F394240

General Info

Members Datasets Scaffolds Average Seq Length
298 180 298 199

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10711807|Ga0114129_107118072
Length 217
Sequence MTTLVMFSGGLDSTAMLLKLLAGPGEEMRTELRVHHVRMVNREGRDRAESRAVESIVSYCRARYRPFRYSESALDFSGLEAVPIDYLSIAFVACQVAIDTPGCDRIAVGALSTDTDIVNRCARQRRVFDAMYECYRARKLGEPRVEWLYPVYDTPKAELAAALPPELLDLTWSCRRPIDGYRPCLACKACIAREKAKNPAGRQDLHSPAAPAHNRAR

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
93 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
94 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
105 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
106 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
107 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
108 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
109 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
110 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100041911 3300005334 Bacteria 3280
2 Ga0070680_100010047 3300005336 Bacteria 7291
3 Ga0070680_100058226 3300005336 Bacteria 3160
4 Ga0070680_100063916 3300005336 Bacteria 3016
5 Ga0070680_100164032 3300005336 Bacteria 1868
6 Ga0070689_100272514 3300005340 Bacteria 1401
7 Ga0070689_100420317 3300005340 Bacteria 1133
8 Ga0070691_10065318 3300005341 Bacteria 1757
9 Ga0070692_10041953 3300005345 Bacteria 2346
10 Ga0070668_100090583 3300005347 Bacteria 2409
11 Ga0070675_100031320 3300005354 Bacteria 4299
12 Ga0070674_100064893 3300005356 Bacteria 2561
13 Ga0070673_100272131 3300005364 Bacteria 1483
14 Ga0070673_100452922 3300005364 Bacteria 1155
15 Ga0070673_100482766 3300005364 Bacteria 1119
16 Ga0070673_100650358 3300005364 Bacteria 965
17 Ga0070709_10246094 3300005434 Bacteria 1286
18 Ga0070714_100430057 3300005435 Bacteria 1252
19 Ga0070713_100679813 3300005436 Bacteria 982
20 Ga0070701_10369733 3300005438 Bacteria 901
21 Ga0070701_10457230 3300005438 Bacteria 821
22 Ga0070705_100004332 3300005440 Bacteria 6913
23 Ga0070700_100013789 3300005441 Bacteria 4546
24 Ga0070700_100187575 3300005441 Bacteria 1443
25 Ga0070694_100018420 3300005444 Bacteria 4431
26 Ga0070708_100181957 3300005445 Bacteria 1965
27 Ga0070678_100895891 3300005456 Bacteria 811
28 Ga0070662_100496118 3300005457 Bacteria 1018
29 Ga0070681_10026128 3300005458 Bacteria 5871
30 Ga0070681_10464266 3300005458 Bacteria 1178
31 Ga0068867_100002232 3300005459 Bacteria 13609
32 Ga0070707_100911102 3300005468 Bacteria 844
33 Ga0070698_100260859 3300005471 Bacteria 1665
34 Ga0070699_100005306 3300005518 Bacteria 11305
35 Ga0070699_100077516 3300005518 Bacteria 2894
36 Ga0070679_100130060 3300005530 Bacteria 2499
37 Ga0070697_100002467 3300005536 Bacteria 14224
38 Ga0070697_100750034 3300005536 Bacteria 863
39 Ga0070672_100449523 3300005543 Bacteria 1110
40 Ga0070695_100011896 3300005545 Bacteria 5209
41 Ga0070695_100018622 3300005545 Bacteria 4217
42 Ga0070695_100055453 3300005545 Bacteria 2554
43 Ga0070695_100406402 3300005545 Bacteria 1033
44 Ga0070696_100003728 3300005546 Bacteria 10171
45 Ga0070696_100534747 3300005546 Bacteria 937
46 Ga0070693_100378366 3300005547 Bacteria 976
47 Ga0070704_100002202 3300005549 Bacteria 10863
48 Ga0070704_100108049 3300005549 Bacteria 2111
49 Ga0070704_100174074 3300005549 Bacteria 1715
50 Ga0070704_100214040 3300005549 Bacteria 1563
51 Ga0070704_100232172 3300005549 Bacteria 1506
52 Ga0070702_100304145 3300005615 Bacteria 1105
53 Ga0068861_100026879 3300005719 Bacteria 4187
54 Ga0068861_100203647 3300005719 Bacteria 1662
55 Ga0068870_10069528 3300005840 Bacteria 1916
56 Ga0068870_10213969 3300005840 Bacteria 1176
57 Ga0068863_101310602 3300005841 Bacteria 731
58 Ga0068862_100017502 3300005844 Bacteria 5970
59 Ga0081539_10002623 3300005985 Bacteria 24577
60 Ga0097621_100404769 3300006237 Bacteria 1222
61 Ga0075428_100362614 3300006844 Bacteria 1554
62 Ga0075430_100003485 3300006846 Bacteria 13164
63 Ga0075430_100008481 3300006846 Bacteria 8682
64 Ga0075430_100096777 3300006846 Bacteria 2467
65 Ga0075430_100277985 3300006846 Bacteria 1385
66 Ga0075431_100142607 3300006847 Bacteria 2470
67 Ga0075431_100148503 3300006847 Bacteria 2414
68 Ga0075431_100210940 3300006847 Bacteria 1984
69 Ga0075431_100699382 3300006847 Bacteria 991
70 Ga0075433_10136586 3300006852 Bacteria 2180
71 Ga0075433_10484133 3300006852 Bacteria 1090
72 Ga0075434_100000065 3300006871 Bacteria 54115
73 Ga0075434_100049777 3300006871 Bacteria 4161
74 Ga0075434_100768834 3300006871 Bacteria 980
75 Ga0075429_100016813 3300006880 Bacteria 6331
76 Ga0075429_100097839 3300006880 Bacteria 2560
77 Ga0068865_100256776 3300006881 Bacteria 1382
78 Ga0068865_100597966 3300006881 Bacteria 932
79 Ga0075436_100000392 3300006914 Bacteria 28103
80 Ga0075436_100029313 3300006914 Bacteria 3784
81 Ga0075436_100040959 3300006914 Bacteria 3196
82 Ga0075436_100121346 3300006914 Bacteria 1829
83 Ga0075436_100147803 3300006914 Bacteria 1652
84 Ga0075436_100565266 3300006914 Bacteria 836
85 Ga0075435_100006010 3300007076 Bacteria 8544
86 Ga0075435_100241829 3300007076 Bacteria 1535
87 Ga0075435_100591732 3300007076 Bacteria 962
88 Ga0075435_100739983 3300007076 Bacteria 855
89 Ga0099794_10147253 3300007265 Bacteria 1194
90 Ga0111539_10349145 3300009094 Bacteria 1722
91 Ga0105245_10240759 3300009098 Bacteria 1754
92 Ga0114129_10016784 3300009147 Bacteria 10423
93 Ga0114129_10067912 3300009147 Bacteria 4971
94 Ga0114129_10711807 3300009147 Bacteria 1289
95 Ga0114129_11380352 3300009147 Bacteria 870
96 Ga0105242_10637387 3300009176 Unclassified 1035
97 Ga0105249_10006734 3300009553 Bacteria 10011
98 Ga0163162_10212226 3300013306 Bacteria 2066
99 Ga0157375_10625632 3300013308 Bacteria 1234
100 Ga0157380_10004851 3300014326 Bacteria 9367
101 Ga0157377_10137880 3300014745 Bacteria 1496
102 Ga0207699_10340014 3300025906 Bacteria 1057
103 Ga0207699_10401697 3300025906 Bacteria 976
104 Ga0207643_10008266 3300025908 Bacteria 5587
105 Ga0207643_10199462 3300025908 Bacteria 1218
106 Ga0207707_10027621 3300025912 Bacteria 4961
107 Ga0207663_10441171 3300025916 Bacteria 1003
108 Ga0207660_10022162 3300025917 Bacteria 4278
109 Ga0207660_10153313 3300025917 Bacteria 1772
110 Ga0207660_10166412 3300025917 Bacteria 1704
111 Ga0207660_10279807 3300025917 Bacteria 1324
112 Ga0207652_10086133 3300025921 Bacteria 2754
113 Ga0207646_10475788 3300025922 Bacteria 1126
114 Ga0207659_10028115 3300025926 Bacteria 3817
115 Ga0207664_10601508 3300025929 Bacteria 987
116 Ga0207706_10050248 3300025933 Bacteria 3685
117 Ga0207709_10019131 3300025935 Bacteria 3845
118 Ga0207670_10202747 3300025936 Bacteria 1508
119 Ga0207669_10374392 3300025937 Bacteria 1108
120 Ga0207704_10009561 3300025938 Bacteria 4683
121 Ga0207704_10548764 3300025938 Bacteria 939
122 Ga0207665_10764566 3300025939 Bacteria 762
123 Ga0207691_10149497 3300025940 Bacteria 2054
124 Ga0207689_10024495 3300025942 Bacteria 5064
125 Ga0207651_10322305 3300025960 Bacteria 1292
126 Ga0207712_10005266 3300025961 Bacteria 8178
127 Ga0207668_10049704 3300025972 Bacteria 2884
128 Ga0207708_10006893 3300026075 Bacteria 8405
129 Ga0207708_10058327 3300026075 Bacteria 2945
130 Ga0207708_10454295 3300026075 Bacteria 1067
131 Ga0207708_10550055 3300026075 Bacteria 973
132 Ga0207648_10002662 3300026089 Bacteria 19053
133 Ga0207676_10037870 3300026095 Bacteria 3679
134 Ga0207675_100010009 3300026118 Bacteria 8885
135 Ga0207675_100285144 3300026118 Bacteria 1605
136 Ga0207683_10595060 3300026121 Bacteria 1024
137 Ga0207683_10632662 3300026121 Bacteria 991
138 Ga0209996_1010785 3300027395 Bacteria 1215
139 Ga0209999_1003859 3300027543 Bacteria 2695
140 Ga0209983_1041901 3300027665 Bacteria 991
141 Ga0209974_10035372 3300027876 Bacteria 1659
142 Ga0207428_10050086 3300027907 Bacteria 3343
143 Ga0207428_10091282 3300027907 Bacteria 2364
144 Ga0207428_10434310 3300027907 Bacteria 958
145 Ga0268265_10001132 3300028380 Bacteria 23559
146 Ga0268265_10224432 3300028380 Bacteria 1646
147 Ga0268265_10312513 3300028380 Bacteria 1419
148 Ga0307408_100035582 3300031548 Bacteria 3496
149 Ga0307408_100198580 3300031548 Bacteria 1622
150 Ga0307408_100543706 3300031548 Bacteria 1024
151 Ga0307407_10098675 3300031903 Bacteria 1808
152 Ga0307416_100347935 3300032002 Bacteria 1498
153 Ga0307416_100355035 3300032002 Bacteria 1485
154 Ga0307416_100561210 3300032002 Bacteria 1216
155 Ga0307416_100680875 3300032002 Bacteria 1116
156 Ga0373938_0008300 3300034957 Bacteria 1852
157 Ga0373949_0011001 3300035090 Bacteria 1990
158 Ga0373939_0018147 3300035114 Bacteria 1880
159 Ga0373941_0002659 3300035115 Bacteria 3962
160 Ga0373953_0031099 3300035117 Bacteria 2075
161 Ga0373954_0000094 3300035118 Bacteria 30419
162 Ga0373956_0093843 3300035119 Bacteria 1386
163 Ga0373961_0021061 3300035241 Bacteria 1731
164 Ga0373931_0026316 3300035691 Bacteria 2960
165 Ga0373935_0209956 3300035692 Bacteria 1349
166 Ga0373933_0048323 3300035724 Bacteria 2533
167 Ga0373937_0000449 3300036401 Bacteria 37990
168 Ga0439453_0000656 3300041408 Bacteria 3943
169 Ga0439453_0016640 3300041408 Bacteria 1285
170 Ga0439431_0036390 3300041997 Bacteria 1240
171 Ga0439441_000395 3300042001 Bacteria 4555
172 Ga0439441_007900 3300042001 Bacteria 1726
173 Ga0439443_003819 3300042003 Bacteria 1928
174 Ga0439456_030392 3300042013 Bacteria 1156
175 Ga0439435_0000783 3300042436 Bacteria 5358
176 Ga0439444_0000585 3300042437 Bacteria 4177
177 Ga0439444_0003720 3300042437 Bacteria 2173
178 Ga0439460_0002711 3300042461 Bacteria 4270
179 Ga0466964_0097927 3300044706 Bacteria 1288
180 Ga0466968_0227118 3300044735 Bacteria 881
181 Ga0466960_0549266 3300044901 Bacteria 681
182 Ga0495641_0143926 3300046461 Bacteria 1065
183 Ga0495651_0545356 3300046462 Unclassified 737
184 Ga0495653_0423228 3300046463 Bacteria 842
185 Ga0495662_0004818 3300046476 Bacteria 6763
186 Ga0495662_0016532 3300046476 Bacteria 3574
187 Ga0495608_0010394 3300046511 Bacteria 6495
188 Ga0495618_0111941 3300046514 Bacteria 1748
189 Ga0495628_0006337 3300046516 Bacteria 10341
190 Ga0495628_0178517 3300046516 Bacteria 1607
191 Ga0495630_0001124 3300046517 Bacteria 18441
192 Ga0495630_0090836 3300046517 Bacteria 2307
193 Ga0495642_0075626 3300046528 Bacteria 1413
194 Ga0495652_0052066 3300046529 Bacteria 3493
195 Ga0495652_0261542 3300046529 Bacteria 1277
196 Ga0495640_0001398 3300046533 Bacteria 18997
197 Ga0495640_0021347 3300046533 Bacteria 4755
198 Ga0495586_0001311 3300046535 Bacteria 13836
199 Ga0495586_0188338 3300046535 Bacteria 1168
200 Ga0495587_0006712 3300046536 Bacteria 7496
201 Ga0495621_0052507 3300046539 Bacteria 1461
202 Ga0495645_0030431 3300046543 Bacteria 3931
203 Ga0495667_0017435 3300046559 Bacteria 4850
204 Ga0495634_0004109 3300046642 Bacteria 11527
205 Ga0495634_0142005 3300046642 Bacteria 1524
206 Ga0495635_0062968 3300046663 Bacteria 2547
207 Ga0495635_0422987 3300046663 Bacteria 883
208 Ga0495657_0044941 3300046675 Bacteria 3000
209 Ga0495599_0000904 3300046678 Bacteria 16610
210 Ga0495599_0243013 3300046678 Bacteria 1097
211 Ga0495623_0099248 3300046679 Bacteria 1776
212 Ga0495658_0027285 3300046683 Bacteria 3071
213 Ga0495658_0088377 3300046683 Bacteria 1831
214 Ga0495658_0245945 3300046683 Bacteria 1124
215 Ga0495669_0006201 3300046684 Bacteria 4989
216 Ga0495613_0014125 3300046689 Bacteria 5925
217 Ga0495624_0016753 3300046690 Bacteria 4932
218 Ga0495600_0022288 3300046809 Bacteria 4066
219 Ga0495600_0305314 3300046809 Bacteria 1003
220 Ga0495604_0001361 3300047317 Bacteria 20003
221 Ga0495604_0057287 3300047317 Bacteria 2996
222 Ga0495636_0015775 3300047318 Bacteria 3012
223 Ga0495674_0392114 3300047319 Bacteria 1122
224 Ga0501292_045736 3300049515 Bacteria 766
225 Ga0501033_0251225 3300049570 Bacteria 1253
226 Ga0501037_0264364 3300049573 Bacteria 1202
227 Ga0501038_0037170 3300049574 Bacteria 4271
228 Ga0501039_0013115 3300049575 Bacteria 6337
229 Ga0501039_0019978 3300049575 Bacteria 5134
230 Ga0501039_0331892 3300049575 Bacteria 1195
231 Ga0501040_0089937 3300049576 Bacteria 2133
232 Ga0501040_0173907 3300049576 Bacteria 1525
233 Ga0501041_0016937 3300049577 Bacteria 4336
234 Ga0501041_0060408 3300049577 Bacteria 2320
235 Ga0501041_0206981 3300049577 Bacteria 1230
236 Ga0501042_0141993 3300049578 Bacteria 1731
237 Ga0501042_0561202 3300049578 Bacteria 830
238 Ga0501043_0332768 3300049579 Bacteria 1156
239 Ga0501043_0416466 3300049579 Bacteria 1013
240 Ga0501043_0641212 3300049579 Bacteria 781
241 Ga0501046_0094882 3300049580 Bacteria 2292
242 Ga0501048_0046144 3300049582 Bacteria 3111
243 Ga0501067_0167581 3300049583 Bacteria 1223
244 Ga0501068_0103998 3300049584 Bacteria 1762
245 Ga0501069_0178864 3300049585 Bacteria 1226
246 Ga0501071_0032113 3300049587 Bacteria 3726
247 Ga0501071_0226774 3300049587 Bacteria 1407
248 Ga0501072_0009825 3300049588 Bacteria 7274
249 Ga0501075_0008633 3300049591 Bacteria 7104
250 Ga0501076_0002070 3300049592 Bacteria 13739
251 Ga0501076_0116551 3300049592 Bacteria 2162
252 Ga0501077_0044299 3300049593 Bacteria 2827
253 Ga0501077_0345342 3300049593 Bacteria 949
254 Ga0501079_0012688 3300049741 Bacteria 6436
255 Ga0501079_0039583 3300049741 Bacteria 3636
256 Ga0501080_0065143 3300049742 Bacteria 3390
257 Ga0501081_0014040 3300049743 Bacteria 5275
258 Ga0501081_0169959 3300049743 Bacteria 1574
259 Ga0501045_0028852 3300049824 Bacteria 4005
260 Ga0501045_0108557 3300049824 Bacteria 2057
261 nmdc:mga05p37_38831_c1 3300050507 Bacteria 5841
262 nmdc:mga05p37_39253_c1 3300050507 Bacteria 5811
263 nmdc:mga05p37_531766_c1 3300050507 Bacteria 1342
264 nmdc:mga05p37_718779_c1 3300050507 Bacteria 1106
265 nmdc:mga09592_26266_c1 3300050508 Bacteria 4823
266 nmdc:mga09592_681896_c1 3300050508 Bacteria 876
267 nmdc:mga0qj67_199328_c1 3300050509 Bacteria 1627
268 nmdc:mga0qj67_2114_c1 3300050509 Bacteria 14162
269 nmdc:mga0qj67_23602_c1 3300050509 Bacteria 4733
270 nmdc:mga0qj67_38306_c1 3300050509 Bacteria 3761
271 nmdc:mga06r32_596752_c1 3300050510 Bacteria 1075
272 nmdc:mga08y16_174056_c1 3300050511 Bacteria 2235
273 nmdc:mga08y16_287966_c1 3300050511 Bacteria 1694
274 nmdc:mga08y16_404940_c1 3300050511 Bacteria 1396
275 nmdc:mga08y16_621086_c1 3300050511 Bacteria 1088
276 nmdc:mga08y16_82757_c1 3300050511 Bacteria 3346
277 nmdc:mga0n895_291477_c1 3300050512 Bacteria 1655
278 nmdc:mga0n895_84_c1 3300050512 Bacteria 54345
279 nmdc:mga0n895_895173_c1 3300050512 Bacteria 873
280 nmdc:mga0rr50_11216_c1 3300050513 Bacteria 5722
281 nmdc:mga0rr50_183122_c1 3300050513 Bacteria 1713
282 nmdc:mga0rr50_328900_c1 3300050513 Bacteria 1283
283 nmdc:mga0rr50_663799_c1 3300050513 Bacteria 890
284 nmdc:mga08x19_15334_c1 3300050514 Bacteria 4662
285 nmdc:mga08x19_26816_c1 3300050514 Bacteria 3598
286 nmdc:mga08x19_296295_c1 3300050514 Bacteria 1123
287 nmdc:mga08x19_316882_c1 3300050514 Bacteria 1085
288 nmdc:mga08x19_37191_c1 3300050514 Bacteria 3088
289 nmdc:mga08x19_533452_c1 3300050514 Bacteria 830
290 nmdc:mga0a205_196133_c1 3300050515 Bacteria 1910
291 nmdc:mga0a205_200555_c1 3300050515 Bacteria 1886
292 nmdc:mga0a205_314916_c1 3300050515 Bacteria 1436
293 Ga0495612_0178298 3300053078 Bacteria 932
294 Ga0495619_0323802 3300053085 Bacteria 1067
295 Ga0501084_0107402 3300054114 Bacteria 2345
296 Ga0501084_0567249 3300054114 Viruses 959
297 Ga0501082_0022247 3300060353 Bacteria 5463
298 Ga0530510_0002052 3300061734 Bacteria 13839

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044735 Ga0466968_0227118 Ga0466968_0227118_313_858 169
2 3300050514 nmdc:mga08x19_316882_c1 nmdc:mga08x19_316882_c1_519_1061 169
3 3300050509 nmdc:mga0qj67_38306_c1 nmdc:mga0qj67_38306_c1_495_1094 170
4 3300006846 Ga0075430_100008481 Ga0075430_1000084815 173
5 3300006847 Ga0075431_100142607 Ga0075431_1001426072 173
6 3300005435 Ga0070714_100430057 Ga0070714_1004300572 179
7 3300005436 Ga0070713_100679813 Ga0070713_1006798132 179
8 3300005440 Ga0070705_100004332 Ga0070705_1000043324 179
9 3300005445 Ga0070708_100181957 Ga0070708_1001819572 179
10 3300005458 Ga0070681_10464266 Ga0070681_104642662 179
11 3300005468 Ga0070707_100911102 Ga0070707_1009111022 179
12 3300005518 Ga0070699_100005306 Ga0070699_1000053068 179
13 3300005518 Ga0070699_100077516 Ga0070699_1000775165 179
14 3300005536 Ga0070697_100002467 Ga0070697_1000024678 179
15 3300005536 Ga0070697_100750034 Ga0070697_1007500341 179
16 3300005545 Ga0070695_100011896 Ga0070695_1000118962 179
17 3300005545 Ga0070695_100406402 Ga0070695_1004064021 179
18 3300005546 Ga0070696_100003728 Ga0070696_1000037289 179
19 3300005546 Ga0070696_100534747 Ga0070696_1005347471 179
20 3300005547 Ga0070693_100378366 Ga0070693_1003783662 179
21 3300005549 Ga0070704_100174074 Ga0070704_1001740742 179
22 3300005985 Ga0081539_10002623 Ga0081539_100026237 179
23 3300006852 Ga0075433_10136586 Ga0075433_101365862 179
24 3300006852 Ga0075433_10484133 Ga0075433_104841332 179
25 3300006871 Ga0075434_100000065 Ga0075434_10000006520 179
26 3300006871 Ga0075434_100768834 Ga0075434_1007688342 179
27 3300006914 Ga0075436_100000392 Ga0075436_10000039230 179
28 3300006914 Ga0075436_100029313 Ga0075436_1000293136 179
29 3300006914 Ga0075436_100040959 Ga0075436_1000409592 179
30 3300006914 Ga0075436_100121346 Ga0075436_1001213462 179
31 3300006914 Ga0075436_100147803 Ga0075436_1001478032 179
32 3300006914 Ga0075436_100565266 Ga0075436_1005652662 179
33 3300007076 Ga0075435_100006010 Ga0075435_1000060106 179
34 3300007076 Ga0075435_100241829 Ga0075435_1002418291 179
35 3300007076 Ga0075435_100591732 Ga0075435_1005917321 179
36 3300007265 Ga0099794_10147253 Ga0099794_101472532 179
37 3300025906 Ga0207699_10401697 Ga0207699_104016972 179
38 3300025916 Ga0207663_10441171 Ga0207663_104411712 179
39 3300025922 Ga0207646_10475788 Ga0207646_104757882 179
40 3300025929 Ga0207664_10601508 Ga0207664_106015082 179
41 3300025939 Ga0207665_10764566 Ga0207665_107645662 179
42 3300035692 Ga0373935_0209956 Ga0373935_0209956_262_837 179
43 3300044706 Ga0466964_0097927 Ga0466964_0097927_243_830 179
44 3300046539 Ga0495621_0052507 Ga0495621_0052507_219_791 179
45 3300046684 Ga0495669_0006201 Ga0495669_0006201_2233_2820 179
46 3300049585 Ga0501069_0178864 Ga0501069_0178864_247_819 179
47 3300050512 nmdc:mga0n895_291477_c1 nmdc:mga0n895_291477_c1_549_1139 179
48 3300050512 nmdc:mga0n895_84_c1 nmdc:mga0n895_84_c1_3546_4133 179
49 3300050512 nmdc:mga0n895_895173_c1 nmdc:mga0n895_895173_c1_175_762 179
50 3300050513 nmdc:mga0rr50_11216_c1 nmdc:mga0rr50_11216_c1_4714_5286 179
51 3300050513 nmdc:mga0rr50_183122_c1 nmdc:mga0rr50_183122_c1_849_1436 179
52 3300050513 nmdc:mga0rr50_328900_c1 nmdc:mga0rr50_328900_c1_673_1260 179
53 3300050514 nmdc:mga08x19_15334_c1 nmdc:mga08x19_15334_c1_3392_4009 179
54 3300050514 nmdc:mga08x19_26816_c1 nmdc:mga08x19_26816_c1_574_1161 179
55 3300050514 nmdc:mga08x19_296295_c1 nmdc:mga08x19_296295_c1_53_640 179
56 3300050514 nmdc:mga08x19_37191_c1 nmdc:mga08x19_37191_c1_1447_2034 179
57 3300050514 nmdc:mga08x19_533452_c1 nmdc:mga08x19_533452_c1_79_669 179
58 3300050515 nmdc:mga0a205_196133_c1 nmdc:mga0a205_196133_c1_572_1159 179
59 3300050515 nmdc:mga0a205_200555_c1 nmdc:mga0a205_200555_c1_690_1262 179
60 3300050515 nmdc:mga0a205_314916_c1 nmdc:mga0a205_314916_c1_801_1373 179
61 3300053078 Ga0495612_0178298 Ga0495612_0178298_15_590 180
62 3300049593 Ga0501077_0345342 Ga0501077_0345342_306_902 182
63 3300005336 Ga0070680_100063916 Ga0070680_1000639164 183
64 3300005364 Ga0070673_100650358 Ga0070673_1006503582 183
65 3300005458 Ga0070681_10026128 Ga0070681_100261287 183
66 3300005471 Ga0070698_100260859 Ga0070698_1002608593 183
67 3300005530 Ga0070679_100130060 Ga0070679_1001300602 183
68 3300025912 Ga0207707_10027621 Ga0207707_100276215 183
69 3300025917 Ga0207660_10166412 Ga0207660_101664122 183
70 3300025921 Ga0207652_10086133 Ga0207652_100861332 183
71 3300032002 Ga0307416_100680875 Ga0307416_1006808752 183
72 3300034957 Ga0373938_0008300 Ga0373938_0008300_1230_1829 183
73 3300035090 Ga0373949_0011001 Ga0373949_0011001_236_835 183
74 3300035114 Ga0373939_0018147 Ga0373939_0018147_358_957 183
75 3300035115 Ga0373941_0002659 Ga0373941_0002659_382_981 183
76 3300035241 Ga0373961_0021061 Ga0373961_0021061_294_893 183
77 3300035691 Ga0373931_0026316 Ga0373931_0026316_193_792 183
78 3300044901 Ga0466960_0549266 Ga0466960_0549266_74_658 183
79 3300049583 Ga0501067_0167581 Ga0501067_0167581_36_620 183
80 3300005340 Ga0070689_100420317 Ga0070689_1004203172 185
81 3300005364 Ga0070673_100272131 Ga0070673_1002721312 185
82 3300005434 Ga0070709_10246094 Ga0070709_102460941 185
83 3300005545 Ga0070695_100055453 Ga0070695_1000554533 185
84 3300005549 Ga0070704_100108049 Ga0070704_1001080492 185
85 3300005615 Ga0070702_100304145 Ga0070702_1003041452 185
86 3300005841 Ga0068863_101310602 Ga0068863_1013106022 185
87 3300006871 Ga0075434_100049777 Ga0075434_1000497775 185
88 3300006881 Ga0068865_100597966 Ga0068865_1005979662 185
89 3300007076 Ga0075435_100739983 Ga0075435_1007399832 185
90 3300025906 Ga0207699_10340014 Ga0207699_103400142 185
91 3300025936 Ga0207670_10202747 Ga0207670_102027472 185
92 3300025938 Ga0207704_10548764 Ga0207704_105487641 185
93 3300025960 Ga0207651_10322305 Ga0207651_103223052 185
94 3300026075 Ga0207708_10058327 Ga0207708_100583272 185
95 3300026095 Ga0207676_10037870 Ga0207676_100378703 185
96 3300027907 Ga0207428_10091282 Ga0207428_100912822 185
97 3300035117 Ga0373953_0031099 Ga0373953_0031099_1138_1743 185
98 3300035118 Ga0373954_0000094 Ga0373954_0000094_10787_11392 185
99 3300035119 Ga0373956_0093843 Ga0373956_0093843_641_1246 185
100 3300035724 Ga0373933_0048323 Ga0373933_0048323_285_890 185
101 3300036401 Ga0373937_0000449 Ga0373937_0000449_15763_16368 185
102 3300046461 Ga0495641_0143926 Ga0495641_0143926_382_972 185
103 3300046462 Ga0495651_0545356 Ga0495651_0545356_42_647 185
104 3300046463 Ga0495653_0423228 Ga0495653_0423228_158_763 185
105 3300046476 Ga0495662_0004818 Ga0495662_0004818_4001_4606 185
106 3300046476 Ga0495662_0016532 Ga0495662_0016532_2292_2897 185
107 3300046511 Ga0495608_0010394 Ga0495608_0010394_4245_4835 185
108 3300046514 Ga0495618_0111941 Ga0495618_0111941_1111_1716 185
109 3300046516 Ga0495628_0006337 Ga0495628_0006337_4939_5544 185
110 3300046516 Ga0495628_0178517 Ga0495628_0178517_76_681 185
111 3300046517 Ga0495630_0001124 Ga0495630_0001124_8161_8766 185
112 3300046517 Ga0495630_0090836 Ga0495630_0090836_218_823 185
113 3300046529 Ga0495652_0052066 Ga0495652_0052066_2411_3016 185
114 3300046529 Ga0495652_0261542 Ga0495652_0261542_160_765 185
115 3300046533 Ga0495640_0001398 Ga0495640_0001398_16654_17244 185
116 3300046533 Ga0495640_0021347 Ga0495640_0021347_3286_3891 185
117 3300046535 Ga0495586_0001311 Ga0495586_0001311_9427_10032 185
118 3300046535 Ga0495586_0188338 Ga0495586_0188338_202_807 185
119 3300046536 Ga0495587_0006712 Ga0495587_0006712_6069_6674 185
120 3300046543 Ga0495645_0030431 Ga0495645_0030431_2177_2782 185
121 3300046559 Ga0495667_0017435 Ga0495667_0017435_3665_4255 185
122 3300046642 Ga0495634_0004109 Ga0495634_0004109_9475_10080 185
123 3300046642 Ga0495634_0142005 Ga0495634_0142005_384_989 185
124 3300046663 Ga0495635_0062968 Ga0495635_0062968_1448_2038 185
125 3300046663 Ga0495635_0422987 Ga0495635_0422987_122_727 185
126 3300046675 Ga0495657_0044941 Ga0495657_0044941_999_1604 185
127 3300046678 Ga0495599_0000904 Ga0495599_0000904_17_622 185
128 3300046678 Ga0495599_0243013 Ga0495599_0243013_236_841 185
129 3300046679 Ga0495623_0099248 Ga0495623_0099248_33_638 185
130 3300046683 Ga0495658_0027285 Ga0495658_0027285_933_1538 185
131 3300046683 Ga0495658_0088377 Ga0495658_0088377_230_835 185
132 3300046683 Ga0495658_0245945 Ga0495658_0245945_116_721 185
133 3300046689 Ga0495613_0014125 Ga0495613_0014125_3677_4282 185
134 3300046690 Ga0495624_0016753 Ga0495624_0016753_2737_3342 185
135 3300046809 Ga0495600_0022288 Ga0495600_0022288_3192_3797 185
136 3300046809 Ga0495600_0305314 Ga0495600_0305314_274_879 185
137 3300047317 Ga0495604_0001361 Ga0495604_0001361_13310_13915 185
138 3300047317 Ga0495604_0057287 Ga0495604_0057287_264_869 185
139 3300047318 Ga0495636_0015775 Ga0495636_0015775_2310_2915 185
140 3300047319 Ga0495674_0392114 Ga0495674_0392114_131_736 185
141 3300050508 nmdc:mga09592_26266_c1 nmdc:mga09592_26266_c1_381_986 185
142 3300050511 nmdc:mga08y16_174056_c1 nmdc:mga08y16_174056_c1_629_1234 185
143 3300050513 nmdc:mga0rr50_663799_c1 nmdc:mga0rr50_663799_c1_231_821 185
144 3300053085 Ga0495619_0323802 Ga0495619_0323802_331_936 185
145 3300006237 Ga0097621_100404769 Ga0097621_1004047692 186
146 3300006847 Ga0075431_100148503 Ga0075431_1001485032 186
147 3300006880 Ga0075429_100016813 Ga0075429_1000168136 186
148 3300009147 Ga0114129_10016784 Ga0114129_100167848 186
149 3300009176 Ga0105242_10637387 Ga0105242_106373872 186
150 3300032002 Ga0307416_100561210 Ga0307416_1005612102 186
151 3300050507 nmdc:mga05p37_39253_c1 nmdc:mga05p37_39253_c1_506_1105 186
152 3300054114 Ga0501084_0107402 Ga0501084_0107402_454_1071 186
153 3300009098 Ga0105245_10240759 Ga0105245_102407591 187
154 3300026075 Ga0207708_10550055 Ga0207708_105500552 187
155 3300049576 Ga0501040_0173907 Ga0501040_0173907_429_1040 189
156 3300054114 Ga0501084_0567249 Ga0501084_0567249_266_877 189
157 3300005336 Ga0070680_100164032 Ga0070680_1001640323 190
158 3300005438 Ga0070701_10369733 Ga0070701_103697331 190
159 3300005549 Ga0070704_100214040 Ga0070704_1002140402 190
160 3300006846 Ga0075430_100096777 Ga0075430_1000967774 190
161 3300009147 Ga0114129_11380352 Ga0114129_113803521 190
162 3300025917 Ga0207660_10153313 Ga0207660_101533132 190
163 3300031548 Ga0307408_100035582 Ga0307408_1000355822 190
164 3300031548 Ga0307408_100198580 Ga0307408_1001985802 190
165 3300032002 Ga0307416_100355035 Ga0307416_1003550352 190
166 3300041408 Ga0439453_0016640 Ga0439453_0016640_576_1172 190
167 3300041997 Ga0439431_0036390 Ga0439431_0036390_444_1049 190
168 3300042001 Ga0439441_007900 Ga0439441_007900_801_1397 190
169 3300042003 Ga0439443_003819 Ga0439443_003819_695_1291 190
170 3300042436 Ga0439435_0000783 Ga0439435_0000783_917_1513 190
171 3300042437 Ga0439444_0000585 Ga0439444_0000585_633_1229 190
172 3300049570 Ga0501033_0251225 Ga0501033_0251225_205_801 190
173 3300049574 Ga0501038_0037170 Ga0501038_0037170_1651_2247 190
174 3300049575 Ga0501039_0019978 Ga0501039_0019978_3251_3847 190
175 3300049577 Ga0501041_0016937 Ga0501041_0016937_2593_3189 190
176 3300049578 Ga0501042_0141993 Ga0501042_0141993_1040_1636 190
177 3300049579 Ga0501043_0416466 Ga0501043_0416466_217_813 190
178 3300049580 Ga0501046_0094882 Ga0501046_0094882_1448_2044 190
179 3300049582 Ga0501048_0046144 Ga0501048_0046144_1991_2587 190
180 3300049584 Ga0501068_0103998 Ga0501068_0103998_597_1193 190
181 3300049587 Ga0501071_0032113 Ga0501071_0032113_1253_1849 190
182 3300049587 Ga0501071_0226774 Ga0501071_0226774_357_968 190
183 3300049588 Ga0501072_0009825 Ga0501072_0009825_3850_4446 190
184 3300049591 Ga0501075_0008633 Ga0501075_0008633_3183_3779 190
185 3300049592 Ga0501076_0002070 Ga0501076_0002070_3332_3928 190
186 3300049593 Ga0501077_0044299 Ga0501077_0044299_1337_1933 190
187 3300049741 Ga0501079_0012688 Ga0501079_0012688_3301_3897 190
188 3300049742 Ga0501080_0065143 Ga0501080_0065143_310_906 190
189 3300049743 Ga0501081_0014040 Ga0501081_0014040_1370_1966 190
190 3300049824 Ga0501045_0028852 Ga0501045_0028852_62_658 190
191 3300050509 nmdc:mga0qj67_23602_c1 nmdc:mga0qj67_23602_c1_1528_2148 190
192 3300050510 nmdc:mga06r32_596752_c1 nmdc:mga06r32_596752_c1_46_666 190
193 3300060353 Ga0501082_0022247 Ga0501082_0022247_2389_2985 190
194 3300061734 Ga0530510_0002052 Ga0530510_0002052_10065_10661 190
195 3300006844 Ga0075428_100362614 Ga0075428_1003626142 191
196 3300006846 Ga0075430_100003485 Ga0075430_1000034859 191
197 3300006846 Ga0075430_100277985 Ga0075430_1002779852 191
198 3300006847 Ga0075431_100210940 Ga0075431_1002109401 191
199 3300006880 Ga0075429_100097839 Ga0075429_1000978391 191
200 3300009147 Ga0114129_10067912 Ga0114129_100679125 191
201 3300027395 Ga0209996_1010785 Ga0209996_10107852 191
202 3300027543 Ga0209999_1003859 Ga0209999_10038592 191
203 3300027665 Ga0209983_1041901 Ga0209983_10419011 191
204 3300027876 Ga0209974_10035372 Ga0209974_100353722 191
205 3300031548 Ga0307408_100543706 Ga0307408_1005437061 191
206 3300031903 Ga0307407_10098675 Ga0307407_100986752 191
207 3300032002 Ga0307416_100347935 Ga0307416_1003479352 191
208 3300041408 Ga0439453_0000656 Ga0439453_0000656_1884_2498 191
209 3300042001 Ga0439441_000395 Ga0439441_000395_1601_2215 191
210 3300042013 Ga0439456_030392 Ga0439456_030392_285_899 191
211 3300042437 Ga0439444_0003720 Ga0439444_0003720_205_819 191
212 3300042461 Ga0439460_0002711 Ga0439460_0002711_2604_3218 191
213 3300046528 Ga0495642_0075626 Ga0495642_0075626_133_747 191
214 3300049515 Ga0501292_045736 Ga0501292_045736_133_756 191
215 3300049575 Ga0501039_0331892 Ga0501039_0331892_133_732 191
216 3300049576 Ga0501040_0089937 Ga0501040_0089937_204_803 191
217 3300049577 Ga0501041_0060408 Ga0501041_0060408_442_1041 191
218 3300049578 Ga0501042_0561202 Ga0501042_0561202_55_654 191
219 3300049579 Ga0501043_0641212 Ga0501043_0641212_52_651 191
220 3300049824 Ga0501045_0108557 Ga0501045_0108557_1246_1845 191
221 3300050507 nmdc:mga05p37_38831_c1 nmdc:mga05p37_38831_c1_1694_2308 191
222 3300050509 nmdc:mga0qj67_2114_c1 nmdc:mga0qj67_2114_c1_2997_3611 191
223 3300049573 Ga0501037_0264364 Ga0501037_0264364_574_1185 195
224 3300049575 Ga0501039_0013115 Ga0501039_0013115_2545_3156 195
225 3300049577 Ga0501041_0206981 Ga0501041_0206981_583_1194 195
226 3300049579 Ga0501043_0332768 Ga0501043_0332768_319_930 195
227 3300049592 Ga0501076_0116551 Ga0501076_0116551_663_1274 195
228 3300049741 Ga0501079_0039583 Ga0501079_0039583_255_866 195
229 3300049743 Ga0501081_0169959 Ga0501081_0169959_809_1420 195
230 3300005334 Ga0068869_100041911 Ga0068869_1000419113 196
231 3300005336 Ga0070680_100010047 Ga0070680_1000100472 196
232 3300005336 Ga0070680_100058226 Ga0070680_1000582263 196
233 3300005340 Ga0070689_100272514 Ga0070689_1002725142 196
234 3300005341 Ga0070691_10065318 Ga0070691_100653182 196
235 3300005345 Ga0070692_10041953 Ga0070692_100419533 196
236 3300005347 Ga0070668_100090583 Ga0070668_1000905834 196
237 3300005354 Ga0070675_100031320 Ga0070675_1000313202 196
238 3300005356 Ga0070674_100064893 Ga0070674_1000648933 196
239 3300005364 Ga0070673_100452922 Ga0070673_1004529221 196
240 3300005364 Ga0070673_100482766 Ga0070673_1004827662 196
241 3300005438 Ga0070701_10457230 Ga0070701_104572301 196
242 3300005441 Ga0070700_100013789 Ga0070700_1000137892 196
243 3300005441 Ga0070700_100187575 Ga0070700_1001875752 196
244 3300005444 Ga0070694_100018420 Ga0070694_1000184206 196
245 3300005456 Ga0070678_100895891 Ga0070678_1008958911 196
246 3300005457 Ga0070662_100496118 Ga0070662_1004961181 196
247 3300005459 Ga0068867_100002232 Ga0068867_1000022323 196
248 3300005543 Ga0070672_100449523 Ga0070672_1004495232 196
249 3300005545 Ga0070695_100018622 Ga0070695_1000186223 196
250 3300005549 Ga0070704_100002202 Ga0070704_1000022027 196
251 3300005549 Ga0070704_100232172 Ga0070704_1002321722 196
252 3300005719 Ga0068861_100026879 Ga0068861_1000268794 196
253 3300005719 Ga0068861_100203647 Ga0068861_1002036472 196
254 3300005840 Ga0068870_10069528 Ga0068870_100695282 196
255 3300005840 Ga0068870_10213969 Ga0068870_102139692 196
256 3300005844 Ga0068862_100017502 Ga0068862_1000175022 196
257 3300006847 Ga0075431_100699382 Ga0075431_1006993822 196
258 3300006881 Ga0068865_100256776 Ga0068865_1002567762 196
259 3300009094 Ga0111539_10349145 Ga0111539_103491452 196
260 3300009147 Ga0114129_10711807 Ga0114129_107118072 196
261 3300009553 Ga0105249_10006734 Ga0105249_100067346 196
262 3300013306 Ga0163162_10212226 Ga0163162_102122262 196
263 3300013308 Ga0157375_10625632 Ga0157375_106256321 196
264 3300014326 Ga0157380_10004851 Ga0157380_100048513 196
265 3300014745 Ga0157377_10137880 Ga0157377_101378801 196
266 3300025908 Ga0207643_10008266 Ga0207643_100082664 196
267 3300025908 Ga0207643_10199462 Ga0207643_101994622 196
268 3300025917 Ga0207660_10022162 Ga0207660_100221626 196
269 3300025917 Ga0207660_10279807 Ga0207660_102798072 196
270 3300025926 Ga0207659_10028115 Ga0207659_100281153 196
271 3300025933 Ga0207706_10050248 Ga0207706_100502485 196
272 3300025935 Ga0207709_10019131 Ga0207709_100191312 196
273 3300025937 Ga0207669_10374392 Ga0207669_103743922 196
274 3300025938 Ga0207704_10009561 Ga0207704_100095616 196
275 3300025940 Ga0207691_10149497 Ga0207691_101494972 196
276 3300025942 Ga0207689_10024495 Ga0207689_100244953 196
277 3300025961 Ga0207712_10005266 Ga0207712_100052663 196
278 3300025972 Ga0207668_10049704 Ga0207668_100497042 196
279 3300026075 Ga0207708_10006893 Ga0207708_100068938 196
280 3300026075 Ga0207708_10454295 Ga0207708_104542952 196
281 3300026089 Ga0207648_10002662 Ga0207648_1000266217 196
282 3300026118 Ga0207675_100010009 Ga0207675_1000100093 196
283 3300026118 Ga0207675_100285144 Ga0207675_1002851442 196
284 3300026121 Ga0207683_10595060 Ga0207683_105950602 196
285 3300026121 Ga0207683_10632662 Ga0207683_106326622 196
286 3300027907 Ga0207428_10050086 Ga0207428_100500862 196
287 3300027907 Ga0207428_10434310 Ga0207428_104343102 196
288 3300028380 Ga0268265_10001132 Ga0268265_1000113212 196
289 3300028380 Ga0268265_10224432 Ga0268265_102244322 196
290 3300028380 Ga0268265_10312513 Ga0268265_103125132 196
291 3300050507 nmdc:mga05p37_531766_c1 nmdc:mga05p37_531766_c1_255_893 196
292 3300050507 nmdc:mga05p37_718779_c1 nmdc:mga05p37_718779_c1_184_813 196
293 3300050508 nmdc:mga09592_681896_c1 nmdc:mga09592_681896_c1_160_774 196
294 3300050509 nmdc:mga0qj67_199328_c1 nmdc:mga0qj67_199328_c1_893_1507 196
295 3300050511 nmdc:mga08y16_287966_c1 nmdc:mga08y16_287966_c1_534_1163 196
296 3300050511 nmdc:mga08y16_404940_c1 nmdc:mga08y16_404940_c1_569_1198 196
297 3300050511 nmdc:mga08y16_621086_c1 nmdc:mga08y16_621086_c1_329_958 196
298 3300050511 nmdc:mga08y16_82757_c1 nmdc:mga08y16_82757_c1_2642_3271 196

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aou-assembly1.cif.gz_A-2 ctidh bound to nadp. the complex structures of isocitrate dehydrogenase from clostridium thermocellum and desulfotalea psychrophila, support a new active site locking mechanism 0.6099 72 144
1ni5-assembly1.cif.gz_A-2 structure of the mesj pp-atpase from escherichia coli 0.6086 2 152
1cnz-assembly1.cif.gz_B 3-isopropylmalate dehydrogenase (ipmdh) from salmonella typhimurium 0.6086 78 144
6xxy-assembly1.cif.gz_B crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. 0.5807 78 140
1g2u-assembly1.cif.gz_A-2 the structure of the mutant, a172v, of 3-isopropylmalate dehydrogenase from thermus thermophilus hb8 : its thermostability and structure. 0.5802 78 152
ID Description Score Start End Superfamily
af_Q54SV7_3_143_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6735 4 106 3.40.50.620
af_Q4E0P7_114_265_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.6667 76 142 3.40.718.10
1ni5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6121 2 152 3.40.50.620
af_Q54IX1_146_387_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.5808 9 87 3.90.550.10
af_P23797_57_301_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.551 6 140 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A536YAH0-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.8637 1 193 GO:0008616
AF-A0A1W2G9Q3-F1-model_v4 PP-loop family protein 0.8407 1 168
AF-A0A536YAH0-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.8315 1 193 GO:0008616
AF-A0A2E2T9B6-F1-model_v4 7-cyano-7-deazaguanine synthase 0.8245 2 168
AF-A0A363SFE4-F1-model_v4 7-cyano-7-deazaguanine synthase 0.8225 1 187

Feature Viewer

pLDDT pTM Quality
76.33 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map