Ga0495612_0178298 | 3300053078 | Bacteria | 932 |
| 294 | Ga0495619_0323802 | 3300053085 | Bacteria | 1067 |
| 295 | Ga0501084_0107402 | 3300054114 | Bacteria | 2345 |
| 296 | Ga0501084_0567249 | 3300054114 | Viruses | 959 |
| 297 | Ga0501082_0022247 | 3300060353 | Bacteria | 5463 |
| 298 | Ga0530510_0002052 | 3300061734 | Bacteria | 13839 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044735 | Ga0466968_0227118 | Ga0466968_0227118_313_858 | 169 |
| 2 | 3300050514 | nmdc:mga08x19_316882_c1 | nmdc:mga08x19_316882_c1_519_1061 | 169 |
| 3 | 3300050509 | nmdc:mga0qj67_38306_c1 | nmdc:mga0qj67_38306_c1_495_1094 | 170 |
| 4 | 3300006846 | Ga0075430_100008481 | Ga0075430_1000084815 | 173 |
| 5 | 3300006847 | Ga0075431_100142607 | Ga0075431_1001426072 | 173 |
| 6 | 3300005435 | Ga0070714_100430057 | Ga0070714_1004300572 | 179 |
| 7 | 3300005436 | Ga0070713_100679813 | Ga0070713_1006798132 | 179 |
| 8 | 3300005440 | Ga0070705_100004332 | Ga0070705_1000043324 | 179 |
| 9 | 3300005445 | Ga0070708_100181957 | Ga0070708_1001819572 | 179 |
| 10 | 3300005458 | Ga0070681_10464266 | Ga0070681_104642662 | 179 |
| 11 | 3300005468 | Ga0070707_100911102 | Ga0070707_1009111022 | 179 |
| 12 | 3300005518 | Ga0070699_100005306 | Ga0070699_1000053068 | 179 |
| 13 | 3300005518 | Ga0070699_100077516 | Ga0070699_1000775165 | 179 |
| 14 | 3300005536 | Ga0070697_100002467 | Ga0070697_1000024678 | 179 |
| 15 | 3300005536 | Ga0070697_100750034 | Ga0070697_1007500341 | 179 |
| 16 | 3300005545 | Ga0070695_100011896 | Ga0070695_1000118962 | 179 |
| 17 | 3300005545 | Ga0070695_100406402 | Ga0070695_1004064021 | 179 |
| 18 | 3300005546 | Ga0070696_100003728 | Ga0070696_1000037289 | 179 |
| 19 | 3300005546 | Ga0070696_100534747 | Ga0070696_1005347471 | 179 |
| 20 | 3300005547 | Ga0070693_100378366 | Ga0070693_1003783662 | 179 |
| 21 | 3300005549 | Ga0070704_100174074 | Ga0070704_1001740742 | 179 |
| 22 | 3300005985 | Ga0081539_10002623 | Ga0081539_100026237 | 179 |
| 23 | 3300006852 | Ga0075433_10136586 | Ga0075433_101365862 | 179 |
| 24 | 3300006852 | Ga0075433_10484133 | Ga0075433_104841332 | 179 |
| 25 | 3300006871 | Ga0075434_100000065 | Ga0075434_10000006520 | 179 |
| 26 | 3300006871 | Ga0075434_100768834 | Ga0075434_1007688342 | 179 |
| 27 | 3300006914 | Ga0075436_100000392 | Ga0075436_10000039230 | 179 |
| 28 | 3300006914 | Ga0075436_100029313 | Ga0075436_1000293136 | 179 |
| 29 | 3300006914 | Ga0075436_100040959 | Ga0075436_1000409592 | 179 |
| 30 | 3300006914 | Ga0075436_100121346 | Ga0075436_1001213462 | 179 |
| 31 | 3300006914 | Ga0075436_100147803 | Ga0075436_1001478032 | 179 |
| 32 | 3300006914 | Ga0075436_100565266 | Ga0075436_1005652662 | 179 |
| 33 | 3300007076 | Ga0075435_100006010 | Ga0075435_1000060106 | 179 |
| 34 | 3300007076 | Ga0075435_100241829 | Ga0075435_1002418291 | 179 |
| 35 | 3300007076 | Ga0075435_100591732 | Ga0075435_1005917321 | 179 |
| 36 | 3300007265 | Ga0099794_10147253 | Ga0099794_101472532 | 179 |
| 37 | 3300025906 | Ga0207699_10401697 | Ga0207699_104016972 | 179 |
| 38 | 3300025916 | Ga0207663_10441171 | Ga0207663_104411712 | 179 |
| 39 | 3300025922 | Ga0207646_10475788 | Ga0207646_104757882 | 179 |
| 40 | 3300025929 | Ga0207664_10601508 | Ga0207664_106015082 | 179 |
| 41 | 3300025939 | Ga0207665_10764566 | Ga0207665_107645662 | 179 |
| 42 | 3300035692 | Ga0373935_0209956 | Ga0373935_0209956_262_837 | 179 |
| 43 | 3300044706 | Ga0466964_0097927 | Ga0466964_0097927_243_830 | 179 |
| 44 | 3300046539 | Ga0495621_0052507 | Ga0495621_0052507_219_791 | 179 |
| 45 | 3300046684 | Ga0495669_0006201 | Ga0495669_0006201_2233_2820 | 179 |
| 46 | 3300049585 | Ga0501069_0178864 | Ga0501069_0178864_247_819 | 179 |
| 47 | 3300050512 | nmdc:mga0n895_291477_c1 | nmdc:mga0n895_291477_c1_549_1139 | 179 |
| 48 | 3300050512 | nmdc:mga0n895_84_c1 | nmdc:mga0n895_84_c1_3546_4133 | 179 |
| 49 | 3300050512 | nmdc:mga0n895_895173_c1 | nmdc:mga0n895_895173_c1_175_762 | 179 |
| 50 | 3300050513 | nmdc:mga0rr50_11216_c1 | nmdc:mga0rr50_11216_c1_4714_5286 | 179 |
| 51 | 3300050513 | nmdc:mga0rr50_183122_c1 | nmdc:mga0rr50_183122_c1_849_1436 | 179 |
| 52 | 3300050513 | nmdc:mga0rr50_328900_c1 | nmdc:mga0rr50_328900_c1_673_1260 | 179 |
| 53 | 3300050514 | nmdc:mga08x19_15334_c1 | nmdc:mga08x19_15334_c1_3392_4009 | 179 |
| 54 | 3300050514 | nmdc:mga08x19_26816_c1 | nmdc:mga08x19_26816_c1_574_1161 | 179 |
| 55 | 3300050514 | nmdc:mga08x19_296295_c1 | nmdc:mga08x19_296295_c1_53_640 | 179 |
| 56 | 3300050514 | nmdc:mga08x19_37191_c1 | nmdc:mga08x19_37191_c1_1447_2034 | 179 |
| 57 | 3300050514 | nmdc:mga08x19_533452_c1 | nmdc:mga08x19_533452_c1_79_669 | 179 |
| 58 | 3300050515 | nmdc:mga0a205_196133_c1 | nmdc:mga0a205_196133_c1_572_1159 | 179 |
| 59 | 3300050515 | nmdc:mga0a205_200555_c1 | nmdc:mga0a205_200555_c1_690_1262 | 179 |
| 60 | 3300050515 | nmdc:mga0a205_314916_c1 | nmdc:mga0a205_314916_c1_801_1373 | 179 |
| 61 | 3300053078 | Ga0495612_0178298 | Ga0495612_0178298_15_590 | 180 |
| 62 | 3300049593 | Ga0501077_0345342 | Ga0501077_0345342_306_902 | 182 |
| 63 | 3300005336 | Ga0070680_100063916 | Ga0070680_1000639164 | 183 |
| 64 | 3300005364 | Ga0070673_100650358 | Ga0070673_1006503582 | 183 |
| 65 | 3300005458 | Ga0070681_10026128 | Ga0070681_100261287 | 183 |
| 66 | 3300005471 | Ga0070698_100260859 | Ga0070698_1002608593 | 183 |
| 67 | 3300005530 | Ga0070679_100130060 | Ga0070679_1001300602 | 183 |
| 68 | 3300025912 | Ga0207707_10027621 | Ga0207707_100276215 | 183 |
| 69 | 3300025917 | Ga0207660_10166412 | Ga0207660_101664122 | 183 |
| 70 | 3300025921 | Ga0207652_10086133 | Ga0207652_100861332 | 183 |
| 71 | 3300032002 | Ga0307416_100680875 | Ga0307416_1006808752 | 183 |
| 72 | 3300034957 | Ga0373938_0008300 | Ga0373938_0008300_1230_1829 | 183 |
| 73 | 3300035090 | Ga0373949_0011001 | Ga0373949_0011001_236_835 | 183 |
| 74 | 3300035114 | Ga0373939_0018147 | Ga0373939_0018147_358_957 | 183 |
| 75 | 3300035115 | Ga0373941_0002659 | Ga0373941_0002659_382_981 | 183 |
| 76 | 3300035241 | Ga0373961_0021061 | Ga0373961_0021061_294_893 | 183 |
| 77 | 3300035691 | Ga0373931_0026316 | Ga0373931_0026316_193_792 | 183 |
| 78 | 3300044901 | Ga0466960_0549266 | Ga0466960_0549266_74_658 | 183 |
| 79 | 3300049583 | Ga0501067_0167581 | Ga0501067_0167581_36_620 | 183 |
| 80 | 3300005340 | Ga0070689_100420317 | Ga0070689_1004203172 | 185 |
| 81 | 3300005364 | Ga0070673_100272131 | Ga0070673_1002721312 | 185 |
| 82 | 3300005434 | Ga0070709_10246094 | Ga0070709_102460941 | 185 |
| 83 | 3300005545 | Ga0070695_100055453 | Ga0070695_1000554533 | 185 |
| 84 | 3300005549 | Ga0070704_100108049 | Ga0070704_1001080492 | 185 |
| 85 | 3300005615 | Ga0070702_100304145 | Ga0070702_1003041452 | 185 |
| 86 | 3300005841 | Ga0068863_101310602 | Ga0068863_1013106022 | 185 |
| 87 | 3300006871 | Ga0075434_100049777 | Ga0075434_1000497775 | 185 |
| 88 | 3300006881 | Ga0068865_100597966 | Ga0068865_1005979662 | 185 |
| 89 | 3300007076 | Ga0075435_100739983 | Ga0075435_1007399832 | 185 |
| 90 | 3300025906 | Ga0207699_10340014 | Ga0207699_103400142 | 185 |
| 91 | 3300025936 | Ga0207670_10202747 | Ga0207670_102027472 | 185 |
| 92 | 3300025938 | Ga0207704_10548764 | Ga0207704_105487641 | 185 |
| 93 | 3300025960 | Ga0207651_10322305 | Ga0207651_103223052 | 185 |
| 94 | 3300026075 | Ga0207708_10058327 | Ga0207708_100583272 | 185 |
| 95 | 3300026095 | Ga0207676_10037870 | Ga0207676_100378703 | 185 |
| 96 | 3300027907 | Ga0207428_10091282 | Ga0207428_100912822 | 185 |
| 97 | 3300035117 | Ga0373953_0031099 | Ga0373953_0031099_1138_1743 | 185 |
| 98 | 3300035118 | Ga0373954_0000094 | Ga0373954_0000094_10787_11392 | 185 |
| 99 | 3300035119 | Ga0373956_0093843 | Ga0373956_0093843_641_1246 | 185 |
| 100 | 3300035724 | Ga0373933_0048323 | Ga0373933_0048323_285_890 | 185 |
| 101 | 3300036401 | Ga0373937_0000449 | Ga0373937_0000449_15763_16368 | 185 |
| 102 | 3300046461 | Ga0495641_0143926 | Ga0495641_0143926_382_972 | 185 |
| 103 | 3300046462 | Ga0495651_0545356 | Ga0495651_0545356_42_647 | 185 |
| 104 | 3300046463 | Ga0495653_0423228 | Ga0495653_0423228_158_763 | 185 |
| 105 | 3300046476 | Ga0495662_0004818 | Ga0495662_0004818_4001_4606 | 185 |
| 106 | 3300046476 | Ga0495662_0016532 | Ga0495662_0016532_2292_2897 | 185 |
| 107 | 3300046511 | Ga0495608_0010394 | Ga0495608_0010394_4245_4835 | 185 |
| 108 | 3300046514 | Ga0495618_0111941 | Ga0495618_0111941_1111_1716 | 185 |
| 109 | 3300046516 | Ga0495628_0006337 | Ga0495628_0006337_4939_5544 | 185 |
| 110 | 3300046516 | Ga0495628_0178517 | Ga0495628_0178517_76_681 | 185 |
| 111 | 3300046517 | Ga0495630_0001124 | Ga0495630_0001124_8161_8766 | 185 |
| 112 | 3300046517 | Ga0495630_0090836 | Ga0495630_0090836_218_823 | 185 |
| 113 | 3300046529 | Ga0495652_0052066 | Ga0495652_0052066_2411_3016 | 185 |
| 114 | 3300046529 | Ga0495652_0261542 | Ga0495652_0261542_160_765 | 185 |
| 115 | 3300046533 | Ga0495640_0001398 | Ga0495640_0001398_16654_17244 | 185 |
| 116 | 3300046533 | Ga0495640_0021347 | Ga0495640_0021347_3286_3891 | 185 |
| 117 | 3300046535 | Ga0495586_0001311 | Ga0495586_0001311_9427_10032 | 185 |
| 118 | 3300046535 | Ga0495586_0188338 | Ga0495586_0188338_202_807 | 185 |
| 119 | 3300046536 | Ga0495587_0006712 | Ga0495587_0006712_6069_6674 | 185 |
| 120 | 3300046543 | Ga0495645_0030431 | Ga0495645_0030431_2177_2782 | 185 |
| 121 | 3300046559 | Ga0495667_0017435 | Ga0495667_0017435_3665_4255 | 185 |
| 122 | 3300046642 | Ga0495634_0004109 | Ga0495634_0004109_9475_10080 | 185 |
| 123 | 3300046642 | Ga0495634_0142005 | Ga0495634_0142005_384_989 | 185 |
| 124 | 3300046663 | Ga0495635_0062968 | Ga0495635_0062968_1448_2038 | 185 |
| 125 | 3300046663 | Ga0495635_0422987 | Ga0495635_0422987_122_727 | 185 |
| 126 | 3300046675 | Ga0495657_0044941 | Ga0495657_0044941_999_1604 | 185 |
| 127 | 3300046678 | Ga0495599_0000904 | Ga0495599_0000904_17_622 | 185 |
| 128 | 3300046678 | Ga0495599_0243013 | Ga0495599_0243013_236_841 | 185 |
| 129 | 3300046679 | Ga0495623_0099248 | Ga0495623_0099248_33_638 | 185 |
| 130 | 3300046683 | Ga0495658_0027285 | Ga0495658_0027285_933_1538 | 185 |
| 131 | 3300046683 | Ga0495658_0088377 | Ga0495658_0088377_230_835 | 185 |
| 132 | 3300046683 | Ga0495658_0245945 | Ga0495658_0245945_116_721 | 185 |
| 133 | 3300046689 | Ga0495613_0014125 | Ga0495613_0014125_3677_4282 | 185 |
| 134 | 3300046690 | Ga0495624_0016753 | Ga0495624_0016753_2737_3342 | 185 |
| 135 | 3300046809 | Ga0495600_0022288 | Ga0495600_0022288_3192_3797 | 185 |
| 136 | 3300046809 | Ga0495600_0305314 | Ga0495600_0305314_274_879 | 185 |
| 137 | 3300047317 | Ga0495604_0001361 | Ga0495604_0001361_13310_13915 | 185 |
| 138 | 3300047317 | Ga0495604_0057287 | Ga0495604_0057287_264_869 | 185 |
| 139 | 3300047318 | Ga0495636_0015775 | Ga0495636_0015775_2310_2915 | 185 |
| 140 | 3300047319 | Ga0495674_0392114 | Ga0495674_0392114_131_736 | 185 |
| 141 | 3300050508 | nmdc:mga09592_26266_c1 | nmdc:mga09592_26266_c1_381_986 | 185 |
| 142 | 3300050511 | nmdc:mga08y16_174056_c1 | nmdc:mga08y16_174056_c1_629_1234 | 185 |
| 143 | 3300050513 | nmdc:mga0rr50_663799_c1 | nmdc:mga0rr50_663799_c1_231_821 | 185 |
| 144 | 3300053085 | Ga0495619_0323802 | Ga0495619_0323802_331_936 | 185 |
| 145 | 3300006237 | Ga0097621_100404769 | Ga0097621_1004047692 | 186 |
| 146 | 3300006847 | Ga0075431_100148503 | Ga0075431_1001485032 | 186 |
| 147 | 3300006880 | Ga0075429_100016813 | Ga0075429_1000168136 | 186 |
| 148 | 3300009147 | Ga0114129_10016784 | Ga0114129_100167848 | 186 |
| 149 | 3300009176 | Ga0105242_10637387 | Ga0105242_106373872 | 186 |
| 150 | 3300032002 | Ga0307416_100561210 | Ga0307416_1005612102 | 186 |
| 151 | 3300050507 | nmdc:mga05p37_39253_c1 | nmdc:mga05p37_39253_c1_506_1105 | 186 |
| 152 | 3300054114 | Ga0501084_0107402 | Ga0501084_0107402_454_1071 | 186 |
| 153 | 3300009098 | Ga0105245_10240759 | Ga0105245_102407591 | 187 |
| 154 | 3300026075 | Ga0207708_10550055 | Ga0207708_105500552 | 187 |
| 155 | 3300049576 | Ga0501040_0173907 | Ga0501040_0173907_429_1040 | 189 |
| 156 | 3300054114 | Ga0501084_0567249 | Ga0501084_0567249_266_877 | 189 |
| 157 | 3300005336 | Ga0070680_100164032 | Ga0070680_1001640323 | 190 |
| 158 | 3300005438 | Ga0070701_10369733 | Ga0070701_103697331 | 190 |
| 159 | 3300005549 | Ga0070704_100214040 | Ga0070704_1002140402 | 190 |
| 160 | 3300006846 | Ga0075430_100096777 | Ga0075430_1000967774 | 190 |
| 161 | 3300009147 | Ga0114129_11380352 | Ga0114129_113803521 | 190 |
| 162 | 3300025917 | Ga0207660_10153313 | Ga0207660_101533132 | 190 |
| 163 | 3300031548 | Ga0307408_100035582 | Ga0307408_1000355822 | 190 |
| 164 | 3300031548 | Ga0307408_100198580 | Ga0307408_1001985802 | 190 |
| 165 | 3300032002 | Ga0307416_100355035 | Ga0307416_1003550352 | 190 |
| 166 | 3300041408 | Ga0439453_0016640 | Ga0439453_0016640_576_1172 | 190 |
| 167 | 3300041997 | Ga0439431_0036390 | Ga0439431_0036390_444_1049 | 190 |
| 168 | 3300042001 | Ga0439441_007900 | Ga0439441_007900_801_1397 | 190 |
| 169 | 3300042003 | Ga0439443_003819 | Ga0439443_003819_695_1291 | 190 |
| 170 | 3300042436 | Ga0439435_0000783 | Ga0439435_0000783_917_1513 | 190 |
| 171 | 3300042437 | Ga0439444_0000585 | Ga0439444_0000585_633_1229 | 190 |
| 172 | 3300049570 | Ga0501033_0251225 | Ga0501033_0251225_205_801 | 190 |
| 173 | 3300049574 | Ga0501038_0037170 | Ga0501038_0037170_1651_2247 | 190 |
| 174 | 3300049575 | Ga0501039_0019978 | Ga0501039_0019978_3251_3847 | 190 |
| 175 | 3300049577 | Ga0501041_0016937 | Ga0501041_0016937_2593_3189 | 190 |
| 176 | 3300049578 | Ga0501042_0141993 | Ga0501042_0141993_1040_1636 | 190 |
| 177 | 3300049579 | Ga0501043_0416466 | Ga0501043_0416466_217_813 | 190 |
| 178 | 3300049580 | Ga0501046_0094882 | Ga0501046_0094882_1448_2044 | 190 |
| 179 | 3300049582 | Ga0501048_0046144 | Ga0501048_0046144_1991_2587 | 190 |
| 180 | 3300049584 | Ga0501068_0103998 | Ga0501068_0103998_597_1193 | 190 |
| 181 | 3300049587 | Ga0501071_0032113 | Ga0501071_0032113_1253_1849 | 190 |
| 182 | 3300049587 | Ga0501071_0226774 | Ga0501071_0226774_357_968 | 190 |
| 183 | 3300049588 | Ga0501072_0009825 | Ga0501072_0009825_3850_4446 | 190 |
| 184 | 3300049591 | Ga0501075_0008633 | Ga0501075_0008633_3183_3779 | 190 |
| 185 | 3300049592 | Ga0501076_0002070 | Ga0501076_0002070_3332_3928 | 190 |
| 186 | 3300049593 | Ga0501077_0044299 | Ga0501077_0044299_1337_1933 | 190 |
| 187 | 3300049741 | Ga0501079_0012688 | Ga0501079_0012688_3301_3897 | 190 |
| 188 | 3300049742 | Ga0501080_0065143 | Ga0501080_0065143_310_906 | 190 |
| 189 | 3300049743 | Ga0501081_0014040 | Ga0501081_0014040_1370_1966 | 190 |
| 190 | 3300049824 | Ga0501045_0028852 | Ga0501045_0028852_62_658 | 190 |
| 191 | 3300050509 | nmdc:mga0qj67_23602_c1 | nmdc:mga0qj67_23602_c1_1528_2148 | 190 |
| 192 | 3300050510 | nmdc:mga06r32_596752_c1 | nmdc:mga06r32_596752_c1_46_666 | 190 |
| 193 | 3300060353 | Ga0501082_0022247 | Ga0501082_0022247_2389_2985 | 190 |
| 194 | 3300061734 | Ga0530510_0002052 | Ga0530510_0002052_10065_10661 | 190 |
| 195 | 3300006844 | Ga0075428_100362614 | Ga0075428_1003626142 | 191 |
| 196 | 3300006846 | Ga0075430_100003485 | Ga0075430_1000034859 | 191 |
| 197 | 3300006846 | Ga0075430_100277985 | Ga0075430_1002779852 | 191 |
| 198 | 3300006847 | Ga0075431_100210940 | Ga0075431_1002109401 | 191 |
| 199 | 3300006880 | Ga0075429_100097839 | Ga0075429_1000978391 | 191 |
| 200 | 3300009147 | Ga0114129_10067912 | Ga0114129_100679125 | 191 |
| 201 | 3300027395 | Ga0209996_1010785 | Ga0209996_10107852 | 191 |
| 202 | 3300027543 | Ga0209999_1003859 | Ga0209999_10038592 | 191 |
| 203 | 3300027665 | Ga0209983_1041901 | Ga0209983_10419011 | 191 |
| 204 | 3300027876 | Ga0209974_10035372 | Ga0209974_100353722 | 191 |
| 205 | 3300031548 | Ga0307408_100543706 | Ga0307408_1005437061 | 191 |
| 206 | 3300031903 | Ga0307407_10098675 | Ga0307407_100986752 | 191 |
| 207 | 3300032002 | Ga0307416_100347935 | Ga0307416_1003479352 | 191 |
| 208 | 3300041408 | Ga0439453_0000656 | Ga0439453_0000656_1884_2498 | 191 |
| 209 | 3300042001 | Ga0439441_000395 | Ga0439441_000395_1601_2215 | 191 |
| 210 | 3300042013 | Ga0439456_030392 | Ga0439456_030392_285_899 | 191 |
| 211 | 3300042437 | Ga0439444_0003720 | Ga0439444_0003720_205_819 | 191 |
| 212 | 3300042461 | Ga0439460_0002711 | Ga0439460_0002711_2604_3218 | 191 |
| 213 | 3300046528 | Ga0495642_0075626 | Ga0495642_0075626_133_747 | 191 |
| 214 | 3300049515 | Ga0501292_045736 | Ga0501292_045736_133_756 | 191 |
| 215 | 3300049575 | Ga0501039_0331892 | Ga0501039_0331892_133_732 | 191 |
| 216 | 3300049576 | Ga0501040_0089937 | Ga0501040_0089937_204_803 | 191 |
| 217 | 3300049577 | Ga0501041_0060408 | Ga0501041_0060408_442_1041 | 191 |
| 218 | 3300049578 | Ga0501042_0561202 | Ga0501042_0561202_55_654 | 191 |
| 219 | 3300049579 | Ga0501043_0641212 | Ga0501043_0641212_52_651 | 191 |
| 220 | 3300049824 | Ga0501045_0108557 | Ga0501045_0108557_1246_1845 | 191 |
| 221 | 3300050507 | nmdc:mga05p37_38831_c1 | nmdc:mga05p37_38831_c1_1694_2308 | 191 |
| 222 | 3300050509 | nmdc:mga0qj67_2114_c1 | nmdc:mga0qj67_2114_c1_2997_3611 | 191 |
| 223 | 3300049573 | Ga0501037_0264364 | Ga0501037_0264364_574_1185 | 195 |
| 224 | 3300049575 | Ga0501039_0013115 | Ga0501039_0013115_2545_3156 | 195 |
| 225 | 3300049577 | Ga0501041_0206981 | Ga0501041_0206981_583_1194 | 195 |
| 226 | 3300049579 | Ga0501043_0332768 | Ga0501043_0332768_319_930 | 195 |
| 227 | 3300049592 | Ga0501076_0116551 | Ga0501076_0116551_663_1274 | 195 |
| 228 | 3300049741 | Ga0501079_0039583 | Ga0501079_0039583_255_866 | 195 |
| 229 | 3300049743 | Ga0501081_0169959 | Ga0501081_0169959_809_1420 | 195 |
| 230 | 3300005334 | Ga0068869_100041911 | Ga0068869_1000419113 | 196 |
| 231 | 3300005336 | Ga0070680_100010047 | Ga0070680_1000100472 | 196 |
| 232 | 3300005336 | Ga0070680_100058226 | Ga0070680_1000582263 | 196 |
| 233 | 3300005340 | Ga0070689_100272514 | Ga0070689_1002725142 | 196 |
| 234 | 3300005341 | Ga0070691_10065318 | Ga0070691_100653182 | 196 |
| 235 | 3300005345 | Ga0070692_10041953 | Ga0070692_100419533 | 196 |
| 236 | 3300005347 | Ga0070668_100090583 | Ga0070668_1000905834 | 196 |
| 237 | 3300005354 | Ga0070675_100031320 | Ga0070675_1000313202 | 196 |
| 238 | 3300005356 | Ga0070674_100064893 | Ga0070674_1000648933 | 196 |
| 239 | 3300005364 | Ga0070673_100452922 | Ga0070673_1004529221 | 196 |
| 240 | 3300005364 | Ga0070673_100482766 | Ga0070673_1004827662 | 196 |
| 241 | 3300005438 | Ga0070701_10457230 | Ga0070701_104572301 | 196 |
| 242 | 3300005441 | Ga0070700_100013789 | Ga0070700_1000137892 | 196 |
| 243 | 3300005441 | Ga0070700_100187575 | Ga0070700_1001875752 | 196 |
| 244 | 3300005444 | Ga0070694_100018420 | Ga0070694_1000184206 | 196 |
| 245 | 3300005456 | Ga0070678_100895891 | Ga0070678_1008958911 | 196 |
| 246 | 3300005457 | Ga0070662_100496118 | Ga0070662_1004961181 | 196 |
| 247 | 3300005459 | Ga0068867_100002232 | Ga0068867_1000022323 | 196 |
| 248 | 3300005543 | Ga0070672_100449523 | Ga0070672_1004495232 | 196 |
| 249 | 3300005545 | Ga0070695_100018622 | Ga0070695_1000186223 | 196 |
| 250 | 3300005549 | Ga0070704_100002202 | Ga0070704_1000022027 | 196 |
| 251 | 3300005549 | Ga0070704_100232172 | Ga0070704_1002321722 | 196 |
| 252 | 3300005719 | Ga0068861_100026879 | Ga0068861_1000268794 | 196 |
| 253 | 3300005719 | Ga0068861_100203647 | Ga0068861_1002036472 | 196 |
| 254 | 3300005840 | Ga0068870_10069528 | Ga0068870_100695282 | 196 |
| 255 | 3300005840 | Ga0068870_10213969 | Ga0068870_102139692 | 196 |
| 256 | 3300005844 | Ga0068862_100017502 | Ga0068862_1000175022 | 196 |
| 257 | 3300006847 | Ga0075431_100699382 | Ga0075431_1006993822 | 196 |
| 258 | 3300006881 | Ga0068865_100256776 | Ga0068865_1002567762 | 196 |
| 259 | 3300009094 | Ga0111539_10349145 | Ga0111539_103491452 | 196 |
| 260 | 3300009147 | Ga0114129_10711807 | Ga0114129_107118072 | 196 |
| 261 | 3300009553 | Ga0105249_10006734 | Ga0105249_100067346 | 196 |
| 262 | 3300013306 | Ga0163162_10212226 | Ga0163162_102122262 | 196 |
| 263 | 3300013308 | Ga0157375_10625632 | Ga0157375_106256321 | 196 |
| 264 | 3300014326 | Ga0157380_10004851 | Ga0157380_100048513 | 196 |
| 265 | 3300014745 | Ga0157377_10137880 | Ga0157377_101378801 | 196 |
| 266 | 3300025908 | Ga0207643_10008266 | Ga0207643_100082664 | 196 |
| 267 | 3300025908 | Ga0207643_10199462 | Ga0207643_101994622 | 196 |
| 268 | 3300025917 | Ga0207660_10022162 | Ga0207660_100221626 | 196 |
| 269 | 3300025917 | Ga0207660_10279807 | Ga0207660_102798072 | 196 |
| 270 | 3300025926 | Ga0207659_10028115 | Ga0207659_100281153 | 196 |
| 271 | 3300025933 | Ga0207706_10050248 | Ga0207706_100502485 | 196 |
| 272 | 3300025935 | Ga0207709_10019131 | Ga0207709_100191312 | 196 |
| 273 | 3300025937 | Ga0207669_10374392 | Ga0207669_103743922 | 196 |
| 274 | 3300025938 | Ga0207704_10009561 | Ga0207704_100095616 | 196 |
| 275 | 3300025940 | Ga0207691_10149497 | Ga0207691_101494972 | 196 |
| 276 | 3300025942 | Ga0207689_10024495 | Ga0207689_100244953 | 196 |
| 277 | 3300025961 | Ga0207712_10005266 | Ga0207712_100052663 | 196 |
| 278 | 3300025972 | Ga0207668_10049704 | Ga0207668_100497042 | 196 |
| 279 | 3300026075 | Ga0207708_10006893 | Ga0207708_100068938 | 196 |
| 280 | 3300026075 | Ga0207708_10454295 | Ga0207708_104542952 | 196 |
| 281 | 3300026089 | Ga0207648_10002662 | Ga0207648_1000266217 | 196 |
| 282 | 3300026118 | Ga0207675_100010009 | Ga0207675_1000100093 | 196 |
| 283 | 3300026118 | Ga0207675_100285144 | Ga0207675_1002851442 | 196 |
| 284 | 3300026121 | Ga0207683_10595060 | Ga0207683_105950602 | 196 |
| 285 | 3300026121 | Ga0207683_10632662 | Ga0207683_106326622 | 196 |
| 286 | 3300027907 | Ga0207428_10050086 | Ga0207428_100500862 | 196 |
| 287 | 3300027907 | Ga0207428_10434310 | Ga0207428_104343102 | 196 |
| 288 | 3300028380 | Ga0268265_10001132 | Ga0268265_1000113212 | 196 |
| 289 | 3300028380 | Ga0268265_10224432 | Ga0268265_102244322 | 196 |
| 290 | 3300028380 | Ga0268265_10312513 | Ga0268265_103125132 | 196 |
| 291 | 3300050507 | nmdc:mga05p37_531766_c1 | nmdc:mga05p37_531766_c1_255_893 | 196 |
| 292 | 3300050507 | nmdc:mga05p37_718779_c1 | nmdc:mga05p37_718779_c1_184_813 | 196 |
| 293 | 3300050508 | nmdc:mga09592_681896_c1 | nmdc:mga09592_681896_c1_160_774 | 196 |
| 294 | 3300050509 | nmdc:mga0qj67_199328_c1 | nmdc:mga0qj67_199328_c1_893_1507 | 196 |
| 295 | 3300050511 | nmdc:mga08y16_287966_c1 | nmdc:mga08y16_287966_c1_534_1163 | 196 |
| 296 | 3300050511 | nmdc:mga08y16_404940_c1 | nmdc:mga08y16_404940_c1_569_1198 | 196 |
| 297 | 3300050511 | nmdc:mga08y16_621086_c1 | nmdc:mga08y16_621086_c1_329_958 | 196 |
| 298 | 3300050511 | nmdc:mga08y16_82757_c1 | nmdc:mga08y16_82757_c1_2642_3271 | 196 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4aou-assembly1.cif.gz_A-2 | ctidh bound to nadp. the complex structures of isocitrate dehydrogenase from clostridium thermocellum and desulfotalea psychrophila, support a new active site locking mechanism | 0.6099 | 72 | 144 |
| 1ni5-assembly1.cif.gz_A-2 | structure of the mesj pp-atpase from escherichia coli | 0.6086 | 2 | 152 |
| 1cnz-assembly1.cif.gz_B | 3-isopropylmalate dehydrogenase (ipmdh) from salmonella typhimurium | 0.6086 | 78 | 144 |
| 6xxy-assembly1.cif.gz_B | crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. | 0.5807 | 78 | 140 |
| 1g2u-assembly1.cif.gz_A-2 | the structure of the mutant, a172v, of 3-isopropylmalate dehydrogenase from thermus thermophilus hb8 : its thermostability and structure. | 0.5802 | 78 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54SV7_3_143_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.6735 | 4 | 106 | 3.40.50.620 |
| af_Q4E0P7_114_265_3.40.718.10 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.6667 | 76 | 142 | 3.40.718.10 |
| 1ni5A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.6121 | 2 | 152 | 3.40.50.620 |
| af_Q54IX1_146_387_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.5808 | 9 | 87 | 3.90.550.10 |
| af_P23797_57_301_3.40.50.10320 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.551 | 6 | 140 | 3.40.50.10320 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536YAH0-F1-model_v4 | 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) | 0.8637 | 1 | 193 |
GO:0008616
|
| AF-A0A1W2G9Q3-F1-model_v4 | PP-loop family protein | 0.8407 | 1 | 168 |
|
| AF-A0A536YAH0-F1-model_v4 | 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) | 0.8315 | 1 | 193 |
GO:0008616
|
| AF-A0A2E2T9B6-F1-model_v4 | 7-cyano-7-deazaguanine synthase | 0.8245 | 2 | 168 |
|
| AF-A0A363SFE4-F1-model_v4 | 7-cyano-7-deazaguanine synthase | 0.8225 | 1 | 187 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar