F393918

General Info

Members Datasets Scaffolds Average Seq Length
297 225 203 237

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000440|Ga0501034_0000440_65411_66268
Length 285
Sequence VRQVGAATFAQLKALKEQAYIGVVRRRHAVQSVRVRRAVSWLSGDDAMQPVHNDAPNPPMPALCQGCESRHGFCRALTAEQRLSLSRHTRRVHYPAGAELLADAAPITSYGNVLNGVVKLSKVLEDGRQQVVGLQFAPDLLGRLFASESRVTAEAASDVDLCMVPRTALEALLRENPALEHAIMLQTLRELDEARDWMVTLGRKTAAEKVASFLYLIASHIDPLQDEETSFELPLSRADIGDFLGLTVETVSRQMSRLKADGVIEIENYRHVSVPDVARLRLRCG

Samples

Sample ID Description Type Environment
1 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
4 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
5 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
6 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
7 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
8 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
9 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
10 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
11 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
12 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
13 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
14 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
15 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
16 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
17 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
18 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
19 2643221558 Rhizobium sp. Root149 Isolate Unclassified
20 2643221580 Devosia sp. Root635 Isolate Unclassified
21 2643221591 Devosia sp. Root685 Isolate Unclassified
22 2643221599 Rhizobium sp. Root708 Isolate Unclassified
23 2643221607 Rhizobium sp. Root73 Isolate Unclassified
24 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
25 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
26 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
27 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
28 2643221674 Devosia sp. Root436 Isolate Unclassified
29 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
30 2643221718 Rhizobium sp. Root268 Isolate Unclassified
31 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
32 2738541293 Rhizobium sp. GV031 Isolate Unclassified
33 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
34 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
35 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
36 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
37 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
38 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
39 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
40 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
41 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
42 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
43 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
44 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
45 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
46 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
47 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
48 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
49 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
50 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
51 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
52 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
53 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
54 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
55 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
56 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
57 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
58 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
59 2932401849 Devosia sp. 2618 Isolate Rhizosphere
60 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
61 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
62 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
63 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
64 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
65 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
66 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
67 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
68 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
69 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
70 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
71 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
72 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
73 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
74 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
75 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
76 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
77 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
78 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
79 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
80 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
81 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
82 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
83 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
84 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
85 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
86 2996887358 Rhizobium sp. R711 Isolate Nodule
87 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
88 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
89 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
90 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
91 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
92 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
93 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
94 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
95 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
96 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
97 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
100 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
101 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
117 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
138 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
147 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
154 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
213 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
217 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
218 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
219 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
220 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
221 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
222 8005258706 Rhizobium sp. R693 Isolate Nodule
223 8005321885 Rhizobium sp. R72 Isolate Nodule
224 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
225 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.01
Metatranscriptomes 0.34
Isolates 31.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.81
Nodule 21.21
Rhizoplane 8.08
Rhizosphere 34.34
Stem 0
Stem Tuber 0
Unclassified 21.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002419 3300002773 Bacteria 7111
2 JGI25152J39213_1007355 3300002773 Bacteria 2858
3 JGI25150J39212_1000164 3300002774 Bacteria 37406
4 JGI25151J46595_10000201 3300003187 Bacteria 73412
5 JGI25165J46597_1000034 3300003214 Bacteria 292458
6 JGI25153J46596_10000838 3300003215 Bacteria 18810
7 rootH1_10304007 3300003323 Bacteria 2379
8 JGI25160J50197_1008309 3300003354 Bacteria 3964
9 Ga0055528_1001284 3300003790 Bacteria 15768
10 Ga0070668_100023887 3300005347 Bacteria 4629
11 Ga0070668_100168588 3300005347 Bacteria 1781
12 Ga0070671_100152017 3300005355 Bacteria 1955
13 Ga0070667_100214166 3300005367 Bacteria 1713
14 Ga0070714_100525101 3300005435 Bacteria 1131
15 Ga0070678_100494531 3300005456 Bacteria 1078
16 Ga0070686_100433987 3300005544 Bacteria 1006
17 Ga0070665_100005795 3300005548 Bacteria 12676
18 Ga0070665_100227589 3300005548 Bacteria 1865
19 Ga0068856_100728601 3300005614 Bacteria 1012
20 Ga0075363_100002910 3300006048 Bacteria 7134
21 Ga0070712_100276445 3300006175 Bacteria 1351
22 Ga0075367_10080339 3300006178 Bacteria 1972
23 Ga0075370_10078294 3300006353 Bacteria 1898
24 Ga0075370_10123495 3300006353 Bacteria 1508
25 Ga0079104_1002821 3300006946 Bacteria 8745
26 Ga0105251_10017508 3300009011 Bacteria 3838
27 Ga0105250_10073000 3300009092 Bacteria 1388
28 Ga0105241_10045500 3300009174 Bacteria 3330
29 Ga0105238_10089090 3300009551 Bacteria 3073
30 Ga0105249_10353634 3300009553 Bacteria 1489
31 Ga0105239_10070951 3300010375 Bacteria 3827
32 Ga0105239_10122877 3300010375 Bacteria 2885
33 Ga0157374_10093610 3300013296 Bacteria 2869
34 Ga0228711_1000016 3300022739 Bacteria 126351
35 Ga0228710_1000013 3300022740 Bacteria 145976
36 Ga0207425_1000055 3300025245 Bacteria 152820
37 Ga0209129_1000029 3300025258 Bacteria 401149
38 Ga0209129_1000613 3300025258 Bacteria 24014
39 Ga0209673_1008628 3300025273 Bacteria 4517
40 Ga0209673_1010646 3300025273 Bacteria 3857
41 Ga0209130_1004957 3300025284 Bacteria 4819
42 Ga0209130_1008327 3300025284 Bacteria 3072
43 Ga0209130_1010481 3300025284 Bacteria 2548
44 Ga0209025_1000070 3300025294 Bacteria 287776
45 Ga0209025_1007226 3300025294 Bacteria 8359
46 Ga0209564_1022429 3300025295 Bacteria 2232
47 Ga0209758_1000094 3300025297 Bacteria 241068
48 Ga0209256_1006589 3300025299 Bacteria 6078
49 Ga0209256_1022984 3300025299 Bacteria 1872
50 Ga0207426_1001714 3300025302 Bacteria 16806
51 Ga0209051_1007658 3300025303 Bacteria 5868
52 Ga0209051_1074673 3300025303 Bacteria 1004
53 Ga0207713_1053297 3300025735 Bacteria 1594
54 Ga0207695_10212092 3300025913 Bacteria 1847
55 Ga0207671_10068419 3300025914 Bacteria 2646
56 Ga0207693_10253483 3300025915 Bacteria 1381
57 Ga0207694_10216752 3300025924 Bacteria 1560
58 Ga0207644_10029368 3300025931 Bacteria 3814
59 Ga0207712_10340045 3300025961 Bacteria 1244
60 Ga0207668_10107107 3300025972 Bacteria 2090
61 Ga0207658_10301968 3300025986 Bacteria 1380
62 Ga0209281_1000221 3300027111 Bacteria 122380
63 Ga0209282_1000041 3300027666 Bacteria 122268
64 Ga0268266_10109291 3300028379 Bacteria 2448
65 Ga0268266_10332891 3300028379 Bacteria 1423
66 Ga0307515_10000121 3300028794 Bacteria 188657
67 Ga0307515_10379286 3300028794 Bacteria 1047
68 Ga0307406_10008710 3300031901 Bacteria 5671
69 Ga0307412_10141896 3300031911 Bacteria 1761
70 Ga0307412_10248713 3300031911 Bacteria 1379
71 Ga0315914_1000030 3300031967 Bacteria 102599
72 Ga0307414_10158108 3300032004 Bacteria 1797
73 Ga0307414_10442283 3300032004 Bacteria 1138
74 Ga0316593_10055653 3300032168 Bacteria 1345
75 Ga0315913_1000017 3300033430 Bacteria 102835
76 Ga0315915_1000017 3300033464 Bacteria 148111
77 Ga0316574_0335859 3300035398 Bacteria 958
78 Ga0373947_0309512 3300035725 Bacteria 1055
79 Ga0316582_0070441 3300036647 Bacteria 2262
80 Ga0395905_0000569 3300037471 Bacteria 50013
81 Ga0395905_0136041 3300037471 Bacteria 2311
82 Ga0395901_0272183 3300038443 Bacteria 1761
83 Ga0439465_0048490 3300041413 Bacteria 1386
84 Ga0451843_1769026 3300041509 Bacteria 990
85 Ga0495638_0023504 3300046460 Bacteria 4030
86 Ga0495585_0052979 3300046492 Bacteria 2246
87 Ga0495607_0116518 3300046501 Bacteria 1409
88 Ga0495607_0225194 3300046501 Bacteria 915
89 Ga0495606_0155510 3300046507 Bacteria 1338
90 Ga0495610_0009496 3300046512 Bacteria 6143
91 Ga0495610_0105740 3300046512 Bacteria 1254
92 Ga0495620_0059268 3300046515 Bacteria 1600
93 Ga0495632_0012927 3300046519 Bacteria 4788
94 Ga0495632_0085322 3300046519 Bacteria 1502
95 Ga0495643_0028091 3300046522 Bacteria 3157
96 Ga0495652_0367197 3300046529 Bacteria 1027
97 Ga0495633_0081758 3300046558 Bacteria 1503
98 Ga0495656_0057966 3300046615 Bacteria 1679
99 Ga0495668_0055564 3300046616 Bacteria 2186
100 Ga0495625_0063656 3300046660 Bacteria 2604
101 Ga0495670_0203241 3300046691 Bacteria 1050
102 Ga0495636_0187764 3300047318 Bacteria 940
103 Ga0495686_0003636 3300047472 Bacteria 13219
104 Ga0495686_0064245 3300047472 Bacteria 2272
105 Ga0495686_0400920 3300047472 Bacteria 736
106 Ga0496100_0113136 3300048903 Bacteria 1889
107 Ga0496100_0505483 3300048903 Bacteria 931
108 Ga0496101_0124437 3300048904 Bacteria 1953
109 Ga0496101_0297607 3300048904 Bacteria 1263
110 Ga0496102_0077570 3300048905 Bacteria 3057
111 Ga0496102_0124893 3300048905 Bacteria 2405
112 Ga0496103_0057438 3300048906 Bacteria 2416
113 Ga0496104_0080261 3300048907 Bacteria 3110
114 Ga0496104_0466746 3300048907 Bacteria 1174
115 Ga0496104_0665996 3300048907 Bacteria 949
116 Ga0496105_0066327 3300048908 Bacteria 2979
117 Ga0496106_0075012 3300048909 Bacteria 2590
118 Ga0496106_0185536 3300048909 Bacteria 1652
119 Ga0496108_0039909 3300048911 Bacteria 3912
120 Ga0496109_0046515 3300048912 Bacteria 3941
121 Ga0496110_0148954 3300048913 Bacteria 2118
122 Ga0496110_0261065 3300048913 Bacteria 1576
123 Ga0496110_0392178 3300048913 Bacteria 1265
124 Ga0496111_0019701 3300048914 Bacteria 4691
125 Ga0496111_0108862 3300048914 Bacteria 2040
126 Ga0496112_0001270 3300048915 Bacteria 19161
127 Ga0496112_0326588 3300048915 Bacteria 1478
128 Ga0496113_0536846 3300048916 Bacteria 938
129 Ga0496114_0039404 3300048917 Bacteria 3910
130 Ga0496116_0001460 3300048919 Bacteria 26485
131 Ga0496116_0014345 3300048919 Bacteria 6334
132 Ga0496116_0023833 3300048919 Bacteria 4546
133 Ga0496117_0007285 3300048920 Bacteria 10867
134 Ga0496117_0035200 3300048920 Bacteria 3762
135 Ga0496117_0038194 3300048920 Bacteria 3565
136 Ga0496118_0009327 3300048921 Bacteria 9944
137 Ga0496118_0019101 3300048921 Bacteria 6140
138 Ga0496118_0259861 3300048921 Bacteria 981
139 Ga0496119_0073611 3300048922 Bacteria 1992
140 Ga0496119_0110816 3300048922 Bacteria 1524
141 Ga0496120_0010488 3300048923 Bacteria 6460
142 Ga0496121_0000001 3300048924 Bacteria 1830318
143 Ga0496121_0002673 3300048924 Bacteria 26675
144 Ga0496121_0294016 3300048924 Bacteria 1105
145 Ga0496122_0006514 3300048925 Bacteria 13371
146 Ga0496122_0022600 3300048925 Bacteria 5583
147 Ga0496122_0059931 3300048925 Bacteria 2806
148 Ga0496122_0090085 3300048925 Bacteria 2094
149 Ga0496123_0002144 3300048926 Bacteria 25227
150 Ga0496123_0046215 3300048926 Bacteria 2954
151 Ga0496123_0047373 3300048926 Bacteria 2905
152 Ga0496123_0072398 3300048926 Bacteria 2145
153 Ga0496124_0004154 3300048927 Bacteria 17092
154 Ga0496124_0006467 3300048927 Bacteria 12758
155 Ga0496124_0034678 3300048927 Bacteria 4424
156 Ga0496124_0053357 3300048927 Bacteria 3427
157 Ga0496124_0082711 3300048927 Bacteria 2635
158 Ga0496124_0155111 3300048927 Bacteria 1792
159 Ga0496124_0286771 3300048927 Bacteria 1197
160 Ga0496125_0000001 3300048928 Bacteria 1766138
161 Ga0496125_0000318 3300048928 Bacteria 93900
162 Ga0496125_0016310 3300048928 Bacteria 7137
163 Ga0496125_0027963 3300048928 Bacteria 5101
164 Ga0496126_0020449 3300048929 Bacteria 6487
165 Ga0496126_0048154 3300048929 Bacteria 3898
166 Ga0496126_0073282 3300048929 Bacteria 3045
167 Ga0496126_0079770 3300048929 Bacteria 2897
168 Ga0495678_035250 3300049459 Bacteria 2053
169 Ga0501031_0439378 3300049568 Bacteria 843
170 Ga0501034_0000440 3300049571 Bacteria 68848
171 Ga0501034_0130958 3300049571 Bacteria 2491
172 Ga0501034_0184308 3300049571 Bacteria 2051
173 Ga0501034_0443603 3300049571 Bacteria 1216
174 Ga0501036_0024314 3300049572 Bacteria 5107
175 Ga0501037_0107239 3300049573 Bacteria 2013
176 Ga0501037_0360719 3300049573 Bacteria 1001
177 Ga0501038_0043560 3300049574 Bacteria 3902
178 Ga0501038_0325521 3300049574 Bacteria 1201
179 Ga0501038_0505069 3300049574 Bacteria 924
180 Ga0501047_0033879 3300049581 Bacteria 4929
181 Ga0501047_0458196 3300049581 Bacteria 1104
182 Ga0501070_0114449 3300049586 Bacteria 2228
183 Ga0501073_0049370 3300049589 Bacteria 2951
184 Ga0501074_0219990 3300049590 Bacteria 1352
185 Ga0501080_0402344 3300049742 Bacteria 1231
186 Ga0501035_0000927 3300049822 Bacteria 31062
187 Ga0501044_0036220 3300049823 Bacteria 5162
188 Ga0501044_0494121 3300049823 Bacteria 1125
189 nmdc:mga00v17_3040_c1 3300050491 Bacteria 8625
190 nmdc:mga00v17_436463_c1 3300050491 Bacteria 850
191 nmdc:mga06z11_58893_c1 3300050494 Bacteria 1994
192 nmdc:mga07m45_120185_c1 3300050496 Bacteria 1517
193 nmdc:mga07m45_182448_c1 3300050496 Bacteria 1220
194 Ga0500569_033704 3300053109 Bacteria 1457
195 Ga0500618_011216 3300053125 Bacteria 2382
196 Ga0500559_0018321 3300053136 Bacteria 2959
197 Ga0500568_0000114 3300053139 Bacteria 73279
198 Ga0500568_0062536 3300053139 Bacteria 1438
199 Ga0500604_0000162 3300053151 Bacteria 19306
200 Ga0500624_010611 3300053157 Bacteria 1330
201 Ga0500627_0156339 3300053158 Bacteria 1029
202 Ga0500634_0000040 3300053161 Bacteria 59608
203 Ga0500634_0165270 3300053161 Bacteria 1016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2922185730 2922188007 192
2 3300005544 Ga0070686_100433987 Ga0070686_1004339872 204
3 3300048903 Ga0496100_0505483 Ga0496100_0505483_304_918 204
4 3300048925 Ga0496122_0090085 Ga0496122_0090085_1466_2080 204
5 3300046501 Ga0495607_0225194 Ga0495607_0225194_140_787 205
6 3300046512 Ga0495610_0105740 Ga0495610_0105740_199_846 205
7 3300046558 Ga0495633_0081758 Ga0495633_0081758_232_879 205
8 3300046615 Ga0495656_0057966 Ga0495656_0057966_547_1194 205
9 3300046691 Ga0495670_0203241 Ga0495670_0203241_189_836 205
10 3300050496 nmdc:mga07m45_182448_c1 nmdc:mga07m45_182448_c1_579_1202 205
11 3300035725 Ga0373947_0309512 Ga0373947_0309512_260_904 214
12 3300046529 Ga0495652_0367197 Ga0495652_0367197_141_785 214
13 3300048903 Ga0496100_0113136 Ga0496100_0113136_572_1216 214
14 3300048904 Ga0496101_0124437 Ga0496101_0124437_720_1364 214
15 3300048905 Ga0496102_0124893 Ga0496102_0124893_1479_2123 214
16 3300048907 Ga0496104_0665996 Ga0496104_0665996_182_826 214
17 3300048909 Ga0496106_0185536 Ga0496106_0185536_363_1007 214
18 3300048911 Ga0496108_0039909 Ga0496108_0039909_881_1525 214
19 3300048912 Ga0496109_0046515 Ga0496109_0046515_903_1547 214
20 3300048913 Ga0496110_0392178 Ga0496110_0392178_66_710 214
21 3300048914 Ga0496111_0108862 Ga0496111_0108862_379_1023 214
22 3300048915 Ga0496112_0001270 Ga0496112_0001270_17862_18506 214
23 3300048916 Ga0496113_0536846 Ga0496113_0536846_191_835 214
24 3300053161 Ga0500634_0000040 Ga0500634_0000040_7913_8557 214
25 3300053161 Ga0500634_0165270 Ga0500634_0165270_100_744 214
26 3300046492 Ga0495585_0052979 Ga0495585_0052979_917_1564 215
27 3300046507 Ga0495606_0155510 Ga0495606_0155510_478_1125 215
28 3300046616 Ga0495668_0055564 Ga0495668_0055564_824_1471 215
29 3300046660 Ga0495625_0063656 Ga0495625_0063656_201_848 215
30 3300047472 Ga0495686_0064245 Ga0495686_0064245_1458_2105 215
31 3300048919 Ga0496116_0001460 Ga0496116_0001460_12798_13445 215
32 3300048919 Ga0496116_0014345 Ga0496116_0014345_4272_4919 215
33 3300048920 Ga0496117_0007285 Ga0496117_0007285_5885_6532 215
34 3300048920 Ga0496117_0035200 Ga0496117_0035200_1710_2357 215
35 3300048921 Ga0496118_0009327 Ga0496118_0009327_5766_6413 215
36 3300048921 Ga0496118_0019101 Ga0496118_0019101_5218_5865 215
37 3300048922 Ga0496119_0073611 Ga0496119_0073611_173_820 215
38 3300048924 Ga0496121_0002673 Ga0496121_0002673_12293_12940 215
39 3300048924 Ga0496121_0294016 Ga0496121_0294016_389_1036 215
40 3300048925 Ga0496122_0006514 Ga0496122_0006514_525_1172 215
41 3300048925 Ga0496122_0022600 Ga0496122_0022600_4412_5059 215
42 3300048926 Ga0496123_0002144 Ga0496123_0002144_13983_14630 215
43 3300048926 Ga0496123_0072398 Ga0496123_0072398_547_1194 215
44 3300048927 Ga0496124_0004154 Ga0496124_0004154_5699_6346 215
45 3300048927 Ga0496124_0006467 Ga0496124_0006467_6071_6718 215
46 3300048927 Ga0496124_0053357 Ga0496124_0053357_1222_1869 215
47 3300048928 Ga0496125_0016310 Ga0496125_0016310_1742_2389 215
48 3300048929 Ga0496126_0048154 Ga0496126_0048154_1926_2573 215
49 3300048929 Ga0496126_0073282 Ga0496126_0073282_2273_2920 215
50 3300053125 Ga0500618_011216 Ga0500618_011216_1327_1974 215
51 iso_pu_bacteria 2881861095 2881862551 220
52 3300003354 JGI25160J50197_1008309 JGI25160J50197_10083094 224
53 3300003790 Ga0055528_1001284 Ga0055528_10012846 224
54 3300009011 Ga0105251_10017508 Ga0105251_100175084 224
55 3300009092 Ga0105250_10073000 Ga0105250_100730002 224
56 3300009553 Ga0105249_10353634 Ga0105249_103536342 224
57 3300025299 Ga0209256_1022984 Ga0209256_10229842 224
58 3300046519 Ga0495632_0012927 Ga0495632_0012927_460_1134 224
59 3300047472 Ga0495686_0400920 Ga0495686_0400920_38_712 224
60 3300048904 Ga0496101_0297607 Ga0496101_0297607_282_956 224
61 3300048905 Ga0496102_0077570 Ga0496102_0077570_1831_2505 224
62 3300048906 Ga0496103_0057438 Ga0496103_0057438_1501_2175 224
63 3300048907 Ga0496104_0080261 Ga0496104_0080261_574_1248 224
64 3300048908 Ga0496105_0066327 Ga0496105_0066327_392_1066 224
65 3300048909 Ga0496106_0075012 Ga0496106_0075012_485_1159 224
66 3300048913 Ga0496110_0261065 Ga0496110_0261065_519_1193 224
67 3300048915 Ga0496112_0326588 Ga0496112_0326588_473_1147 224
68 3300048917 Ga0496114_0039404 Ga0496114_0039404_2628_3302 224
69 3300048919 Ga0496116_0023833 Ga0496116_0023833_2293_2967 224
70 3300048921 Ga0496118_0259861 Ga0496118_0259861_272_946 224
71 3300048926 Ga0496123_0047373 Ga0496123_0047373_1915_2589 224
72 3300025284 Ga0209130_1008327 Ga0209130_10083273 226
73 3300053139 Ga0500568_0062536 Ga0500568_0062536_621_1307 226
74 3300003214 JGI25165J46597_1000034 JGI25165J46597_1000034242 227
75 iso_pu_bacteria 2510917028 2511182632 234
76 iso_pu_bacteria 2513237138 2513870032 234
77 iso_pu_bacteria 2582581294 2585202137 234
78 iso_pu_bacteria 2582581299 2585228365 234
79 iso_pu_bacteria 2582581304 2585258422 234
80 iso_pu_bacteria 2582581867 2585400799 234
81 iso_pu_bacteria 2585427590 2585822299 234
82 iso_pu_bacteria 2643221599 2644007186 234
83 iso_pu_bacteria 2643221634 2644193593 234
84 iso_pu_bacteria 2643221643 2644242419 234
85 iso_pu_bacteria 2885305155 2885308108 234
86 iso_pu_bacteria 2885326080 2885327315 234
87 iso_pu_bacteria 2923556063 2923559170 234
88 iso_pu_bacteria 2996887358 2996892966 234
89 iso_pu_bacteria 3005452660 3005454753 234
90 iso_pu_bacteria 8005258706 8005259268 234
91 iso_pu_bacteria 8005321885 8005327493 234
92 iso_pu_bacteria 8005542996 8005545758 234
93 iso_pu_bacteria 2643221580 2643909529 235
94 iso_pu_bacteria 2643221637 2644207294 235
95 iso_pu_bacteria 2643221674 2644411098 235
96 iso_pu_bacteria 2643221718 2644650942 235
97 iso_pu_bacteria 2693429783 2694628854 235
98 iso_pu_bacteria 2932401849 2932404259 235
99 3300035398 Ga0316574_0335859 Ga0316574_0335859_15_740 236
100 iso_pu_bacteria 2582581283 2585169288 236
101 iso_pu_bacteria 2582581306 2585268474 236
102 iso_pu_bacteria 2582581865 2585390569 236
103 iso_pu_bacteria 2582581866 2585394319 236
104 iso_pu_bacteria 2643221558 2643812720 236
105 iso_pu_bacteria 2643221591 2643964358 236
106 iso_pu_bacteria 2738541317 2738946090 236
107 iso_pu_bacteria 2856356410 2856363236 236
108 iso_pu_bacteria 2871488783 2871494153 236
109 iso_pu_bacteria 2878753008 2878756728 236
110 iso_pu_bacteria 2881845957 2881851072 236
111 iso_pu_bacteria 2882912400 2882914656 236
112 iso_pu_bacteria 2885318864 2885325334 236
113 iso_pu_bacteria 2903492973 2903502343 236
114 iso_pu_bacteria 2913308742 2913311327 236
115 iso_pu_bacteria 2915980308 2915981868 236
116 iso_pu_bacteria 2916061851 2916067554 236
117 iso_pu_bacteria 2921250672 2921251151 236
118 iso_pu_bacteria 2924784321 2924788317 236
119 iso_pu_bacteria 2929138655 2929139840 236
120 iso_pu_bacteria 2961170736 2961173018 236
121 iso_pu_bacteria 2967996073 2967998229 236
122 iso_pu_bacteria 2968003550 2968008881 236
123 iso_pu_bacteria 2970503327 2970505612 236
124 iso_pu_bacteria 2977821940 2977825908 236
125 iso_pu_bacteria 2979808191 2979810333 236
126 iso_pu_bacteria 2989349275 2989349445 236
127 iso_pu_bacteria 2989771324 2989774967 236
128 iso_pu_bacteria 8004374579 8004378316 236
129 iso_pu_bacteria 8018150411 8018155055 236
130 iso_pu_bacteria 2896384573 2896384882 237
131 iso_pu_bacteria 2995392953 2995393732 237
132 3300002773 JGI25152J39213_1007355 JGI25152J39213_10073552 238
133 3300005347 Ga0070668_100023887 Ga0070668_1000238873 238
134 3300005347 Ga0070668_100168588 Ga0070668_1001685882 238
135 3300005355 Ga0070671_100152017 Ga0070671_1001520172 238
136 3300005367 Ga0070667_100214166 Ga0070667_1002141662 238
137 3300006353 Ga0075370_10123495 Ga0075370_101234952 238
138 3300025258 Ga0209129_1000613 Ga0209129_10006136 238
139 3300025273 Ga0209673_1008628 Ga0209673_10086284 238
140 3300025284 Ga0209130_1004957 Ga0209130_10049573 238
141 3300025294 Ga0209025_1007226 Ga0209025_10072265 238
142 3300025295 Ga0209564_1022429 Ga0209564_10224291 238
143 3300025299 Ga0209256_1006589 Ga0209256_10065892 238
144 3300025302 Ga0207426_1001714 Ga0207426_10017146 238
145 3300025303 Ga0209051_1007658 Ga0209051_10076583 238
146 3300025735 Ga0207713_1053297 Ga0207713_10532972 238
147 3300025931 Ga0207644_10029368 Ga0207644_100293681 238
148 3300025961 Ga0207712_10340045 Ga0207712_103400452 238
149 3300025972 Ga0207668_10107107 Ga0207668_101071072 238
150 3300025986 Ga0207658_10301968 Ga0207658_103019681 238
151 3300028794 Ga0307515_10379286 Ga0307515_103792862 238
152 3300031911 Ga0307412_10141896 Ga0307412_101418961 238
153 3300031911 Ga0307412_10248713 Ga0307412_102487131 238
154 3300032004 Ga0307414_10158108 Ga0307414_101581082 238
155 3300032004 Ga0307414_10442283 Ga0307414_104422832 238
156 3300038443 Ga0395901_0272183 Ga0395901_0272183_217_939 238
157 3300041509 Ga0451843_1769026 Ga0451843_1769026_52_768 238
158 3300053151 Ga0500604_0000162 Ga0500604_0000162_16492_17208 238
159 3300053158 Ga0500627_0156339 Ga0500627_0156339_84_803 238
160 iso_pu_bacteria 2510461069 2510840505 238
161 3300041413 Ga0439465_0048490 Ga0439465_0048490_436_1158 239
162 3300049571 Ga0501034_0130958 Ga0501034_0130958_245_967 239
163 3300049571 Ga0501034_0443603 Ga0501034_0443603_477_1202 239
164 3300049573 Ga0501037_0360719 Ga0501037_0360719_92_817 239
165 3300049574 Ga0501038_0043560 Ga0501038_0043560_171_896 239
166 3300049574 Ga0501038_0325521 Ga0501038_0325521_370_1095 239
167 3300049574 Ga0501038_0505069 Ga0501038_0505069_88_813 239
168 3300049581 Ga0501047_0458196 Ga0501047_0458196_275_1000 239
169 3300049586 Ga0501070_0114449 Ga0501070_0114449_1450_2175 239
170 3300049589 Ga0501073_0049370 Ga0501073_0049370_2205_2930 239
171 3300049590 Ga0501074_0219990 Ga0501074_0219990_301_1026 239
172 3300049742 Ga0501080_0402344 Ga0501080_0402344_22_747 239
173 3300049823 Ga0501044_0494121 Ga0501044_0494121_297_1022 239
174 iso_pu_bacteria 2512875026 2512971073 239
175 iso_pu_bacteria 2513237089 2513604570 239
176 iso_pu_bacteria 2513237156 2513984574 239
177 iso_pu_bacteria 2513237160 2514007623 239
178 iso_pu_bacteria 2517487022 2517570043 239
179 iso_pu_bacteria 2802428858 2802719538 239
180 iso_pu_bacteria 2802428859 2802726869 239
181 iso_pu_bacteria 2802428860 2802732272 239
182 iso_pu_bacteria 2802428861 2802739875 239
183 iso_pu_bacteria 2802428862 2802745381 239
184 iso_pu_bacteria 2802428863 2802752773 239
185 iso_pu_bacteria 2937029754 2937031298 239
186 iso_pu_bacteria 2937036028 2937038561 239
187 iso_pu_bacteria 2937078374 2937079819 239
188 iso_pu_bacteria 2937084907 2937087698 239
189 iso_pu_bacteria 2957375807 2957376606 239
190 iso_pu_bacteria 2957437181 2957440221 239
191 iso_pu_bacteria 2960591022 2960592695 239
192 iso_pu_bacteria 2960631154 2960632812 239
193 iso_pu_bacteria 2960680706 2960681881 239
194 iso_pu_bacteria 2960693952 2960694262 239
195 iso_pu_bacteria 2967686174 2967690797 239
196 iso_pu_bacteria 2967728569 2967735005 239
197 iso_pu_bacteria 2970026789 2970030989 239
198 iso_pu_bacteria 2970122695 2970123002 239
199 iso_pu_bacteria 2970143518 2970144078 239
200 iso_pu_bacteria 2977530762 2977531691 239
201 iso_pu_bacteria 2977544691 2977549106 239
202 iso_pu_bacteria 8003999396 8004001415 239
203 3300003323 rootH1_10304007 rootH1_103040072 240
204 3300005435 Ga0070714_100525101 Ga0070714_1005251012 240
205 3300005456 Ga0070678_100494531 Ga0070678_1004945312 240
206 3300005548 Ga0070665_100005795 Ga0070665_1000057957 240
207 3300005548 Ga0070665_100227589 Ga0070665_1002275892 240
208 3300005614 Ga0068856_100728601 Ga0068856_1007286011 240
209 3300006048 Ga0075363_100002910 Ga0075363_1000029105 240
210 3300006175 Ga0070712_100276445 Ga0070712_1002764452 240
211 3300006178 Ga0075367_10080339 Ga0075367_100803392 240
212 3300006353 Ga0075370_10078294 Ga0075370_100782942 240
213 3300025284 Ga0209130_1010481 Ga0209130_10104812 240
214 3300025915 Ga0207693_10253483 Ga0207693_102534831 240
215 3300028379 Ga0268266_10109291 Ga0268266_101092912 240
216 3300028379 Ga0268266_10332891 Ga0268266_103328911 240
217 3300046460 Ga0495638_0023504 Ga0495638_0023504_852_1580 240
218 3300047318 Ga0495636_0187764 Ga0495636_0187764_175_903 240
219 3300048907 Ga0496104_0466746 Ga0496104_0466746_147_872 240
220 3300048913 Ga0496110_0148954 Ga0496110_0148954_585_1307 240
221 3300048914 Ga0496111_0019701 Ga0496111_0019701_3659_4381 240
222 3300048920 Ga0496117_0038194 Ga0496117_0038194_1358_2083 240
223 3300048923 Ga0496120_0010488 Ga0496120_0010488_5083_5808 240
224 3300048924 Ga0496121_0000001 Ga0496121_0000001_1220557_1221282 240
225 3300048925 Ga0496122_0059931 Ga0496122_0059931_470_1195 240
226 3300048926 Ga0496123_0046215 Ga0496123_0046215_1561_2286 240
227 3300048927 Ga0496124_0034678 Ga0496124_0034678_3072_3797 240
228 3300048927 Ga0496124_0082711 Ga0496124_0082711_1571_2293 240
229 3300048927 Ga0496124_0155111 Ga0496124_0155111_1050_1772 240
230 3300048928 Ga0496125_0000001 Ga0496125_0000001_1379624_1380349 240
231 3300048928 Ga0496125_0000318 Ga0496125_0000318_23723_24445 240
232 3300048928 Ga0496125_0027963 Ga0496125_0027963_1790_2512 240
233 3300048929 Ga0496126_0020449 Ga0496126_0020449_5546_6292 240
234 3300048929 Ga0496126_0079770 Ga0496126_0079770_612_1337 240
235 3300050491 nmdc:mga00v17_3040_c1 nmdc:mga00v17_3040_c1_4439_5164 240
236 3300050491 nmdc:mga00v17_436463_c1 nmdc:mga00v17_436463_c1_29_751 240
237 3300050494 nmdc:mga06z11_58893_c1 nmdc:mga06z11_58893_c1_837_1565 240
238 3300050496 nmdc:mga07m45_120185_c1 nmdc:mga07m45_120185_c1_684_1409 240
239 3300053109 Ga0500569_033704 Ga0500569_033704_319_1047 240
240 3300053136 Ga0500559_0018321 Ga0500559_0018321_449_1186 240
241 3300053139 Ga0500568_0000114 Ga0500568_0000114_6028_6756 240
242 3300053157 Ga0500624_010611 Ga0500624_010611_293_1018 240
243 3300006946 Ga0079104_1002821 Ga0079104_10028211 241
244 3300022739 Ga0228711_1000016 Ga0228711_100001658 241
245 3300022740 Ga0228710_1000013 Ga0228710_100001376 241
246 3300027111 Ga0209281_1000221 Ga0209281_100022154 241
247 3300027666 Ga0209282_1000041 Ga0209282_100004154 241
248 3300031967 Ga0315914_1000030 Ga0315914_100003077 241
249 3300033430 Ga0315913_1000017 Ga0315913_100001775 241
250 3300033464 Ga0315915_1000017 Ga0315915_100001790 241
251 3300009174 Ga0105241_10045500 Ga0105241_100455002 242
252 3300009551 Ga0105238_10089090 Ga0105238_100890903 242
253 3300010375 Ga0105239_10122877 Ga0105239_101228772 242
254 3300025913 Ga0207695_10212092 Ga0207695_102120922 242
255 3300025914 Ga0207671_10068419 Ga0207671_100684193 242
256 3300025924 Ga0207694_10216752 Ga0207694_102167521 242
257 3300037471 Ga0395905_0136041 Ga0395905_0136041_751_1485 242
258 3300049568 Ga0501031_0439378 Ga0501031_0439378_44_772 242
259 3300049573 Ga0501037_0107239 Ga0501037_0107239_83_811 242
260 3300032168 Ga0316593_10055653 Ga0316593_100556532 243
261 3300036647 Ga0316582_0070441 Ga0316582_0070441_18_761 243
262 iso_pu_bacteria 2643221607 2644051857 245
263 iso_pu_bacteria 2643221636 2644201664 245
264 iso_pu_bacteria 2643221686 2644480725 245
265 3300010375 Ga0105239_10070951 Ga0105239_100709513 249
266 3300028794 Ga0307515_10000121 Ga0307515_1000012174 251
267 3300049571 Ga0501034_0184308 Ga0501034_0184308_1163_1966 251
268 3300049822 Ga0501035_0000927 Ga0501035_0000927_11141_11902 252
269 iso_pu_bacteria 2582581283 2585164210 252
270 3300049572 Ga0501036_0024314 Ga0501036_0024314_225_1010 255
271 3300049581 Ga0501047_0033879 Ga0501047_0033879_3415_4200 255
272 3300049823 Ga0501044_0036220 Ga0501044_0036220_2692_3477 255
273 3300013296 Ga0157374_10093610 Ga0157374_100936102 258
274 iso_pu_bacteria 2585427594 2585843315 260
275 iso_pu_bacteria 2738541293 2738800169 260
276 3300049571 Ga0501034_0000440 Ga0501034_0000440_65411_66268 261
277 3300037471 Ga0395905_0000569 Ga0395905_0000569_30572_31411 262
278 3300002773 JGI25152J39213_1002419 JGI25152J39213_10024192 264
279 3300002774 JGI25150J39212_1000164 JGI25150J39212_10001645 264
280 3300003187 JGI25151J46595_10000201 JGI25151J46595_1000020140 264
281 3300003215 JGI25153J46596_10000838 JGI25153J46596_100008382 264
282 3300025245 Ga0207425_1000055 Ga0207425_100005532 264
283 3300025258 Ga0209129_1000029 Ga0209129_1000029233 264
284 3300025273 Ga0209673_1010646 Ga0209673_10106464 264
285 3300025294 Ga0209025_1000070 Ga0209025_1000070149 264
286 3300025297 Ga0209758_1000094 Ga0209758_100009486 264
287 3300025303 Ga0209051_1074673 Ga0209051_10746731 264
288 3300031901 Ga0307406_10008710 Ga0307406_100087105 264
289 3300046501 Ga0495607_0116518 Ga0495607_0116518_517_1311 264
290 3300046512 Ga0495610_0009496 Ga0495610_0009496_2611_3405 264
291 3300046515 Ga0495620_0059268 Ga0495620_0059268_594_1388 264
292 3300046519 Ga0495632_0085322 Ga0495632_0085322_409_1203 264
293 3300046522 Ga0495643_0028091 Ga0495643_0028091_1584_2378 264
294 3300047472 Ga0495686_0003636 Ga0495686_0003636_4463_5257 264
295 3300048922 Ga0496119_0110816 Ga0496119_0110816_408_1202 264
296 3300048927 Ga0496124_0286771 Ga0496124_0286771_11_805 264
297 3300049459 Ga0495678_035250 Ga0495678_035250_773_1567 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00325

Crp

Bacterial regulatory proteins, crp family

233

264

0.99

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

91

176

0.95

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

208

283

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j48-assembly2.cif.gz_B pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.891 43 150
5l0n-assembly1.cif.gz_A pkg i's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with rp-cgmp 0.8777 52 151
4ku8-assembly2.cif.gz_B structures of pkgi reveal a cgmp-selective activation mechanism 0.871 50 146
3mdp-assembly1.cif.gz_A-2 crystal structure of a putative cyclic nucleotide-binding protein (gmet_1532) from geobacter metallireducens gs-15 at 1.90 a resolution 0.8553 41 166
4z07-assembly1.cif.gz_C co-crystal structure of the tandem cnb (cnb-a/b) domains of human pkg i beta with cgmp 0.8544 45 158
ID Description Score Start End Superfamily
4pcqB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9344 214 241 1.10.10.10
af_E7F4S2_470_592_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9181 62 166 2.60.120.10
af_E7F4S2_593_708_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9143 62 171 2.60.120.10
af_Q9VL34_535_672_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9127 45 150 2.60.120.10
af_Q9U969_483_615_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9029 54 166 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6N1DTY7-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9149 50 152 GO:0005829
AF-E3HZN0-F1-model_v4 Transcriptional regulator, Crp/Fnr family 0.9073 39 262 GO:0003677
GO:0003700
GO:0005829
AF-A0A1F8T6S4-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9057 45 173 GO:0003700
GO:0005829
AF-A0A7C7QH41-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.902 45 160
AF-A0A7W5GPK4-F1-model_v4 deleted 0.8926 92 264

Feature Viewer

pLDDT pTM Quality
83.21 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map