F393941

General Info

Members Datasets Scaffolds Average Seq Length
297 183 594 171

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_85245_c1|nmdc:mga00v17_85245_c1_1186_1758
Length 166
Sequence VIQPSQPPTSDDLAAIGQQLGRPARAVHAVAHRCPCGLPDVVATEPRLPDGTPFPTTFYLTCPRAASRIGSLEGAGAMTDPELATAYAAAHVRYLSARAELAAEAGQRVPEIDGISAGGMPDRVKCLHVLAAQALAQGRGVNPLGDEVLDELGEWWSPGPCVATDG

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
107 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
170 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
171 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
172 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 2643221615 Nocardioides sp. Root224 Isolate Unclassified
178 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
179 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
180 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
181 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
182 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
183 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.14
Nodule 0
Rhizoplane 9.09
Rhizosphere 71.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_85245_c1 3300050491 Bacteria 1978
2 Ga0070658_10602635 3300005327 Bacteria 952
3 Ga0070683_100006805 3300005329 Bacteria 9604
4 Ga0070683_100007988 3300005329 Bacteria 8978
5 Ga0070682_100064181 3300005337 Bacteria 2331
6 Ga0070682_100083146 3300005337 Bacteria 2077
7 Ga0070682_101105362 3300005337 Bacteria 664
8 Ga0068868_101129468 3300005338 Bacteria 722
9 Ga0070689_100049921 3300005340 Bacteria 3231
10 Ga0070691_10094694 3300005341 Bacteria 1476
11 Ga0070692_10014902 3300005345 Bacteria 3664
12 Ga0070668_100477363 3300005347 Bacteria 1076
13 Ga0070668_100527622 3300005347 Bacteria 1025
14 Ga0070668_100918733 3300005347 Bacteria 783
15 Ga0070671_100637813 3300005355 Bacteria 922
16 Ga0070688_100121235 3300005365 Bacteria 1752
17 Ga0070667_100100345 3300005367 Bacteria 2500
18 Ga0070700_100000290 3300005441 Bacteria 26415
19 Ga0070694_100428013 3300005444 Bacteria 1041
20 Ga0070708_100183553 3300005445 Bacteria 1956
21 Ga0070663_100248494 3300005455 Bacteria 1407
22 Ga0070678_100244259 3300005456 Bacteria 1502
23 Ga0070662_100236910 3300005457 Bacteria 1462
24 Ga0070684_100030658 3300005535 Bacteria 4571
25 Ga0070684_100094157 3300005535 Bacteria 2668
26 Ga0070684_100607819 3300005535 Bacteria 1017
27 Ga0068853_100404881 3300005539 Bacteria 1277
28 Ga0070672_100027155 3300005543 Bacteria 4268
29 Ga0070672_100341569 3300005543 Bacteria 1275
30 Ga0070686_100106900 3300005544 Bacteria 1900
31 Ga0068854_100023677 3300005578 Bacteria 4196
32 Ga0068856_101257174 3300005614 Bacteria 756
33 Ga0070702_100003425 3300005615 Bacteria 7096
34 Ga0068852_100010604 3300005616 Bacteria 6895
35 Ga0068859_101528534 3300005617 Bacteria 737
36 Ga0068866_10004726 3300005718 Bacteria 5586
37 Ga0068861_100043173 3300005719 Bacteria 3382
38 Ga0068861_100170456 3300005719 Bacteria 1803
39 Ga0068870_10028600 3300005840 Bacteria 2800
40 Ga0068860_100000300 3300005843 Bacteria 68717
41 Ga0068862_100487503 3300005844 Bacteria 1168
42 Ga0081539_10110941 3300005985 Bacteria 1381
43 Ga0075365_10056250 3300006038 Bacteria 2614
44 Ga0075365_10058051 3300006038 Bacteria 2575
45 Ga0075365_10067838 3300006038 Bacteria 2395
46 Ga0075365_10080240 3300006038 Bacteria 2209
47 Ga0075365_10121319 3300006038 Bacteria 1803
48 Ga0075365_10199729 3300006038 Bacteria 1400
49 Ga0075365_10200888 3300006038 Bacteria 1396
50 Ga0075365_10446048 3300006038 Bacteria 914
51 Ga0075363_100004882 3300006048 Bacteria 5925
52 Ga0075363_100092250 3300006048 Bacteria 1668
53 Ga0075364_10031404 3300006051 Bacteria 3412
54 Ga0075364_10034685 3300006051 Bacteria 3257
55 Ga0075364_10071674 3300006051 Bacteria 2283
56 Ga0075364_10251618 3300006051 Bacteria 1201
57 Ga0075362_10068435 3300006177 Bacteria 1617
58 Ga0075367_10366872 3300006178 Bacteria 909
59 Ga0075431_100764103 3300006847 Bacteria 941
60 Ga0068865_100028209 3300006881 Bacteria 3715
61 Ga0068865_101306220 3300006881 Bacteria 645
62 Ga0097620_101528608 3300006931 Bacteria 737
63 Ga0111539_10026731 3300009094 Bacteria 7052
64 Ga0111539_10630309 3300009094 Bacteria 1248
65 Ga0105245_10379098 3300009098 Bacteria 1408
66 Ga0105247_10223995 3300009101 Bacteria 1274
67 Ga0105243_10148278 3300009148 Bacteria 2010
68 Ga0105243_10230928 3300009148 Bacteria 1641
69 Ga0105243_10298340 3300009148 Bacteria 1459
70 Ga0105243_10330555 3300009148 Bacteria 1392
71 Ga0105238_10021858 3300009551 Bacteria 6517
72 Ga0105238_10777822 3300009551 Bacteria 972
73 Ga0105249_10046229 3300009553 Bacteria 3962
74 Ga0105239_10055866 3300010375 Bacteria 4331
75 Ga0105246_10074542 3300011119 Bacteria 2399
76 Ga0105246_10388483 3300011119 Bacteria 1155
77 Ga0105246_11120068 3300011119 Bacteria 720
78 Ga0157323_1018298 3300012495 Bacteria 641
79 Ga0157375_10538226 3300013308 Bacteria 1330
80 Ga0157375_12098776 3300013308 Bacteria 672
81 Ga0157380_10002263 3300014326 Bacteria 12943
82 Ga0182008_10069238 3300014497 Bacteria 1736
83 Ga0157377_10094748 3300014745 Bacteria 1769
84 Ga0213876_10245267 3300021384 Bacteria 952
85 Ga0213875_10381580 3300021388 Bacteria 671
86 Ga0207642_10173877 3300025899 Bacteria 1167
87 Ga0207688_10071978 3300025901 Bacteria 1963
88 Ga0207647_10161435 3300025904 Bacteria 1307
89 Ga0207705_10584385 3300025909 Bacteria 868
90 Ga0207705_10727562 3300025909 Bacteria 771
91 Ga0207663_11296686 3300025916 Bacteria 586
92 Ga0207662_10303892 3300025918 Bacteria 1061
93 Ga0207681_10083535 3300025923 Bacteria 2261
94 Ga0207694_10123031 3300025924 Bacteria 2073
95 Ga0207687_10036143 3300025927 Bacteria 3364
96 Ga0207664_10013000 3300025929 Bacteria 5964
97 Ga0207644_10470023 3300025931 Bacteria 1035
98 Ga0207706_10824773 3300025933 Bacteria 787
99 Ga0207709_10519437 3300025935 Bacteria 932
100 Ga0207670_10029683 3300025936 Bacteria 3486
101 Ga0207669_10014476 3300025937 Bacteria 3954
102 Ga0207704_10054553 3300025938 Bacteria 2437
103 Ga0207704_10322176 3300025938 Bacteria 1193
104 Ga0207691_10002702 3300025940 Bacteria 17340
105 Ga0207661_10149967 3300025944 Bacteria 2015
106 Ga0207661_10186484 3300025944 Bacteria 1816
107 Ga0207661_10489311 3300025944 Bacteria 1124
108 Ga0207712_10180878 3300025961 Bacteria 1656
109 Ga0207668_10537427 3300025972 Bacteria 1011
110 Ga0207658_10127058 3300025986 Bacteria 2042
111 Ga0207658_10753473 3300025986 Bacteria 882
112 Ga0207677_10053985 3300026023 Bacteria 2739
113 Ga0207703_10108678 3300026035 Bacteria 2363
114 Ga0207708_10000344 3300026075 Bacteria 36621
115 Ga0207648_10007118 3300026089 Bacteria 11035
116 Ga0207676_10552961 3300026095 Bacteria 1100
117 Ga0207674_10395135 3300026116 Bacteria 1336
118 Ga0207675_100000374 3300026118 Bacteria 42984
119 Ga0207675_100338783 3300026118 Bacteria 1472
120 Ga0207683_10268339 3300026121 Bacteria 1559
121 Ga0207698_10061445 3300026142 Bacteria 2928
122 Ga0207428_10009370 3300027907 Bacteria 8783
123 Ga0268264_10000916 3300028381 Bacteria 30848
124 Ga0316181_1069694 3300030744 Bacteria 1639
125 Ga0307516_10398016 3300031730 Bacteria 1037
126 Ga0307410_10233406 3300031852 Bacteria 1422
127 Ga0307410_10533781 3300031852 Bacteria 970
128 Ga0307406_10239568 3300031901 Bacteria 1360
129 Ga0307407_10282598 3300031903 Bacteria 1150
130 Ga0307412_10116990 3300031911 Bacteria 1913
131 Ga0307412_11335447 3300031911 Bacteria 647
132 Ga0307409_100349216 3300031995 Bacteria 1395
133 Ga0307409_100480651 3300031995 Bacteria 1205
134 Ga0307409_100550157 3300031995 Bacteria 1133
135 Ga0307409_101191841 3300031995 Bacteria 785
136 Ga0307409_101242179 3300031995 Bacteria 769
137 Ga0307416_100394247 3300032002 Bacteria 1419
138 Ga0307416_100719419 3300032002 Bacteria 1089
139 Ga0307414_10239308 3300032004 Bacteria 1502
140 Ga0307414_11206309 3300032004 Bacteria 701
141 Ga0307411_10265002 3300032005 Bacteria 1359
142 Ga0307411_10657588 3300032005 Bacteria 908
143 Ga0307415_100014649 3300032126 Bacteria 4619
144 Ga0307415_100095208 3300032126 Bacteria 2167
145 Ga0307415_100161059 3300032126 Bacteria 1739
146 Ga0307415_100951374 3300032126 Bacteria 795
147 Ga0373931_0176352 3300035691 Bacteria 1263
148 Ga0395900_0002443 3300037418 Bacteria 20475
149 Ga0395898_0216417 3300037466 Bacteria 1827
150 Ga0395898_1002539 3300037466 Bacteria 771
151 Ga0395898_1053597 3300037466 Bacteria 748
152 Ga0436364_0373820 3300037853 Bacteria 856
153 Ga0395901_0073209 3300038443 Bacteria 3573
154 Ga0395901_0278037 3300038443 Bacteria 1740
155 Ga0436365_1516128 3300039437 Bacteria 1405
156 Ga0451795_0757612 3300041456 Bacteria 643
157 Ga0451851_0064357 3300041507 Bacteria 773
158 Ga0451853_1790160 3300041512 Bacteria 1566
159 Ga0466972_0082187 3300044658 Bacteria 1533
160 Ga0466972_0106695 3300044658 Bacteria 1324
161 Ga0466966_0134766 3300044684 Bacteria 1511
162 Ga0466963_0124514 3300044694 Bacteria 1776
163 Ga0466963_0791153 3300044694 Bacteria 669
164 Ga0466970_0093605 3300044765 Bacteria 1633
165 Ga0466970_0279295 3300044765 Bacteria 939
166 Ga0466970_0555755 3300044765 Bacteria 663
167 Ga0466960_0000525 3300044901 Bacteria 13137
168 Ga0466960_0006960 3300044901 Bacteria 4566
169 Ga0466960_0068904 3300044901 Bacteria 1756
170 Ga0466960_0242423 3300044901 Bacteria 999
171 Ga0466960_0266600 3300044901 Bacteria 956
172 Ga0466960_0415304 3300044901 Bacteria 777
173 Ga0466960_0588760 3300044901 Bacteria 659
174 Ga0466967_0122487 3300045976 Bacteria 2405
175 Ga0466967_0200660 3300045976 Bacteria 1889
176 Ga0466967_0691039 3300045976 Bacteria 1010
177 Ga0495641_0312556 3300046461 Bacteria 709
178 Ga0495664_0041038 3300046477 Bacteria 2737
179 Ga0495652_0796169 3300046529 Bacteria 630
180 Ga0496100_0127282 3300048903 Bacteria 1789
181 Ga0496100_1218987 3300048903 Bacteria 594
182 Ga0496101_0330079 3300048904 Bacteria 1197
183 Ga0496102_0039966 3300048905 Bacteria 4241
184 Ga0496102_0629940 3300048905 Bacteria 996
185 Ga0496102_0984824 3300048905 Bacteria 764
186 Ga0496103_0011196 3300048906 Bacteria 5312
187 Ga0496104_0423750 3300048907 Bacteria 1243
188 Ga0496105_0060855 3300048908 Bacteria 3116
189 Ga0496105_0064564 3300048908 Bacteria 3021
190 Ga0496105_0640978 3300048908 Bacteria 821
191 Ga0496105_1164375 3300048908 Bacteria 569
192 Ga0496106_0045497 3300048909 Bacteria 3296
193 Ga0496106_1301558 3300048909 Bacteria 564
194 Ga0496107_0104635 3300048910 Bacteria 2077
195 Ga0496109_0038863 3300048912 Bacteria 4305
196 Ga0496109_0045950 3300048912 Bacteria 3965
197 Ga0496109_0309193 3300048912 Bacteria 1491
198 Ga0496110_0106123 3300048913 Bacteria 2520
199 Ga0496111_0025625 3300048914 Bacteria 4161
200 Ga0496113_0021030 3300048916 Bacteria 4598
201 Ga0496114_0023414 3300048917 Bacteria 5040
202 Ga0496114_0041927 3300048917 Bacteria 3792
203 Ga0496114_0317979 3300048917 Bacteria 1375
204 Ga0496114_0505596 3300048917 Bacteria 1069
205 Ga0496114_1024016 3300048917 Bacteria 709
206 Ga0496124_0429327 3300048927 Bacteria 908
207 Ga0496126_0427449 3300048929 Bacteria 1070
208 Ga0501031_0019154 3300049568 Bacteria 4456
209 Ga0501031_0178755 3300049568 Bacteria 1386
210 Ga0501032_0012272 3300049569 Bacteria 6131
211 Ga0501032_0189229 3300049569 Bacteria 1345
212 Ga0501033_0006420 3300049570 Bacteria 9208
213 Ga0501033_0152560 3300049570 Bacteria 1666
214 Ga0501034_0055342 3300049571 Bacteria 3992
215 Ga0501036_0057017 3300049572 Bacteria 3309
216 Ga0501037_0007214 3300049573 Bacteria 8122
217 Ga0501037_0036639 3300049573 Bacteria 3614
218 Ga0501038_0006562 3300049574 Bacteria 10762
219 Ga0501039_0132601 3300049575 Bacteria 1955
220 Ga0501039_0453680 3300049575 Bacteria 1007
221 Ga0501040_0288140 3300049576 Bacteria 1173
222 Ga0501042_0102736 3300049578 Bacteria 2056
223 Ga0501042_0142979 3300049578 Bacteria 1725
224 Ga0501042_0371461 3300049578 Bacteria 1035
225 Ga0501042_0484349 3300049578 Bacteria 898
226 Ga0501043_0014312 3300049579 Bacteria 6208
227 Ga0501046_0002217 3300049580 Bacteria 18328
228 Ga0501046_0010496 3300049580 Bacteria 7949
229 Ga0501046_0018589 3300049580 Bacteria 5779
230 Ga0501047_0057658 3300049581 Bacteria 3755
231 Ga0501048_0009495 3300049582 Bacteria 7302
232 Ga0501048_0306770 3300049582 Bacteria 1129
233 Ga0501067_0006074 3300049583 Bacteria 6695
234 Ga0501067_0010353 3300049583 Bacteria 5161
235 Ga0501067_0022261 3300049583 Bacteria 3508
236 Ga0501067_0190928 3300049583 Bacteria 1141
237 Ga0501068_0129630 3300049584 Bacteria 1577
238 Ga0501068_0398671 3300049584 Bacteria 887
239 Ga0501069_0082976 3300049585 Bacteria 1807
240 Ga0501069_0486674 3300049585 Bacteria 735
241 Ga0501070_0025306 3300049586 Bacteria 4977
242 Ga0501070_0455819 3300049586 Bacteria 1031
243 Ga0501071_0166085 3300049587 Bacteria 1652
244 Ga0501072_0876303 3300049588 Bacteria 702
245 Ga0501073_0052454 3300049589 Bacteria 2856
246 Ga0501074_0142088 3300049590 Bacteria 1717
247 Ga0501074_0906348 3300049590 Bacteria 620
248 Ga0501077_0735516 3300049593 Bacteria 634
249 Ga0501079_0219081 3300049741 Bacteria 1487
250 Ga0501079_0315467 3300049741 Bacteria 1224
251 Ga0501079_0798107 3300049741 Bacteria 743
252 Ga0501035_0006827 3300049822 Bacteria 10667
253 Ga0501035_0036392 3300049822 Bacteria 4460
254 Ga0501044_0007037 3300049823 Bacteria 12374
255 Ga0501044_0022115 3300049823 Bacteria 6780
256 Ga0501045_0593948 3300049824 Bacteria 820
257 nmdc:mga03683_57947_c1 3300050489 Bacteria 1631
258 nmdc:mga03n38_288481_c1 3300050490 Bacteria 878
259 nmdc:mga03n38_288618_c1 3300050490 Bacteria 878
260 nmdc:mga03n38_583232_c1 3300050490 Bacteria 635
261 nmdc:mga03n38_62588_c1 3300050490 Bacteria 1698
262 nmdc:mga03n38_6663_c1 3300050490 Bacteria 4033
263 nmdc:mga00v17_113849_c1 3300050491 Bacteria 1139
264 nmdc:mga00v17_406584_c1 3300050491 Bacteria 884
265 nmdc:mga00v17_4150_c1 3300050491 Bacteria 7502
266 nmdc:mga00v17_471575_c1 3300050491 Bacteria 814
267 nmdc:mga0yw44_127495_c1 3300050492 Bacteria 1229
268 nmdc:mga0yw44_21041_c1 3300050492 Bacteria 3633
269 nmdc:mga0yw44_257509_c1 3300050492 Bacteria 1162
270 nmdc:mga0yw44_33647_c1 3300050492 Bacteria 2996
271 nmdc:mga0yw44_46305_c1 3300050492 Bacteria 2611
272 nmdc:mga0yw44_51121_c1 3300050492 Bacteria 2501
273 nmdc:mga0yw44_60043_c1 3300050492 Bacteria 2328
274 nmdc:mga0yw44_74358_c1 3300050492 Bacteria 2116
275 nmdc:mga06z11_212385_c1 3300050494 Bacteria 1128
276 nmdc:mga07m45_27640_c1 3300050496 Bacteria 3127
277 nmdc:mga08y16_19128_c1 3300050511 Bacteria 7216
278 nmdc:mga0a205_1275905_c1 3300050515 Bacteria 582
279 Ga0495601_0313646 3300053077 Bacteria 1021
280 Ga0500641_0063068 3300053096 Bacteria 1546
281 Ga0500554_096963 3300053102 Bacteria 984
282 Ga0500556_0001932 3300053104 Bacteria 7354
283 Ga0500573_0093315 3300053140 Bacteria 1698
284 Ga0500620_087096 3300053155 Bacteria 1086
285 Ga0501084_0483091 3300054114 Bacteria 1047
286 Ga0590075_142419 3300059424 Bacteria 631
287 Ga0466962_0165448 3300061719 Bacteria 1076
288 Ga0530510_0163205 3300061734 Bacteria 1649
289 Ga0530510_0294614 3300061734 Bacteria 1214
290 Ga0530510_0316884 3300061734 Bacteria 1169
291 2644091245 2643221615 Bacteria 5487866
292 2644321048 2643221657 Bacteria 5490246
293 2644457719 2643221681 Bacteria 3707866
294 2774394217 2773857762 Bacteria 5971770
295 2809194926 2808606439 Bacteria 5952208
296 2812349830 2811994878 Bacteria 5992952
297 2891972596 2891968417 Bacteria 5821697
298 nmdc:mga00v17_85245_c1
299 Ga0070658_10602635
300 Ga0070683_100006805
301 Ga0070683_100007988
302 Ga0070682_100064181
303 Ga0070682_100083146
304 Ga0070682_101105362
305 Ga0068868_101129468
306 Ga0070689_100049921
307 Ga0070691_10094694
308 Ga0070692_10014902
309 Ga0070668_100477363
310 Ga0070668_100527622
311 Ga0070668_100918733
312 Ga0070671_100637813
313 Ga0070688_100121235
314 Ga0070667_100100345
315 Ga0070700_100000290
316 Ga0070694_100428013
317 Ga0070708_100183553
318 Ga0070663_100248494
319 Ga0070678_100244259
320 Ga0070662_100236910
321 Ga0070684_100030658
322 Ga0070684_100094157
323 Ga0070684_100607819
324 Ga0068853_100404881
325 Ga0070672_100027155
326 Ga0070672_100341569
327 Ga0070686_100106900
328 Ga0068854_100023677
329 Ga0068856_101257174
330 Ga0070702_100003425
331 Ga0068852_100010604
332 Ga0068859_101528534
333 Ga0068866_10004726
334 Ga0068861_100043173
335 Ga0068861_100170456
336 Ga0068870_10028600
337 Ga0068860_100000300
338 Ga0068862_100487503
339 Ga0081539_10110941
340 Ga0075365_10056250
341 Ga0075365_10058051
342 Ga0075365_10067838
343 Ga0075365_10080240
344 Ga0075365_10121319
345 Ga0075365_10199729
346 Ga0075365_10200888
347 Ga0075365_10446048
348 Ga0075363_100004882
349 Ga0075363_100092250
350 Ga0075364_10031404
351 Ga0075364_10034685
352 Ga0075364_10071674
353 Ga0075364_10251618
354 Ga0075362_10068435
355 Ga0075367_10366872
356 Ga0075431_100764103
357 Ga0068865_100028209
358 Ga0068865_101306220
359 Ga0097620_101528608
360 Ga0111539_10026731
361 Ga0111539_10630309
362 Ga0105245_10379098
363 Ga0105247_10223995
364 Ga0105243_10148278
365 Ga0105243_10230928
366 Ga0105243_10298340
367 Ga0105243_10330555
368 Ga0105238_10021858
369 Ga0105238_10777822
370 Ga0105249_10046229
371 Ga0105239_10055866
372 Ga0105246_10074542
373 Ga0105246_10388483
374 Ga0105246_11120068
375 Ga0157323_1018298
376 Ga0157375_10538226
377 Ga0157375_12098776
378 Ga0157380_10002263
379 Ga0182008_10069238
380 Ga0157377_10094748
381 Ga0213876_10245267
382 Ga0213875_10381580
383 Ga0207642_10173877
384 Ga0207688_10071978
385 Ga0207647_10161435
386 Ga0207705_10584385
387 Ga0207705_10727562
388 Ga0207663_11296686
389 Ga0207662_10303892
390 Ga0207681_10083535
391 Ga0207694_10123031
392 Ga0207687_10036143
393 Ga0207664_10013000
394 Ga0207644_10470023
395 Ga0207706_10824773
396 Ga0207709_10519437
397 Ga0207670_10029683
398 Ga0207669_10014476
399 Ga0207704_10054553
400 Ga0207704_10322176
401 Ga0207691_10002702
402 Ga0207661_10149967
403 Ga0207661_10186484
404 Ga0207661_10489311
405 Ga0207712_10180878
406 Ga0207668_10537427
407 Ga0207658_10127058
408 Ga0207658_10753473
409 Ga0207677_10053985
410 Ga0207703_10108678
411 Ga0207708_10000344
412 Ga0207648_10007118
413 Ga0207676_10552961
414 Ga0207674_10395135
415 Ga0207675_100000374
416 Ga0207675_100338783
417 Ga0207683_10268339
418 Ga0207698_10061445
419 Ga0207428_10009370
420 Ga0268264_10000916
421 Ga0316181_1069694
422 Ga0307516_10398016
423 Ga0307410_10233406
424 Ga0307410_10533781
425 Ga0307406_10239568
426 Ga0307407_10282598
427 Ga0307412_10116990
428 Ga0307412_11335447
429 Ga0307409_100349216
430 Ga0307409_100480651
431 Ga0307409_100550157
432 Ga0307409_101191841
433 Ga0307409_101242179
434 Ga0307416_100394247
435 Ga0307416_100719419
436 Ga0307414_10239308
437 Ga0307414_11206309
438 Ga0307411_10265002
439 Ga0307411_10657588
440 Ga0307415_100014649
441 Ga0307415_100095208
442 Ga0307415_100161059
443 Ga0307415_100951374
444 Ga0373931_0176352
445 Ga0395900_0002443
446 Ga0395898_0216417
447 Ga0395898_1002539
448 Ga0395898_1053597
449 Ga0436364_0373820
450 Ga0395901_0073209
451 Ga0395901_0278037
452 Ga0436365_1516128
453 Ga0451795_0757612
454 Ga0451851_0064357
455 Ga0451853_1790160
456 Ga0466972_0082187
457 Ga0466972_0106695
458 Ga0466966_0134766
459 Ga0466963_0124514
460 Ga0466963_0791153
461 Ga0466970_0093605
462 Ga0466970_0279295
463 Ga0466970_0555755
464 Ga0466960_0000525
465 Ga0466960_0006960
466 Ga0466960_0068904
467 Ga0466960_0242423
468 Ga0466960_0266600
469 Ga0466960_0415304
470 Ga0466960_0588760
471 Ga0466967_0122487
472 Ga0466967_0200660
473 Ga0466967_0691039
474 Ga0495641_0312556
475 Ga0495664_0041038
476 Ga0495652_0796169
477 Ga0496100_0127282
478 Ga0496100_1218987
479 Ga0496101_0330079
480 Ga0496102_0039966
481 Ga0496102_0629940
482 Ga0496102_0984824
483 Ga0496103_0011196
484 Ga0496104_0423750
485 Ga0496105_0060855
486 Ga0496105_0064564
487 Ga0496105_0640978
488 Ga0496105_1164375
489 Ga0496106_0045497
490 Ga0496106_1301558
491 Ga0496107_0104635
492 Ga0496109_0038863
493 Ga0496109_0045950
494 Ga0496109_0309193
495 Ga0496110_0106123
496 Ga0496111_0025625
497 Ga0496113_0021030
498 Ga0496114_0023414
499 Ga0496114_0041927
500 Ga0496114_0317979
501 Ga0496114_0505596
502 Ga0496114_1024016
503 Ga0496124_0429327
504 Ga0496126_0427449
505 Ga0501031_0019154
506 Ga0501031_0178755
507 Ga0501032_0012272
508 Ga0501032_0189229
509 Ga0501033_0006420
510 Ga0501033_0152560
511 Ga0501034_0055342
512 Ga0501036_0057017
513 Ga0501037_0007214
514 Ga0501037_0036639
515 Ga0501038_0006562
516 Ga0501039_0132601
517 Ga0501039_0453680
518 Ga0501040_0288140
519 Ga0501042_0102736
520 Ga0501042_0142979
521 Ga0501042_0371461
522 Ga0501042_0484349
523 Ga0501043_0014312
524 Ga0501046_0002217
525 Ga0501046_0010496
526 Ga0501046_0018589
527 Ga0501047_0057658
528 Ga0501048_0009495
529 Ga0501048_0306770
530 Ga0501067_0006074
531 Ga0501067_0010353
532 Ga0501067_0022261
533 Ga0501067_0190928
534 Ga0501068_0129630
535 Ga0501068_0398671
536 Ga0501069_0082976
537 Ga0501069_0486674
538 Ga0501070_0025306
539 Ga0501070_0455819
540 Ga0501071_0166085
541 Ga0501072_0876303
542 Ga0501073_0052454
543 Ga0501074_0142088
544 Ga0501074_0906348
545 Ga0501077_0735516
546 Ga0501079_0219081
547 Ga0501079_0315467
548 Ga0501079_0798107
549 Ga0501035_0006827
550 Ga0501035_0036392
551 Ga0501044_0007037
552 Ga0501044_0022115
553 Ga0501045_0593948
554 nmdc:mga03683_57947_c1
555 nmdc:mga03n38_288481_c1
556 nmdc:mga03n38_288618_c1
557 nmdc:mga03n38_583232_c1
558 nmdc:mga03n38_62588_c1
559 nmdc:mga03n38_6663_c1
560 nmdc:mga00v17_113849_c1
561 nmdc:mga00v17_406584_c1
562 nmdc:mga00v17_4150_c1
563 nmdc:mga00v17_471575_c1
564 nmdc:mga0yw44_127495_c1
565 nmdc:mga0yw44_21041_c1
566 nmdc:mga0yw44_257509_c1
567 nmdc:mga0yw44_33647_c1
568 nmdc:mga0yw44_46305_c1
569 nmdc:mga0yw44_51121_c1
570 nmdc:mga0yw44_60043_c1
571 nmdc:mga0yw44_74358_c1
572 nmdc:mga06z11_212385_c1
573 nmdc:mga07m45_27640_c1
574 nmdc:mga08y16_19128_c1
575 nmdc:mga0a205_1275905_c1
576 Ga0495601_0313646
577 Ga0500641_0063068
578 Ga0500554_096963
579 Ga0500556_0001932
580 Ga0500573_0093315
581 Ga0500620_087096
582 Ga0501084_0483091
583 Ga0590075_142419
584 Ga0466962_0165448
585 Ga0530510_0163205
586 Ga0530510_0294614
587 Ga0530510_0316884
588 2644091245
589 2644321048
590 2644457719
591 2774394217
592 2809194926
593 2812349830
594 2891972596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04417

DUF501

Protein of unknown function (DUF501)

30

150

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8j83-assembly1.cif.gz_B crystal structure of formate dehydrogenase from methylorubrum extorquens am1 0.3886 1 40
1ub0-assembly1.cif.gz_A-2 crystal structure analysis of phosphomethylpyrimidine kinase (thid) from thermus thermophilus hb8 0.3669 144 179
8apo-assembly1.cif.gz_AL structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.2873 126 177
7zpl-assembly1.cif.gz_E symmetric dimer of influenza a/h7n9 polymerase bound to 5' vrna hook 0.2363 14 101
6d7x-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.2246 84 168
ID Description Score Start End Superfamily
af_A0A0R4IMI8_1_127_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4823 22 63 3.30.200.20
af_Q06490_24_336_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.4665 144 169 3.40.1190.20
af_Q9SVJ4_20_492_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.4115 144 174 1.50.10.10
1ub0A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.3669 144 179 3.40.1190.20
af_F1Q4P4_710_840_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.342 4 40 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6L6XTS8-F1-model_v4 DUF501 domain-containing protein 0.9984 21 179
AF-A0A7Y9ZLD3-F1-model_v4 Septum formation initiator family protein 0.9934 25 181
AF-A0A011AD31-F1-model_v4 Septum formation initiator family protein 0.9933 20 178
AF-A0A6L6XTS8-F1-model_v4 DUF501 domain-containing protein 0.9922 21 179
AF-A0A327ZG79-F1-model_v4 Septum formation initiator family protein 0.992 19 181

Map