F394177

General Info

Members Datasets Scaffolds Average Seq Length
298 177 596 177

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10029700|Ga0081455_100297006
Length 191
Sequence MSQHESWHWTYETATRTLKGMTATQIRPADRLSSLVAGIRTAIDAHADWAETAQLVAEQLRRHLPTPDDVLTAEQQLGSPDDYVGHTLHVEPDGSFSIVGLVWRPGQITRIHDHVTWCTFGVIQGVEHEELFDADLNLIGRSANHVGDVSGFAPPGDIHRVHNTADETAISIHVYGTDVTRVGSSARRYYD

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
101 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
102 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.41
Rhizosphere 88.59
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10029700 3300005937 Bacteria 4981
2 JGI24743J22301_10029302 3300001991 Bacteria 1080
3 JGI25406J46586_10040345 3300003203 Bacteria 1656
4 Ga0070683_100239020 3300005329 Bacteria 1727
5 Ga0070683_101144442 3300005329 Bacteria 748
6 Ga0070682_100242402 3300005337 Bacteria 1295
7 Ga0068868_100058777 3300005338 Bacteria 3040
8 Ga0068868_101221831 3300005338 Bacteria 696
9 Ga0070689_100051603 3300005340 Bacteria 3180
10 Ga0070687_100550282 3300005343 Bacteria 785
11 Ga0070688_100081116 3300005365 Bacteria 2100
12 Ga0070714_100017169 3300005435 Bacteria 5860
13 Ga0070701_10023961 3300005438 Bacteria 2947
14 Ga0070705_100056301 3300005440 Bacteria 2315
15 Ga0070700_100369071 3300005441 Bacteria 1070
16 Ga0070662_101557870 3300005457 Unclassified 570
17 Ga0068867_100606157 3300005459 Bacteria 955
18 Ga0070685_10003535 3300005466 Bacteria 7935
19 Ga0070684_100513345 3300005535 Bacteria 1110
20 Ga0070697_100873628 3300005536 Bacteria 797
21 Ga0070686_100014678 3300005544 Bacteria 4519
22 Ga0070696_100415773 3300005546 Bacteria 1055
23 Ga0070665_100004500 3300005548 Bacteria 14627
24 Ga0070665_100183061 3300005548 Bacteria 2096
25 Ga0070664_100086798 3300005564 Bacteria 2704
26 Ga0068857_100375748 3300005577 Bacteria 1319
27 Ga0068857_100525962 3300005577 Bacteria 1112
28 Ga0068854_100597663 3300005578 Bacteria 942
29 Ga0068856_100119744 3300005614 Bacteria 2634
30 Ga0068856_100305963 3300005614 Bacteria 1607
31 Ga0070702_100041629 3300005615 Bacteria 2578
32 Ga0070702_100168374 3300005615 Bacteria 1423
33 Ga0068852_100084381 3300005616 Bacteria 2827
34 Ga0068859_100272796 3300005617 Bacteria 1784
35 Ga0068864_101049172 3300005618 Bacteria 810
36 Ga0068861_101440916 3300005719 Bacteria 674
37 Ga0081455_10313744 3300005937 Bacteria 1120
38 Ga0081538_10007675 3300005981 Bacteria 9300
39 Ga0081538_10290283 3300005981 Bacteria 604
40 Ga0081539_10001609 3300005985 Bacteria 37152
41 Ga0070717_10117971 3300006028 Bacteria 2270
42 Ga0068871_101063407 3300006358 Bacteria 756
43 Ga0075428_100169480 3300006844 Bacteria 2367
44 Ga0075430_100028903 3300006846 Bacteria 4707
45 Ga0075429_100096447 3300006880 Bacteria 2579
46 Ga0068865_100364922 3300006881 Bacteria 1174
47 Ga0068865_100508059 3300006881 Bacteria 1006
48 Ga0097620_100272776 3300006931 Bacteria 1784
49 Ga0111539_10052304 3300009094 Bacteria 4862
50 Ga0105245_10006706 3300009098 Bacteria 10099
51 Ga0105245_10948602 3300009098 Bacteria 903
52 Ga0105247_10190097 3300009101 Bacteria 1374
53 Ga0114129_11651078 3300009147 Bacteria 783
54 Ga0114129_12479844 3300009147 Bacteria 620
55 Ga0105243_10010871 3300009148 Bacteria 6886
56 Ga0105243_10945931 3300009148 Bacteria 860
57 Ga0105243_12252497 3300009148 Bacteria 582
58 Ga0105242_10315628 3300009176 Bacteria 1432
59 Ga0105242_10962741 3300009176 Bacteria 858
60 Ga0105248_10413992 3300009177 Bacteria 1518
61 Ga0105238_10270045 3300009551 Bacteria 1681
62 Ga0105249_10041735 3300009553 Bacteria 4171
63 Ga0105239_10872651 3300010375 Bacteria 1032
64 Ga0105239_11568123 3300010375 Bacteria 761
65 Ga0105246_10263028 3300011119 Bacteria 1375
66 Ga0157319_1032895 3300012497 Bacteria 570
67 Ga0157372_10464134 3300013307 Bacteria 1476
68 Ga0157375_10024885 3300013308 Bacteria 5549
69 Ga0157375_10487017 3300013308 Bacteria 1398
70 Ga0163163_10433273 3300014325 Bacteria 1374
71 Ga0163163_10512133 3300014325 Bacteria 1262
72 Ga0163163_11679769 3300014325 Bacteria 696
73 Ga0157380_10334600 3300014326 Bacteria 1409
74 Ga0157377_10832245 3300014745 Bacteria 683
75 Ga0157379_10442962 3300014968 Bacteria 1198
76 Ga0157379_10456623 3300014968 Bacteria 1180
77 Ga0157376_10346980 3300014969 Bacteria 1419
78 Ga0182005_1139812 3300015265 Bacteria 699
79 Ga0207642_10760230 3300025899 Bacteria 614
80 Ga0207680_10762393 3300025903 Bacteria 694
81 Ga0207647_10065346 3300025904 Bacteria 2208
82 Ga0207671_10234865 3300025914 Bacteria 1439
83 Ga0207660_10754574 3300025917 Bacteria 794
84 Ga0207687_10005717 3300025927 Bacteria 8228
85 Ga0207687_10280122 3300025927 Bacteria 1336
86 Ga0207664_10002381 3300025929 Bacteria 12433
87 Ga0207706_10759372 3300025933 Unclassified 826
88 Ga0207686_10290900 3300025934 Bacteria 1210
89 Ga0207709_10006581 3300025935 Bacteria 6523
90 Ga0207670_10056496 3300025936 Bacteria 2657
91 Ga0207704_10093479 3300025938 Bacteria 1982
92 Ga0207704_10636813 3300025938 Bacteria 877
93 Ga0207679_10213352 3300025945 Bacteria 1620
94 Ga0207679_10311586 3300025945 Bacteria 1360
95 Ga0207712_10022598 3300025961 Bacteria 4143
96 Ga0207640_10036761 3300025981 Bacteria 3077
97 Ga0207640_10288955 3300025981 Bacteria 1292
98 Ga0207677_10002048 3300026023 Bacteria 10630
99 Ga0207677_11143099 3300026023 Bacteria 711
100 Ga0207639_11323549 3300026041 Bacteria 676
101 Ga0207678_10578277 3300026067 Bacteria 984
102 Ga0207708_10108776 3300026075 Bacteria 2150
103 Ga0207708_10622874 3300026075 Bacteria 916
104 Ga0207648_10187119 3300026089 Bacteria 1834
105 Ga0207648_10368498 3300026089 Bacteria 1297
106 Ga0207676_10150424 3300026095 Bacteria 2004
107 Ga0207676_10471865 3300026095 Bacteria 1187
108 Ga0207674_10294364 3300026116 Bacteria 1572
109 Ga0207683_10236439 3300026121 Bacteria 1666
110 Ga0207683_10659837 3300026121 Bacteria 969
111 Ga0207698_10552804 3300026142 Bacteria 1128
112 Ga0207698_10686730 3300026142 Bacteria 1017
113 Ga0207428_10174430 3300027907 Bacteria 1627
114 Ga0207428_10176527 3300027907 Bacteria 1615
115 Ga0268266_10045877 3300028379 Bacteria 3740
116 Ga0268266_11150946 3300028379 Bacteria 750
117 Ga0268265_10081674 3300028380 Bacteria 2553
118 Ga0307408_100057207 3300031548 Bacteria 2830
119 Ga0307405_10206018 3300031731 Bacteria 1432
120 Ga0307405_10308332 3300031731 Bacteria 1204
121 Ga0307405_11140087 3300031731 Bacteria 672
122 Ga0307413_10695021 3300031824 Bacteria 844
123 Ga0307406_10057147 3300031901 Bacteria 2502
124 Ga0307406_10295095 3300031901 Bacteria 1243
125 Ga0307407_10310901 3300031903 Bacteria 1102
126 Ga0307407_10341780 3300031903 Bacteria 1057
127 Ga0307409_100254234 3300031995 Bacteria 1608
128 Ga0307409_100291177 3300031995 Bacteria 1514
129 Ga0307409_100357064 3300031995 Bacteria 1381
130 Ga0307409_100744476 3300031995 Bacteria 983
131 Ga0307416_100403025 3300032002 Bacteria 1406
132 Ga0307416_100496390 3300032002 Bacteria 1284
133 Ga0307416_100569408 3300032002 Bacteria 1208
134 Ga0307416_100634836 3300032002 Bacteria 1151
135 Ga0307416_101333495 3300032002 Bacteria 823
136 Ga0307416_101664357 3300032002 Bacteria 743
137 Ga0307415_100000178 3300032126 Bacteria 28406
138 Ga0307415_100209008 3300032126 Bacteria 1555
139 Ga0307415_101020823 3300032126 Bacteria 770
140 Ga0373949_0039424 3300035090 Bacteria 1157
141 Ga0395900_0130764 3300037418 Bacteria 2573
142 Ga0395898_0020264 3300037466 Bacteria 6755
143 Ga0395898_0795223 3300037466 Bacteria 886
144 Ga0395901_0028154 3300038443 Bacteria 5780
145 Ga0395901_0518234 3300038443 Bacteria 1212
146 Ga0451791_0490872 3300041451 Bacteria 1108
147 Ga0451793_1868373 3300041452 Bacteria 1107
148 Ga0451802_0396347 3300041460 Bacteria 1009
149 Ga0439464_0244048 3300042439 Bacteria 579
150 Ga0466965_0031759 3300044683 Bacteria 2576
151 Ga0466963_0001654 3300044694 Bacteria 12147
152 Ga0466963_0073811 3300044694 Bacteria 2300
153 Ga0466963_0214564 3300044694 Bacteria 1347
154 Ga0466964_0030274 3300044706 Bacteria 2141
155 Ga0466964_0146840 3300044706 Bacteria 1089
156 Ga0466971_0033097 3300044719 Bacteria 2317
157 Ga0466957_0009158 3300044842 Bacteria 5648
158 Ga0466960_0091555 3300044901 Bacteria 1551
159 Ga0466958_0207794 3300045836 Bacteria 1247
160 Ga0466967_0350589 3300045976 Bacteria 1428
161 Ga0466967_0553412 3300045976 Bacteria 1132
162 Ga0466967_0682617 3300045976 Bacteria 1017
163 Ga0495641_0075525 3300046461 Bacteria 1511
164 Ga0495585_0065779 3300046492 Bacteria 1986
165 Ga0495620_0087173 3300046515 Bacteria 1256
166 Ga0495631_0220454 3300046518 Bacteria 810
167 Ga0495643_0412598 3300046522 Bacteria 594
168 Ga0495644_0196124 3300046523 Bacteria 778
169 Ga0495658_0725904 3300046683 Bacteria 636
170 Ga0495671_0358878 3300046692 Bacteria 699
171 Ga0495672_0025502 3300047320 Bacteria 3782
172 Ga0495676_0173076 3300047321 Bacteria 1518
173 Ga0495626_0108436 3300048091 Bacteria 1205
174 Ga0496100_0129353 3300048903 Bacteria 1777
175 Ga0496100_0148146 3300048903 Bacteria 1671
176 Ga0496101_0095811 3300048904 Bacteria 2214
177 Ga0496101_0104270 3300048904 Bacteria 2127
178 Ga0496102_0027899 3300048905 Bacteria 5043
179 Ga0496102_0575542 3300048905 Bacteria 1049
180 Ga0496102_0837042 3300048905 Bacteria 842
181 Ga0496103_0432434 3300048906 Bacteria 845
182 Ga0496104_0583625 3300048907 Bacteria 1028
183 Ga0496104_0955624 3300048907 Bacteria 761
184 Ga0496106_0067761 3300048909 Bacteria 2721
185 Ga0496106_0178618 3300048909 Bacteria 1685
186 Ga0496107_0132525 3300048910 Bacteria 1840
187 Ga0496107_0993337 3300048910 Bacteria 609
188 Ga0496108_0010966 3300048911 Bacteria 7360
189 Ga0496108_0188461 3300048911 Bacteria 1787
190 Ga0496108_0259167 3300048911 Bacteria 1513
191 Ga0496108_0294566 3300048911 Bacteria 1413
192 Ga0496109_0027986 3300048912 Bacteria 5039
193 Ga0496109_0097058 3300048912 Bacteria 2731
194 Ga0496109_0238567 3300048912 Bacteria 1711
195 Ga0496109_1151080 3300048912 Bacteria 713
196 Ga0496110_0064422 3300048913 Bacteria 3239
197 Ga0496110_0954252 3300048913 Unclassified 764
198 Ga0496111_0032701 3300048914 Bacteria 3709
199 Ga0496111_0080385 3300048914 Bacteria 2378
200 Ga0496112_0072335 3300048915 Bacteria 3408
201 Ga0496112_0428416 3300048915 Bacteria 1261
202 Ga0496113_0123348 3300048916 Bacteria 2027
203 Ga0496113_0614124 3300048916 Bacteria 870
204 Ga0496115_0145681 3300048918 Bacteria 1955
205 Ga0501031_0023083 3300049568 Bacteria 4057
206 Ga0501031_0168737 3300049568 Bacteria 1430
207 Ga0501031_0385438 3300049568 Bacteria 907
208 Ga0501032_0133388 3300049569 Bacteria 1637
209 Ga0501033_0088442 3300049570 Bacteria 2266
210 Ga0501034_0014036 3300049571 Bacteria 8249
211 Ga0501036_0224437 3300049572 Bacteria 1577
212 Ga0501036_0607907 3300049572 Bacteria 906
213 Ga0501036_0744946 3300049572 Bacteria 808
214 Ga0501037_0314299 3300049573 Bacteria 1085
215 Ga0501037_0522000 3300049573 Bacteria 804
216 Ga0501038_0050933 3300049574 Bacteria 3576
217 Ga0501038_0442216 3300049574 Bacteria 1001
218 Ga0501039_0007768 3300049575 Bacteria 8181
219 Ga0501039_0020924 3300049575 Bacteria 5017
220 Ga0501039_0101719 3300049575 Bacteria 2243
221 Ga0501039_0233347 3300049575 Bacteria 1446
222 Ga0501039_0389752 3300049575 Bacteria 1094
223 Ga0501041_0137753 3300049577 Bacteria 1521
224 Ga0501041_0215784 3300049577 Bacteria 1204
225 Ga0501041_0326231 3300049577 Bacteria 969
226 Ga0501042_0040416 3300049578 Bacteria 3316
227 Ga0501042_0074566 3300049578 Bacteria 2428
228 Ga0501042_0753343 3300049578 Bacteria 708
229 Ga0501043_0020843 3300049579 Bacteria 5141
230 Ga0501046_0466819 3300049580 Bacteria 906
231 Ga0501046_0476923 3300049580 Bacteria 895
232 Ga0501047_0116008 3300049581 Bacteria 2560
233 Ga0501047_0363525 3300049581 Bacteria 1282
234 Ga0501048_0102243 3300049582 Bacteria 2022
235 Ga0501048_0290024 3300049582 Bacteria 1164
236 Ga0501048_0557777 3300049582 Bacteria 822
237 Ga0501067_0011257 3300049583 Bacteria 4951
238 Ga0501067_0088318 3300049583 Bacteria 1720
239 Ga0501067_0142568 3300049583 Bacteria 1334
240 Ga0501068_0010706 3300049584 Bacteria 5156
241 Ga0501069_0147810 3300049585 Bacteria 1349
242 Ga0501070_0233291 3300049586 Bacteria 1507
243 Ga0501070_0264497 3300049586 Bacteria 1405
244 Ga0501070_0405864 3300049586 Bacteria 1102
245 Ga0501070_0429347 3300049586 Bacteria 1066
246 Ga0501071_0004136 3300049587 Bacteria 9171
247 Ga0501071_0169561 3300049587 Bacteria 1634
248 Ga0501071_0354514 3300049587 Bacteria 1117
249 Ga0501071_0383684 3300049587 Bacteria 1072
250 Ga0501072_0059975 3300049588 Bacteria 3000
251 Ga0501072_0100866 3300049588 Bacteria 2294
252 Ga0501072_0144018 3300049588 Bacteria 1900
253 Ga0501072_0312313 3300049588 Bacteria 1249
254 Ga0501073_0062499 3300049589 Bacteria 2597
255 Ga0501073_0063426 3300049589 Bacteria 2577
256 Ga0501073_0110971 3300049589 Bacteria 1902
257 Ga0501074_0037251 3300049590 Bacteria 3526
258 Ga0501074_0108580 3300049590 Bacteria 1986
259 Ga0501074_0145883 3300049590 Bacteria 1692
260 Ga0501074_0202877 3300049590 Bacteria 1413
261 Ga0501075_0069173 3300049591 Bacteria 2668
262 Ga0501075_1028679 3300049591 Bacteria 626
263 Ga0501076_0053331 3300049592 Bacteria 3204
264 Ga0501076_0157889 3300049592 Bacteria 1847
265 Ga0501076_0294233 3300049592 Bacteria 1330
266 Ga0501077_0012166 3300049593 Bacteria 5386
267 Ga0501077_0058433 3300049593 Bacteria 2448
268 Ga0501079_0365787 3300049741 Bacteria 1130
269 Ga0501079_0614647 3300049741 Bacteria 855
270 Ga0501080_0042784 3300049742 Bacteria 4217
271 Ga0501080_0226303 3300049742 Bacteria 1710
272 Ga0501081_0119403 3300049743 Bacteria 1876
273 Ga0501083_0126771 3300049744 Bacteria 1673
274 Ga0501083_0169508 3300049744 Bacteria 1427
275 Ga0501083_0193199 3300049744 Bacteria 1328
276 Ga0501035_0076002 3300049822 Bacteria 2970
277 Ga0501035_0364160 3300049822 Bacteria 1208
278 Ga0501035_0807125 3300049822 Bacteria 749
279 Ga0501044_0145344 3300049823 Bacteria 2357
280 Ga0501045_0147030 3300049824 Bacteria 1753
281 Ga0501045_0639972 3300049824 Bacteria 786
282 nmdc:mga09592_250842_c1 3300050508 Bacteria 1534
283 nmdc:mga0qj67_33539_c1 3300050509 Bacteria 4007
284 nmdc:mga06r32_21778_c1 3300050510 Bacteria 5917
285 nmdc:mga08y16_116355_c1 3300050511 Bacteria 2783
286 nmdc:mga0a205_840239_c1 3300050515 Bacteria 765
287 Ga0495655_0013586 3300053083 Bacteria 1688
288 Ga0501084_0011337 3300054114 Bacteria 7383
289 Ga0501084_0212542 3300054114 Bacteria 1632
290 Ga0501084_0448893 3300054114 Bacteria 1090
291 Ga0501082_0070930 3300060353 Bacteria 3000
292 Ga0501082_0161400 3300060353 Bacteria 1948
293 Ga0501082_0325378 3300060353 Bacteria 1339
294 Ga0501082_0401634 3300060353 Bacteria 1196
295 Ga0501082_0438796 3300060353 Bacteria 1140
296 Ga0501082_0988254 3300060353 Bacteria 736
297 Ga0466962_0078000 3300061719 Bacteria 1584
298 Ga0530510_0551008 3300061734 Bacteria 876
299 Ga0081455_10029700
300 JGI24743J22301_10029302
301 JGI25406J46586_10040345
302 Ga0070683_100239020
303 Ga0070683_101144442
304 Ga0070682_100242402
305 Ga0068868_100058777
306 Ga0068868_101221831
307 Ga0070689_100051603
308 Ga0070687_100550282
309 Ga0070688_100081116
310 Ga0070714_100017169
311 Ga0070701_10023961
312 Ga0070705_100056301
313 Ga0070700_100369071
314 Ga0070662_101557870
315 Ga0068867_100606157
316 Ga0070685_10003535
317 Ga0070684_100513345
318 Ga0070697_100873628
319 Ga0070686_100014678
320 Ga0070696_100415773
321 Ga0070665_100004500
322 Ga0070665_100183061
323 Ga0070664_100086798
324 Ga0068857_100375748
325 Ga0068857_100525962
326 Ga0068854_100597663
327 Ga0068856_100119744
328 Ga0068856_100305963
329 Ga0070702_100041629
330 Ga0070702_100168374
331 Ga0068852_100084381
332 Ga0068859_100272796
333 Ga0068864_101049172
334 Ga0068861_101440916
335 Ga0081455_10313744
336 Ga0081538_10007675
337 Ga0081538_10290283
338 Ga0081539_10001609
339 Ga0070717_10117971
340 Ga0068871_101063407
341 Ga0075428_100169480
342 Ga0075430_100028903
343 Ga0075429_100096447
344 Ga0068865_100364922
345 Ga0068865_100508059
346 Ga0097620_100272776
347 Ga0111539_10052304
348 Ga0105245_10006706
349 Ga0105245_10948602
350 Ga0105247_10190097
351 Ga0114129_11651078
352 Ga0114129_12479844
353 Ga0105243_10010871
354 Ga0105243_10945931
355 Ga0105243_12252497
356 Ga0105242_10315628
357 Ga0105242_10962741
358 Ga0105248_10413992
359 Ga0105238_10270045
360 Ga0105249_10041735
361 Ga0105239_10872651
362 Ga0105239_11568123
363 Ga0105246_10263028
364 Ga0157319_1032895
365 Ga0157372_10464134
366 Ga0157375_10024885
367 Ga0157375_10487017
368 Ga0163163_10433273
369 Ga0163163_10512133
370 Ga0163163_11679769
371 Ga0157380_10334600
372 Ga0157377_10832245
373 Ga0157379_10442962
374 Ga0157379_10456623
375 Ga0157376_10346980
376 Ga0182005_1139812
377 Ga0207642_10760230
378 Ga0207680_10762393
379 Ga0207647_10065346
380 Ga0207671_10234865
381 Ga0207660_10754574
382 Ga0207687_10005717
383 Ga0207687_10280122
384 Ga0207664_10002381
385 Ga0207706_10759372
386 Ga0207686_10290900
387 Ga0207709_10006581
388 Ga0207670_10056496
389 Ga0207704_10093479
390 Ga0207704_10636813
391 Ga0207679_10213352
392 Ga0207679_10311586
393 Ga0207712_10022598
394 Ga0207640_10036761
395 Ga0207640_10288955
396 Ga0207677_10002048
397 Ga0207677_11143099
398 Ga0207639_11323549
399 Ga0207678_10578277
400 Ga0207708_10108776
401 Ga0207708_10622874
402 Ga0207648_10187119
403 Ga0207648_10368498
404 Ga0207676_10150424
405 Ga0207676_10471865
406 Ga0207674_10294364
407 Ga0207683_10236439
408 Ga0207683_10659837
409 Ga0207698_10552804
410 Ga0207698_10686730
411 Ga0207428_10174430
412 Ga0207428_10176527
413 Ga0268266_10045877
414 Ga0268266_11150946
415 Ga0268265_10081674
416 Ga0307408_100057207
417 Ga0307405_10206018
418 Ga0307405_10308332
419 Ga0307405_11140087
420 Ga0307413_10695021
421 Ga0307406_10057147
422 Ga0307406_10295095
423 Ga0307407_10310901
424 Ga0307407_10341780
425 Ga0307409_100254234
426 Ga0307409_100291177
427 Ga0307409_100357064
428 Ga0307409_100744476
429 Ga0307416_100403025
430 Ga0307416_100496390
431 Ga0307416_100569408
432 Ga0307416_100634836
433 Ga0307416_101333495
434 Ga0307416_101664357
435 Ga0307415_100000178
436 Ga0307415_100209008
437 Ga0307415_101020823
438 Ga0373949_0039424
439 Ga0395900_0130764
440 Ga0395898_0020264
441 Ga0395898_0795223
442 Ga0395901_0028154
443 Ga0395901_0518234
444 Ga0451791_0490872
445 Ga0451793_1868373
446 Ga0451802_0396347
447 Ga0439464_0244048
448 Ga0466965_0031759
449 Ga0466963_0001654
450 Ga0466963_0073811
451 Ga0466963_0214564
452 Ga0466964_0030274
453 Ga0466964_0146840
454 Ga0466971_0033097
455 Ga0466957_0009158
456 Ga0466960_0091555
457 Ga0466958_0207794
458 Ga0466967_0350589
459 Ga0466967_0553412
460 Ga0466967_0682617
461 Ga0495641_0075525
462 Ga0495585_0065779
463 Ga0495620_0087173
464 Ga0495631_0220454
465 Ga0495643_0412598
466 Ga0495644_0196124
467 Ga0495658_0725904
468 Ga0495671_0358878
469 Ga0495672_0025502
470 Ga0495676_0173076
471 Ga0495626_0108436
472 Ga0496100_0129353
473 Ga0496100_0148146
474 Ga0496101_0095811
475 Ga0496101_0104270
476 Ga0496102_0027899
477 Ga0496102_0575542
478 Ga0496102_0837042
479 Ga0496103_0432434
480 Ga0496104_0583625
481 Ga0496104_0955624
482 Ga0496106_0067761
483 Ga0496106_0178618
484 Ga0496107_0132525
485 Ga0496107_0993337
486 Ga0496108_0010966
487 Ga0496108_0188461
488 Ga0496108_0259167
489 Ga0496108_0294566
490 Ga0496109_0027986
491 Ga0496109_0097058
492 Ga0496109_0238567
493 Ga0496109_1151080
494 Ga0496110_0064422
495 Ga0496110_0954252
496 Ga0496111_0032701
497 Ga0496111_0080385
498 Ga0496112_0072335
499 Ga0496112_0428416
500 Ga0496113_0123348
501 Ga0496113_0614124
502 Ga0496115_0145681
503 Ga0501031_0023083
504 Ga0501031_0168737
505 Ga0501031_0385438
506 Ga0501032_0133388
507 Ga0501033_0088442
508 Ga0501034_0014036
509 Ga0501036_0224437
510 Ga0501036_0607907
511 Ga0501036_0744946
512 Ga0501037_0314299
513 Ga0501037_0522000
514 Ga0501038_0050933
515 Ga0501038_0442216
516 Ga0501039_0007768
517 Ga0501039_0020924
518 Ga0501039_0101719
519 Ga0501039_0233347
520 Ga0501039_0389752
521 Ga0501041_0137753
522 Ga0501041_0215784
523 Ga0501041_0326231
524 Ga0501042_0040416
525 Ga0501042_0074566
526 Ga0501042_0753343
527 Ga0501043_0020843
528 Ga0501046_0466819
529 Ga0501046_0476923
530 Ga0501047_0116008
531 Ga0501047_0363525
532 Ga0501048_0102243
533 Ga0501048_0290024
534 Ga0501048_0557777
535 Ga0501067_0011257
536 Ga0501067_0088318
537 Ga0501067_0142568
538 Ga0501068_0010706
539 Ga0501069_0147810
540 Ga0501070_0233291
541 Ga0501070_0264497
542 Ga0501070_0405864
543 Ga0501070_0429347
544 Ga0501071_0004136
545 Ga0501071_0169561
546 Ga0501071_0354514
547 Ga0501071_0383684
548 Ga0501072_0059975
549 Ga0501072_0100866
550 Ga0501072_0144018
551 Ga0501072_0312313
552 Ga0501073_0062499
553 Ga0501073_0063426
554 Ga0501073_0110971
555 Ga0501074_0037251
556 Ga0501074_0108580
557 Ga0501074_0145883
558 Ga0501074_0202877
559 Ga0501075_0069173
560 Ga0501075_1028679
561 Ga0501076_0053331
562 Ga0501076_0157889
563 Ga0501076_0294233
564 Ga0501077_0012166
565 Ga0501077_0058433
566 Ga0501079_0365787
567 Ga0501079_0614647
568 Ga0501080_0042784
569 Ga0501080_0226303
570 Ga0501081_0119403
571 Ga0501083_0126771
572 Ga0501083_0169508
573 Ga0501083_0193199
574 Ga0501035_0076002
575 Ga0501035_0364160
576 Ga0501035_0807125
577 Ga0501044_0145344
578 Ga0501045_0147030
579 Ga0501045_0639972
580 nmdc:mga09592_250842_c1
581 nmdc:mga0qj67_33539_c1
582 nmdc:mga06r32_21778_c1
583 nmdc:mga08y16_116355_c1
584 nmdc:mga0a205_840239_c1
585 Ga0495655_0013586
586 Ga0501084_0011337
587 Ga0501084_0212542
588 Ga0501084_0448893
589 Ga0501082_0070930
590 Ga0501082_0161400
591 Ga0501082_0325378
592 Ga0501082_0401634
593 Ga0501082_0438796
594 Ga0501082_0988254
595 Ga0466962_0078000
596 Ga0530510_0551008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05995

CDO_I

Cysteine dioxygenase type I

80

187

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xb9-assembly1.cif.gz_F-2 crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with 3-hydroxypropionic acid 0.9205 17 166
6xb9-assembly6.cif.gz_L crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with 3-hydroxypropionic acid 0.9191 17 166
4wvz-assembly2.cif.gz_B crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa 0.9029 17 166
5fpz-assembly1.cif.gz_A-2 the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. 0.8945 69 165
8awp-assembly1.cif.gz_A crystal structure of a manganese-containing cupin (tm1459) from thermotoga maritima, variant 208 (v19i/r23h/m38i/i60f/c106q) 0.8919 69 161
ID Description Score Start End Superfamily
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8926 70 161 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8906 68 165 2.60.120.10
2oa2A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8891 72 164 2.60.120.10
5j7mB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8831 82 161 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8818 69 161 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4V3FJT7-F1-model_v4 Putative metal-dependent enzyme (Double-stranded beta helix superfamily) 0.9717 21 178 GO:0008198
GO:0016702
AF-A0A4R6KI60-F1-model_v4 Cysteine dioxygenase type I 0.9698 16 178 GO:0008198
GO:0016702
AF-A0A6N7IJ79-F1-model_v4 Cysteine dioxygenase 0.9648 21 178 GO:0008198
GO:0016702
AF-A0A7Y7NX41-F1-model_v4 Cysteine dioxygenase family protein 0.9597 83 161 GO:0008198
GO:0016702
AF-A0A4V3FJT7-F1-model_v4 Putative metal-dependent enzyme (Double-stranded beta helix superfamily) 0.9597 21 178 GO:0008198
GO:0016702

Map