F394064

General Info

Members Datasets Scaffolds Average Seq Length
298 191 596 175

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10000928|Ga0070666_1000092812
Length 201
Sequence MRGADVPSARFRCQAEIMSVDNTRIETARLLLRLPRREDFDAYAAMHADEEAARHIGGAMPRAAAWRKFLQMPGAWAMQGYAMFSVCDKITGEWLGQCGPWQPEGWPGTEVGWAFKRSVWGRGYAKEAATASIDWAFDSLGWSEVIHSINTENRASQALAQRLGSRILRQASLPPPYETVIVDVWGQSREEWRARRNGAGT

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
51 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
52 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
53 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
130 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
131 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
182 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
186 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
187 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
188 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
189 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
190 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
191 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 0.34
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 4.7
Rhizosphere 87.92
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10000928 3300005335 Bacteria 17790
2 Ga0070658_10525317 3300005327 Bacteria 1023
3 Ga0070683_100215649 3300005329 Bacteria 1824
4 Ga0070690_100461976 3300005330 Bacteria 943
5 Ga0070670_100279614 3300005331 Bacteria 1457
6 Ga0068869_100921535 3300005334 Bacteria 757
7 Ga0068869_101476733 3300005334 Unclassified 603
8 Ga0070660_100553656 3300005339 Bacteria 960
9 Ga0070661_100032541 3300005344 Bacteria 3775
10 Ga0070661_101090858 3300005344 Bacteria 665
11 Ga0070668_100351843 3300005347 Bacteria 1247
12 Ga0070669_101407185 3300005353 Bacteria 605
13 Ga0070671_100115958 3300005355 Bacteria 2252
14 Ga0070674_100806031 3300005356 Bacteria 811
15 Ga0070673_100070189 3300005364 Bacteria 2811
16 Ga0070659_100290019 3300005366 Bacteria 1363
17 Ga0070659_100563770 3300005366 Bacteria 976
18 Ga0070667_100082183 3300005367 Bacteria 2757
19 Ga0070667_100558211 3300005367 Bacteria 1053
20 Ga0070663_100552508 3300005455 Bacteria 963
21 Ga0070678_100806001 3300005456 Bacteria 853
22 Ga0070681_10471661 3300005458 Bacteria 1168
23 Ga0068867_100035403 3300005459 Bacteria 3621
24 Ga0070679_101069541 3300005530 Bacteria 751
25 Ga0068853_100029534 3300005539 Bacteria 4623
26 Ga0068853_100052944 3300005539 Bacteria 3495
27 Ga0068853_100215283 3300005539 Bacteria 1752
28 Ga0070672_100011174 3300005543 Bacteria 6255
29 Ga0068855_100285726 3300005563 Bacteria 1830
30 Ga0070664_100571669 3300005564 Bacteria 1047
31 Ga0068857_100541716 3300005577 Bacteria 1096
32 Ga0068857_100894489 3300005577 Bacteria 851
33 Ga0068854_100391265 3300005578 Bacteria 1148
34 Ga0068854_100537079 3300005578 Bacteria 990
35 Ga0068856_100006369 3300005614 Bacteria 11585
36 Ga0068856_100023844 3300005614 Bacteria 5951
37 Ga0070702_100301198 3300005615 Bacteria 1109
38 Ga0068852_100196295 3300005616 Bacteria 1907
39 Ga0068852_100619702 3300005616 Bacteria 1087
40 Ga0068859_100063934 3300005617 Bacteria 3712
41 Ga0068859_100327441 3300005617 Bacteria 1626
42 Ga0068864_100013277 3300005618 Bacteria 6823
43 Ga0068864_100059399 3300005618 Bacteria 3309
44 Ga0068864_100099978 3300005618 Unclassified 2570
45 Ga0068864_100233960 3300005618 Bacteria 1700
46 Ga0068851_10074566 3300005834 Bacteria 1762
47 Ga0068863_100001114 3300005841 Bacteria 26847
48 Ga0068863_100268798 3300005841 Bacteria 1650
49 Ga0068858_100195580 3300005842 Bacteria 1911
50 Ga0068858_100640396 3300005842 Bacteria 1033
51 Ga0068860_100020588 3300005843 Bacteria 6389
52 Ga0081455_10273738 3300005937 Bacteria 1223
53 Ga0075364_10005380 3300006051 Bacteria 7432
54 Ga0097621_100245035 3300006237 Bacteria 1568
55 Ga0068871_100086950 3300006358 Bacteria 2598
56 Ga0068865_100305784 3300006881 Bacteria 1274
57 Ga0097620_100063931 3300006931 Bacteria 3712
58 Ga0097620_100327441 3300006931 Bacteria 1626
59 Ga0105240_10245356 3300009093 Bacteria 2074
60 Ga0105240_10311257 3300009093 Bacteria 1798
61 Ga0105241_10045654 3300009174 Bacteria 3325
62 Ga0105242_10703666 3300009176 Bacteria 989
63 Ga0105248_10644483 3300009177 Bacteria 1195
64 Ga0105248_11188371 3300009177 Bacteria 862
65 Ga0105237_10026075 3300009545 Bacteria 5973
66 Ga0105237_10675082 3300009545 Bacteria 1040
67 Ga0105238_10005577 3300009551 Bacteria 12433
68 Ga0105238_10065444 3300009551 Bacteria 3636
69 Ga0105238_10118495 3300009551 Bacteria 2627
70 Ga0105238_10446942 3300009551 Unclassified 1289
71 Ga0105239_10165061 3300010375 Bacteria 2476
72 Ga0105239_10222918 3300010375 Bacteria 2115
73 Ga0105239_10225884 3300010375 Bacteria 2100
74 Ga0105239_10550888 3300010375 Bacteria 1313
75 Ga0105246_10125590 3300011119 Bacteria 1908
76 Ga0105246_10394699 3300011119 Bacteria 1147
77 Ga0157317_1003132 3300012475 Bacteria 1016
78 Ga0157335_1007499 3300012492 Bacteria 816
79 Ga0157316_1001551 3300012510 Bacteria 1443
80 Ga0157316_1041180 3300012510 Bacteria 603
81 Ga0157326_1037399 3300012513 Bacteria 668
82 Ga0157371_10238494 3300013102 Bacteria 1308
83 Ga0157371_10954696 3300013102 Bacteria 652
84 Ga0157370_10144855 3300013104 Bacteria 2212
85 Ga0157370_10233792 3300013104 Bacteria 1701
86 Ga0157370_10259528 3300013104 Bacteria 1606
87 Ga0157369_10016876 3300013105 Bacteria 8204
88 Ga0157369_10525173 3300013105 Bacteria 1224
89 Ga0157378_10000305 3300013297 Bacteria 47763
90 Ga0157378_10106062 3300013297 Bacteria 2570
91 Ga0157378_10181696 3300013297 Bacteria 1979
92 Ga0157372_10002274 3300013307 Bacteria 20817
93 Ga0157372_10200637 3300013307 Bacteria 2310
94 Ga0157372_11257431 3300013307 Bacteria 855
95 Ga0163163_10000601 3300014325 Bacteria 31448
96 Ga0163163_10014534 3300014325 Bacteria 7242
97 Ga0163163_11336456 3300014325 Bacteria 779
98 Ga0157379_10037463 3300014968 Bacteria 4324
99 Ga0157376_10082777 3300014969 Bacteria 2759
100 Ga0157376_10132935 3300014969 Bacteria 2223
101 Ga0163161_10260377 3300017792 Bacteria 1355
102 Ga0206356_11228493 3300020070 Bacteria 727
103 Ga0213876_10113225 3300021384 Bacteria 1440
104 Ga0209676_1004308 3300025292 Bacteria 8012
105 Ga0209676_1015185 3300025292 Bacteria 2847
106 Ga0209025_1105863 3300025294 Bacteria 877
107 Ga0209050_1013711 3300025298 Bacteria 3570
108 Ga0209256_1004463 3300025299 Bacteria 8757
109 Ga0207656_10071645 3300025321 Bacteria 1541
110 Ga0207680_10000745 3300025903 Bacteria 15334
111 Ga0207680_10468577 3300025903 Bacteria 895
112 Ga0207647_10000694 3300025904 Bacteria 26349
113 Ga0207705_10031194 3300025909 Bacteria 3802
114 Ga0207654_10000065 3300025911 Bacteria 69237
115 Ga0207654_10023709 3300025911 Bacteria 3291
116 Ga0207695_10001492 3300025913 Bacteria 39028
117 Ga0207671_10004418 3300025914 Bacteria 13469
118 Ga0207671_10286782 3300025914 Bacteria 1299
119 Ga0207657_10150533 3300025919 Bacteria 1896
120 Ga0207657_10291443 3300025919 Bacteria 1294
121 Ga0207649_10081629 3300025920 Bacteria 2094
122 Ga0207652_10550986 3300025921 Bacteria 1036
123 Ga0207652_10796174 3300025921 Bacteria 840
124 Ga0207694_10007965 3300025924 Bacteria 8009
125 Ga0207694_10104089 3300025924 Bacteria 2252
126 Ga0207694_10521005 3300025924 Bacteria 996
127 Ga0207650_10285675 3300025925 Bacteria 1344
128 Ga0207650_10781430 3300025925 Bacteria 809
129 Ga0207650_10821122 3300025925 Bacteria 788
130 Ga0207659_10318937 3300025926 Bacteria 1282
131 Ga0207687_10201040 3300025927 Bacteria 1557
132 Ga0207644_10091901 3300025931 Bacteria 2263
133 Ga0207690_10476816 3300025932 Bacteria 1006
134 Ga0207706_10371326 3300025933 Bacteria 1242
135 Ga0207709_10603640 3300025935 Bacteria 869
136 Ga0207669_10257061 3300025937 Bacteria 1304
137 Ga0207691_10036501 3300025940 Bacteria 4554
138 Ga0207689_10973001 3300025942 Bacteria 716
139 Ga0207667_10045764 3300025949 Bacteria 4633
140 Ga0207667_10189716 3300025949 Bacteria 2109
141 Ga0207651_10045815 3300025960 Bacteria 2936
142 Ga0207668_10266306 3300025972 Bacteria 1399
143 Ga0207640_10244063 3300025981 Bacteria 1390
144 Ga0207640_10645750 3300025981 Bacteria 901
145 Ga0207658_10195252 3300025986 Bacteria 1686
146 Ga0207703_10084900 3300026035 Bacteria 2648
147 Ga0207639_10002837 3300026041 Bacteria 11625
148 Ga0207639_10028127 3300026041 Bacteria 4102
149 Ga0207639_10039112 3300026041 Bacteria 3532
150 Ga0207702_10019744 3300026078 Bacteria 5579
151 Ga0207641_10005272 3300026088 Bacteria 11043
152 Ga0207641_10583283 3300026088 Bacteria 1093
153 Ga0207648_10187734 3300026089 Bacteria 1831
154 Ga0207676_10009803 3300026095 Bacteria 6812
155 Ga0207676_10082508 3300026095 Unclassified 2615
156 Ga0207676_10199154 3300026095 Bacteria 1768
157 Ga0207683_10072070 3300026121 Bacteria 3055
158 Ga0207698_10144016 3300026142 Bacteria 2058
159 Ga0207698_10403224 3300026142 Bacteria 1307
160 Ga0268265_10024558 3300028380 Bacteria 4265
161 Ga0268265_10239863 3300028380 Bacteria 1599
162 Ga0268265_10423470 3300028380 Bacteria 1237
163 Ga0268264_10021187 3300028381 Bacteria 5310
164 Ga0268264_10029243 3300028381 Bacteria 4512
165 Ga0307408_100073315 3300031548 Bacteria 2537
166 Ga0307508_10194785 3300031616 Bacteria 1628
167 Ga0307516_10089570 3300031730 Bacteria 2907
168 Ga0307410_10138558 3300031852 Bacteria 1797
169 Ga0307410_10278799 3300031852 Bacteria 1311
170 Ga0307412_10103526 3300031911 Bacteria 2018
171 Ga0307412_10168635 3300031911 Bacteria 1635
172 Ga0307412_10247727 3300031911 Bacteria 1382
173 Ga0307409_100584267 3300031995 Bacteria 1102
174 Ga0307416_100824325 3300032002 Bacteria 1025
175 Ga0307414_10028369 3300032004 Bacteria 3630
176 Ga0307414_10062549 3300032004 Bacteria 2642
177 Ga0307414_10076310 3300032004 Bacteria 2435
178 Ga0307411_10095728 3300032005 Bacteria 2085
179 Ga0307411_10854406 3300032005 Bacteria 805
180 Ga0373932_0083298 3300035112 Bacteria 1014
181 Ga0373955_0230721 3300035172 Bacteria 1107
182 Ga0373962_0052946 3300035242 Bacteria 1174
183 Ga0373931_0015876 3300035691 Bacteria 3698
184 Ga0373937_0997037 3300036401 Bacteria 786
185 Ga0395899_0002060 3300037312 Bacteria 16548
186 Ga0395899_0548660 3300037312 Bacteria 743
187 Ga0395900_0007163 3300037418 Bacteria 11557
188 Ga0395898_0445755 3300037466 Bacteria 1233
189 Ga0395898_1018113 3300037466 Bacteria 764
190 Ga0395905_0002534 3300037471 Bacteria 20158
191 Ga0395901_0010039 3300038443 Bacteria 9601
192 Ga0395901_0258481 3300038443 Bacteria 1813
193 Ga0436365_0892994 3300039437 Bacteria 1171
194 Ga0436365_1309044 3300039437 Bacteria 2041
195 Ga0451793_0527537 3300041452 Bacteria 962
196 Ga0451797_0560403 3300041453 Bacteria 1075
197 Ga0451802_1077324 3300041460 Bacteria 1978
198 Ga0451807_2102772 3300041486 Bacteria 2949
199 Ga0451837_0260375 3300041494 Bacteria 3670
200 Ga0451837_1074399 3300041494 Bacteria 835
201 Ga0451843_0890421 3300041509 Bacteria 2553
202 Ga0451843_1683885 3300041509 Bacteria 2646
203 Ga0439449_0003385 3300042007 Bacteria 6215
204 Ga0439449_0067111 3300042007 Bacteria 1323
205 Ga0466963_0724056 3300044694 Bacteria 702
206 Ga0466960_0536824 3300044901 Unclassified 689
207 Ga0495638_0049568 3300046460 Bacteria 2625
208 Ga0495664_0264431 3300046477 Bacteria 1040
209 Ga0495663_0202263 3300046525 Bacteria 693
210 Ga0495598_0001423 3300046537 Bacteria 4735
211 Ga0495598_0060110 3300046537 Bacteria 1170
212 Ga0495621_0019258 3300046539 Bacteria 2227
213 Ga0495656_0068346 3300046615 Bacteria 1571
214 Ga0495656_0127012 3300046615 Bacteria 1210
215 Ga0495659_0078898 3300046664 Bacteria 1246
216 Ga0495670_0210926 3300046691 Bacteria 1030
217 Ga0495636_0112392 3300047318 Bacteria 1199
218 Ga0495636_0144476 3300047318 Bacteria 1064
219 Ga0495615_0055552 3300048090 Bacteria 1031
220 Ga0496102_0435163 3300048905 Bacteria 1231
221 Ga0496102_0515152 3300048905 Bacteria 1118
222 Ga0496103_0153634 3300048906 Bacteria 1475
223 Ga0496108_0374280 3300048911 Bacteria 1243
224 Ga0496109_0615359 3300048912 Bacteria 1022
225 Ga0496111_0053521 3300048914 Bacteria 2916
226 Ga0496112_0743225 3300048915 Bacteria 907
227 Ga0496113_0142374 3300048916 Bacteria 1887
228 Ga0496114_0101092 3300048917 Bacteria 2461
229 Ga0496115_0000456 3300048918 Bacteria 32724
230 Ga0496117_0276030 3300048920 Bacteria 902
231 Ga0496118_0003666 3300048921 Bacteria 19070
232 Ga0496118_0036513 3300048921 Bacteria 3972
233 Ga0496126_0000199 3300048929 Bacteria 133742
234 Ga0501031_0544056 3300049568 Bacteria 748
235 Ga0501032_0073393 3300049569 Bacteria 2279
236 Ga0501033_0090288 3300049570 Bacteria 2241
237 Ga0501034_0000462 3300049571 Bacteria 67291
238 Ga0501034_0107313 3300049571 Bacteria 2784
239 Ga0501034_0371816 3300049571 Bacteria 1355
240 Ga0501034_0476631 3300049571 Bacteria 1163
241 Ga0501036_0296757 3300049572 Bacteria 1352
242 Ga0501037_0469630 3300049573 Bacteria 856
243 Ga0501038_0066306 3300049574 Bacteria 3075
244 Ga0501038_0190701 3300049574 Bacteria 1649
245 Ga0501039_0420990 3300049575 Bacteria 1049
246 Ga0501043_0119802 3300049579 Bacteria 2064
247 Ga0501043_0174349 3300049579 Bacteria 1677
248 Ga0501043_0176990 3300049579 Bacteria 1663
249 Ga0501043_0508382 3300049579 Bacteria 899
250 Ga0501046_0084622 3300049580 Bacteria 2446
251 Ga0501047_0000539 3300049581 Bacteria 40864
252 Ga0501047_0000737 3300049581 Bacteria 34086
253 Ga0501047_0011225 3300049581 Bacteria 8478
254 Ga0501047_0058303 3300049581 Bacteria 3730
255 Ga0501047_0385735 3300049581 Bacteria 1235
256 Ga0501048_0919284 3300049582 Bacteria 629
257 Ga0501067_0000473 3300049583 Bacteria 21945
258 Ga0501068_0024143 3300049584 Bacteria 3569
259 Ga0501068_0142009 3300049584 Bacteria 1505
260 Ga0501069_0000965 3300049585 Bacteria 13704
261 Ga0501070_0016654 3300049586 Bacteria 6173
262 Ga0501070_0083190 3300049586 Bacteria 2649
263 Ga0501070_0085890 3300049586 Bacteria 2605
264 Ga0501070_0118676 3300049586 Bacteria 2186
265 Ga0501070_0232767 3300049586 Bacteria 1509
266 Ga0501072_0000493 3300049588 Bacteria 28344
267 Ga0501073_0003691 3300049589 Bacteria 11498
268 Ga0501073_0230378 3300049589 Bacteria 1280
269 Ga0501074_0074851 3300049590 Bacteria 2431
270 Ga0501074_0100775 3300049590 Bacteria 2067
271 Ga0501074_0152903 3300049590 Bacteria 1649
272 Ga0501079_0134801 3300049741 Bacteria 1923
273 Ga0501079_0238246 3300049741 Bacteria 1421
274 Ga0501080_0000205 3300049742 Bacteria 43839
275 Ga0501080_0002065 3300049742 Bacteria 17407
276 Ga0501080_0008760 3300049742 Bacteria 9191
277 Ga0501080_0012133 3300049742 Bacteria 7895
278 Ga0501080_0304390 3300049742 Bacteria 1445
279 Ga0501083_0001820 3300049744 Bacteria 14623
280 Ga0501083_0054246 3300049744 Bacteria 2690
281 Ga0501035_0077442 3300049822 Bacteria 2938
282 Ga0501044_0011744 3300049823 Bacteria 9487
283 Ga0501044_0056752 3300049823 Bacteria 4020
284 Ga0501044_0732241 3300049823 Bacteria 872
285 nmdc:mga00v17_353_c2 3300050491 Bacteria 9286
286 Ga0500641_0004701 3300053096 Bacteria 4829
287 Ga0500594_0222176 3300053118 Unclassified 624
288 Ga0501084_0836498 3300054114 Bacteria 775
289 Ga0501084_1388391 3300054114 Bacteria 588
290 Ga0501082_0026672 3300060353 Bacteria 4980
291 Ga0501082_0458226 3300060353 Bacteria 1114
292 2525557919 2524614729 Bacteria 3091755
293 2630650114 2627854209 Bacteria 3093011
294 2894416258 2894414249 Bacteria 4405451
295 2895500708 2895498888 Bacteria 5283788
296 2895516422 2895511927 Bacteria 6802080
297 2895523658 2895522137 Bacteria 3284416
298 2895526760 2895525241 Bacteria 3388457
299 Ga0070666_10000928
300 Ga0070658_10525317
301 Ga0070683_100215649
302 Ga0070690_100461976
303 Ga0070670_100279614
304 Ga0068869_100921535
305 Ga0068869_101476733
306 Ga0070660_100553656
307 Ga0070661_100032541
308 Ga0070661_101090858
309 Ga0070668_100351843
310 Ga0070669_101407185
311 Ga0070671_100115958
312 Ga0070674_100806031
313 Ga0070673_100070189
314 Ga0070659_100290019
315 Ga0070659_100563770
316 Ga0070667_100082183
317 Ga0070667_100558211
318 Ga0070663_100552508
319 Ga0070678_100806001
320 Ga0070681_10471661
321 Ga0068867_100035403
322 Ga0070679_101069541
323 Ga0068853_100029534
324 Ga0068853_100052944
325 Ga0068853_100215283
326 Ga0070672_100011174
327 Ga0068855_100285726
328 Ga0070664_100571669
329 Ga0068857_100541716
330 Ga0068857_100894489
331 Ga0068854_100391265
332 Ga0068854_100537079
333 Ga0068856_100006369
334 Ga0068856_100023844
335 Ga0070702_100301198
336 Ga0068852_100196295
337 Ga0068852_100619702
338 Ga0068859_100063934
339 Ga0068859_100327441
340 Ga0068864_100013277
341 Ga0068864_100059399
342 Ga0068864_100099978
343 Ga0068864_100233960
344 Ga0068851_10074566
345 Ga0068863_100001114
346 Ga0068863_100268798
347 Ga0068858_100195580
348 Ga0068858_100640396
349 Ga0068860_100020588
350 Ga0081455_10273738
351 Ga0075364_10005380
352 Ga0097621_100245035
353 Ga0068871_100086950
354 Ga0068865_100305784
355 Ga0097620_100063931
356 Ga0097620_100327441
357 Ga0105240_10245356
358 Ga0105240_10311257
359 Ga0105241_10045654
360 Ga0105242_10703666
361 Ga0105248_10644483
362 Ga0105248_11188371
363 Ga0105237_10026075
364 Ga0105237_10675082
365 Ga0105238_10005577
366 Ga0105238_10065444
367 Ga0105238_10118495
368 Ga0105238_10446942
369 Ga0105239_10165061
370 Ga0105239_10222918
371 Ga0105239_10225884
372 Ga0105239_10550888
373 Ga0105246_10125590
374 Ga0105246_10394699
375 Ga0157317_1003132
376 Ga0157335_1007499
377 Ga0157316_1001551
378 Ga0157316_1041180
379 Ga0157326_1037399
380 Ga0157371_10238494
381 Ga0157371_10954696
382 Ga0157370_10144855
383 Ga0157370_10233792
384 Ga0157370_10259528
385 Ga0157369_10016876
386 Ga0157369_10525173
387 Ga0157378_10000305
388 Ga0157378_10106062
389 Ga0157378_10181696
390 Ga0157372_10002274
391 Ga0157372_10200637
392 Ga0157372_11257431
393 Ga0163163_10000601
394 Ga0163163_10014534
395 Ga0163163_11336456
396 Ga0157379_10037463
397 Ga0157376_10082777
398 Ga0157376_10132935
399 Ga0163161_10260377
400 Ga0206356_11228493
401 Ga0213876_10113225
402 Ga0209676_1004308
403 Ga0209676_1015185
404 Ga0209025_1105863
405 Ga0209050_1013711
406 Ga0209256_1004463
407 Ga0207656_10071645
408 Ga0207680_10000745
409 Ga0207680_10468577
410 Ga0207647_10000694
411 Ga0207705_10031194
412 Ga0207654_10000065
413 Ga0207654_10023709
414 Ga0207695_10001492
415 Ga0207671_10004418
416 Ga0207671_10286782
417 Ga0207657_10150533
418 Ga0207657_10291443
419 Ga0207649_10081629
420 Ga0207652_10550986
421 Ga0207652_10796174
422 Ga0207694_10007965
423 Ga0207694_10104089
424 Ga0207694_10521005
425 Ga0207650_10285675
426 Ga0207650_10781430
427 Ga0207650_10821122
428 Ga0207659_10318937
429 Ga0207687_10201040
430 Ga0207644_10091901
431 Ga0207690_10476816
432 Ga0207706_10371326
433 Ga0207709_10603640
434 Ga0207669_10257061
435 Ga0207691_10036501
436 Ga0207689_10973001
437 Ga0207667_10045764
438 Ga0207667_10189716
439 Ga0207651_10045815
440 Ga0207668_10266306
441 Ga0207640_10244063
442 Ga0207640_10645750
443 Ga0207658_10195252
444 Ga0207703_10084900
445 Ga0207639_10002837
446 Ga0207639_10028127
447 Ga0207639_10039112
448 Ga0207702_10019744
449 Ga0207641_10005272
450 Ga0207641_10583283
451 Ga0207648_10187734
452 Ga0207676_10009803
453 Ga0207676_10082508
454 Ga0207676_10199154
455 Ga0207683_10072070
456 Ga0207698_10144016
457 Ga0207698_10403224
458 Ga0268265_10024558
459 Ga0268265_10239863
460 Ga0268265_10423470
461 Ga0268264_10021187
462 Ga0268264_10029243
463 Ga0307408_100073315
464 Ga0307508_10194785
465 Ga0307516_10089570
466 Ga0307410_10138558
467 Ga0307410_10278799
468 Ga0307412_10103526
469 Ga0307412_10168635
470 Ga0307412_10247727
471 Ga0307409_100584267
472 Ga0307416_100824325
473 Ga0307414_10028369
474 Ga0307414_10062549
475 Ga0307414_10076310
476 Ga0307411_10095728
477 Ga0307411_10854406
478 Ga0373932_0083298
479 Ga0373955_0230721
480 Ga0373962_0052946
481 Ga0373931_0015876
482 Ga0373937_0997037
483 Ga0395899_0002060
484 Ga0395899_0548660
485 Ga0395900_0007163
486 Ga0395898_0445755
487 Ga0395898_1018113
488 Ga0395905_0002534
489 Ga0395901_0010039
490 Ga0395901_0258481
491 Ga0436365_0892994
492 Ga0436365_1309044
493 Ga0451793_0527537
494 Ga0451797_0560403
495 Ga0451802_1077324
496 Ga0451807_2102772
497 Ga0451837_0260375
498 Ga0451837_1074399
499 Ga0451843_0890421
500 Ga0451843_1683885
501 Ga0439449_0003385
502 Ga0439449_0067111
503 Ga0466963_0724056
504 Ga0466960_0536824
505 Ga0495638_0049568
506 Ga0495664_0264431
507 Ga0495663_0202263
508 Ga0495598_0001423
509 Ga0495598_0060110
510 Ga0495621_0019258
511 Ga0495656_0068346
512 Ga0495656_0127012
513 Ga0495659_0078898
514 Ga0495670_0210926
515 Ga0495636_0112392
516 Ga0495636_0144476
517 Ga0495615_0055552
518 Ga0496102_0435163
519 Ga0496102_0515152
520 Ga0496103_0153634
521 Ga0496108_0374280
522 Ga0496109_0615359
523 Ga0496111_0053521
524 Ga0496112_0743225
525 Ga0496113_0142374
526 Ga0496114_0101092
527 Ga0496115_0000456
528 Ga0496117_0276030
529 Ga0496118_0003666
530 Ga0496118_0036513
531 Ga0496126_0000199
532 Ga0501031_0544056
533 Ga0501032_0073393
534 Ga0501033_0090288
535 Ga0501034_0000462
536 Ga0501034_0107313
537 Ga0501034_0371816
538 Ga0501034_0476631
539 Ga0501036_0296757
540 Ga0501037_0469630
541 Ga0501038_0066306
542 Ga0501038_0190701
543 Ga0501039_0420990
544 Ga0501043_0119802
545 Ga0501043_0174349
546 Ga0501043_0176990
547 Ga0501043_0508382
548 Ga0501046_0084622
549 Ga0501047_0000539
550 Ga0501047_0000737
551 Ga0501047_0011225
552 Ga0501047_0058303
553 Ga0501047_0385735
554 Ga0501048_0919284
555 Ga0501067_0000473
556 Ga0501068_0024143
557 Ga0501068_0142009
558 Ga0501069_0000965
559 Ga0501070_0016654
560 Ga0501070_0083190
561 Ga0501070_0085890
562 Ga0501070_0118676
563 Ga0501070_0232767
564 Ga0501072_0000493
565 Ga0501073_0003691
566 Ga0501073_0230378
567 Ga0501074_0074851
568 Ga0501074_0100775
569 Ga0501074_0152903
570 Ga0501079_0134801
571 Ga0501079_0238246
572 Ga0501080_0000205
573 Ga0501080_0002065
574 Ga0501080_0008760
575 Ga0501080_0012133
576 Ga0501080_0304390
577 Ga0501083_0001820
578 Ga0501083_0054246
579 Ga0501035_0077442
580 Ga0501044_0011744
581 Ga0501044_0056752
582 Ga0501044_0732241
583 nmdc:mga00v17_353_c2
584 Ga0500641_0004701
585 Ga0500594_0222176
586 Ga0501084_0836498
587 Ga0501084_1388391
588 Ga0501082_0026672
589 Ga0501082_0458226
590 2525557919
591 2630650114
592 2894416258
593 2895500708
594 2895516422
595 2895523658
596 2895526760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

29

166

0.97

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

42

165

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kpp-assembly1.cif.gz_A structure of the e102a mutant of a gnat superfamily pa3944 acetyltransferase 0.9157 6 161
6edd-assembly2.cif.gz_B crystal structure of a gnat superfamily pa3944 acetyltransferase in complex with coa (p1 space group) 0.9138 3 161
6edd-assembly2.cif.gz_B crystal structure of a gnat superfamily pa3944 acetyltransferase in complex with coa (p1 space group) 0.8521 3 161
2fsr-assembly1.cif.gz_A crystal structure of the acetyltransferase from agrobacterium tumefaciens str. c58 0.8479 6 156
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.8458 111 155
ID Description Score Start End Superfamily
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.891 6 159 3.40.630.30
af_Q2G0B8_3_165_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8862 8 142 3.40.630.30
af_Q54L65_11_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8775 8 154 3.40.630.30
af_Q54VL6_2_179_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8684 7 159 3.40.630.30
af_Q2FUT4_1_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8614 8 135 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2Z6E6E9-F1-model_v4 Glutathione S-transferase, unnamed subgroup 0.9791 5 159 GO:0016747
AF-A0A7Y6XLX3-F1-model_v4 GNAT family N-acetyltransferase 0.9778 4 132 GO:0016747
AF-A0A7G9QUI4-F1-model_v4 GNAT family N-acetyltransferase 0.9777 6 167 GO:0016747
AF-A0A0J6FXD7-F1-model_v4 Acetyltransferase 0.9757 5 162 GO:0016747
AF-A0A2N5DP22-F1-model_v4 N-acetyltransferase 0.9733 4 161 GO:0016747

Map