F393887

General Info

Members Datasets Scaffolds Average Seq Length
297 158 297 211

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0510068|Ga0496100_0510068_168_890
Length 240
Sequence LDLPGWQAIYQQLKDKNFEIISVAQDTGGAKDAGPWIDPLHYLEAKPGLPKETIETARKIGPLGYTVLIDEKHLVSKLYNMVNVPTGVWINEKGRIVRPNEVAFVDDRFKNFSGLDSAPYLSALKDWVERGEKSAYVMSEDRLREKLAAQDPSLAMAAAEFGLGEQLYKSGHAAEAIPHFKEAQRLNPRSWSYKRQAWALSDAKRDYGTSFREEVDKIGGSKVYYTPPDLPAEKKPEKPQ

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.38
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2111430 2162886006 Unclassified 1025
2 Ga0058861_11258896 3300004800 Unclassified 1063
3 Ga0065715_10273213 3300005293 Unclassified 1093
4 Ga0070690_100038484 3300005330 Bacteria 3019
5 Ga0070690_100051653 3300005330 Unclassified 2625
6 Ga0068869_100244214 3300005334 Unclassified 1431
7 Ga0070680_100012488 3300005336 Bacteria 6601
8 Ga0070680_100172193 3300005336 Bacteria 1822
9 Ga0068868_100023889 3300005338 Bacteria 4632
10 Ga0070689_100258899 3300005340 Unclassified 1438
11 Ga0070687_100033313 3300005343 Bacteria 2542
12 Ga0070703_10000164 3300005406 Bacteria 33085
13 Ga0070709_10129420 3300005434 Unclassified 1721
14 Ga0070709_10465093 3300005434 Unclassified 955
15 Ga0070714_100073516 3300005435 Bacteria 2962
16 Ga0070713_100026641 3300005436 Bacteria 4542
17 Ga0070713_100087054 3300005436 Unclassified 2679
18 Ga0070713_100189550 3300005436 Bacteria 1852
19 Ga0070710_10302214 3300005437 Unclassified 1045
20 Ga0070710_10389211 3300005437 Bacteria 932
21 Ga0070711_100000010 3300005439 Bacteria 164614
22 Ga0070711_100042678 3300005439 Unclassified 3067
23 Ga0070705_100000590 3300005440 Bacteria 21129
24 Ga0070705_100000809 3300005440 Bacteria 17643
25 Ga0070705_100073440 3300005440 Unclassified 2076
26 Ga0070705_100330535 3300005440 Unclassified 1104
27 Ga0070705_100551585 3300005440 Unclassified 884
28 Ga0070700_100226699 3300005441 Bacteria 1327
29 Ga0070700_100526169 3300005441 Unclassified 914
30 Ga0070694_100001600 3300005444 Bacteria 13292
31 Ga0070694_100009187 3300005444 Bacteria 6063
32 Ga0070694_100049210 3300005444 Unclassified 2838
33 Ga0070694_100058323 3300005444 Bacteria 2626
34 Ga0070694_100309491 3300005444 Bacteria 1213
35 Ga0070694_100394025 3300005444 Bacteria 1083
36 Ga0070708_100001390 3300005445 Bacteria 18506
37 Ga0070708_100069293 3300005445 Bacteria 3172
38 Ga0070708_100078813 3300005445 Bacteria 2978
39 Ga0070708_100094051 3300005445 Unclassified 2734
40 Ga0070681_10053179 3300005458 Bacteria 4035
41 Ga0070681_10849611 3300005458 Bacteria 830
42 Ga0070706_100006423 3300005467 Bacteria 11105
43 Ga0070706_100053027 3300005467 Bacteria 3743
44 Ga0070706_100179980 3300005467 Bacteria 1974
45 Ga0070707_100000001 3300005468 Bacteria 320358
46 Ga0070707_100003306 3300005468 Bacteria 15220
47 Ga0070707_100017087 3300005468 Bacteria 6814
48 Ga0070707_100377574 3300005468 Unclassified 1377
49 Ga0070707_100593732 3300005468 Bacteria 1070
50 Ga0070707_100749114 3300005468 Unclassified 940
51 Ga0070698_100006776 3300005471 Bacteria 12420
52 Ga0070699_100000090 3300005518 Bacteria 87042
53 Ga0070699_100012364 3300005518 Bacteria 7364
54 Ga0070699_100025563 3300005518 Bacteria 5089
55 Ga0070699_100065612 3300005518 Bacteria 3151
56 Ga0070699_100101576 3300005518 Bacteria 2521
57 Ga0070699_100248537 3300005518 Bacteria 1589
58 Ga0070699_100794295 3300005518 Unclassified 866
59 Ga0070679_100012641 3300005530 Bacteria 8075
60 Ga0070684_100038880 3300005535 Bacteria 4090
61 Ga0070697_100000949 3300005536 Bacteria 21843
62 Ga0070697_100154715 3300005536 Unclassified 1935
63 Ga0070697_100213339 3300005536 Bacteria 1644
64 Ga0070697_100324160 3300005536 Bacteria 1327
65 Ga0070695_100003308 3300005545 Bacteria 9420
66 Ga0070695_100118896 3300005545 Unclassified 1805
67 Ga0070695_100190406 3300005545 Bacteria 1459
68 Ga0070696_100000001 3300005546 Bacteria 174282
69 Ga0070696_100001149 3300005546 Bacteria 17168
70 Ga0070696_100001311 3300005546 Bacteria 16240
71 Ga0070696_100145267 3300005546 Unclassified 1737
72 Ga0070696_100346839 3300005546 Unclassified 1149
73 Ga0070693_100000054 3300005547 Bacteria 43910
74 Ga0070693_100010869 3300005547 Bacteria 4571
75 Ga0070693_100131539 3300005547 Unclassified 1565
76 Ga0070704_100007216 3300005549 Bacteria 6607
77 Ga0070704_100032428 3300005549 Bacteria 3524
78 Ga0070704_100129408 3300005549 Bacteria 1954
79 Ga0070704_100566767 3300005549 Unclassified 994
80 Ga0068855_100115943 3300005563 Unclassified 3070
81 Ga0068857_100140211 3300005577 Bacteria 2185
82 Ga0068857_100294525 3300005577 Unclassified 1495
83 Ga0068856_100180585 3300005614 Bacteria 2123
84 Ga0068852_100026024 3300005616 Bacteria 4749
85 Ga0068852_100451608 3300005616 Bacteria 1272
86 Ga0068859_100009568 3300005617 Bacteria 9787
87 Ga0068859_100039013 3300005617 Bacteria 4763
88 Ga0068859_100406049 3300005617 Bacteria 1458
89 Ga0068864_100069895 3300005618 Bacteria 3054
90 Ga0068864_100391730 3300005618 Unclassified 1319
91 Ga0068860_100008958 3300005843 Bacteria 9969
92 Ga0068860_100254948 3300005843 Bacteria 1709
93 Ga0068862_100068383 3300005844 Bacteria 3064
94 Ga0068862_100254660 3300005844 Unclassified 1601
95 Ga0081455_10012499 3300005937 Bacteria 8469
96 Ga0070717_10027811 3300006028 Bacteria 4521
97 Ga0070717_10083200 3300006028 Bacteria 2690
98 Ga0070715_10050089 3300006163 Bacteria 1792
99 Ga0070716_100682748 3300006173 Unclassified 782
100 Ga0070712_100041842 3300006175 Unclassified 3148
101 Ga0070712_100077853 3300006175 Bacteria 2391
102 Ga0070712_100079071 3300006175 Unclassified 2376
103 Ga0097621_100972943 3300006237 Unclassified 793
104 Ga0075428_100494565 3300006844 Bacteria 1309
105 Ga0075433_10801335 3300006852 Bacteria 823
106 Ga0075434_100081335 3300006871 Unclassified 3237
107 Ga0075434_100288071 3300006871 Bacteria 1662
108 Ga0075434_100646067 3300006871 Bacteria 1076
109 Ga0075434_101033426 3300006871 Unclassified 835
110 Ga0075429_100049220 3300006880 Bacteria 3665
111 Ga0075429_100161205 3300006880 Unclassified 1964
112 Ga0075429_100424946 3300006880 Bacteria 1164
113 Ga0075436_100000854 3300006914 Bacteria 20259
114 Ga0075436_100065023 3300006914 Bacteria 2522
115 Ga0075436_100227652 3300006914 Bacteria 1324
116 Ga0097620_100009565 3300006931 Bacteria 9787
117 Ga0097620_100039014 3300006931 Bacteria 4763
118 Ga0097620_100406064 3300006931 Bacteria 1458
119 Ga0075435_100668233 3300007076 Bacteria 902
120 Ga0099794_10017110 3300007265 Unclassified 3227
121 Ga0099794_10021338 3300007265 Bacteria 2942
122 Ga0099794_10190880 3300007265 Bacteria 1047
123 Ga0099795_10004895 3300007788 Bacteria 3505
124 Ga0099795_10063914 3300007788 Bacteria 1373
125 Ga0111539_10341593 3300009094 Unclassified 1743
126 Ga0105245_10015195 3300009098 Bacteria 6707
127 Ga0105245_10244757 3300009098 Unclassified 1740
128 Ga0105247_10080130 3300009101 Bacteria 2056
129 Ga0114129_10022848 3300009147 Bacteria 8869
130 Ga0114129_10142688 3300009147 Unclassified 3281
131 Ga0114129_10652438 3300009147 Unclassified 1358
132 Ga0114129_10835902 3300009147 Unclassified 1172
133 Ga0114129_10845364 3300009147 Bacteria 1164
134 Ga0114129_10960107 3300009147 Bacteria 1079
135 Ga0114129_11646976 3300009147 Unclassified 784
136 Ga0105243_10000096 3300009148 Bacteria 100257
137 Ga0105243_10371284 3300009148 Bacteria 1320
138 Ga0105242_10002474 3300009176 Bacteria 14490
139 Ga0105242_10075634 3300009176 Bacteria 2804
140 Ga0105242_10228750 3300009176 Unclassified 1666
141 Ga0105248_10162391 3300009177 Bacteria 2519
142 Ga0105248_10272359 3300009177 Bacteria 1906
143 Ga0105239_10087207 3300010375 Bacteria 3440
144 Ga0105239_10769844 3300010375 Unclassified 1102
145 Ga0105239_11380257 3300010375 Bacteria 813
146 Ga0105246_10278664 3300011119 Unclassified 1340
147 Ga0105246_10342722 3300011119 Bacteria 1222
148 Ga0157369_10033368 3300013105 Bacteria 5657
149 Ga0157369_10083310 3300013105 Bacteria 3421
150 Ga0157369_10127491 3300013105 Bacteria 2697
151 Ga0157369_10148118 3300013105 Bacteria 2481
152 Ga0157374_10870973 3300013296 Bacteria 918
153 Ga0157378_10000496 3300013297 Bacteria 37321
154 Ga0157378_10097844 3300013297 Bacteria 2675
155 Ga0157378_10442915 3300013297 Unclassified 1288
156 Ga0163162_10049791 3300013306 Bacteria 4200
157 Ga0163163_10714682 3300014325 Bacteria 1065
158 Ga0157380_11025791 3300014326 Bacteria 860
159 Ga0157379_10064739 3300014968 Bacteria 3267
160 Ga0207653_10000348 3300025885 Bacteria 23233
161 Ga0207692_10195214 3300025898 Bacteria 1187
162 Ga0207692_10249061 3300025898 Unclassified 1064
163 Ga0207692_10347261 3300025898 Bacteria 914
164 Ga0207647_10418610 3300025904 Unclassified 753
165 Ga0207699_10274686 3300025906 Unclassified 1169
166 Ga0207684_10000102 3300025910 Bacteria 162120
167 Ga0207684_10013380 3300025910 Bacteria 7097
168 Ga0207707_10194554 3300025912 Bacteria 1769
169 Ga0207707_10611620 3300025912 Bacteria 921
170 Ga0207693_10010812 3300025915 Bacteria 7409
171 Ga0207693_10042709 3300025915 Bacteria 3569
172 Ga0207693_10104841 3300025915 Bacteria 2217
173 Ga0207663_10000005 3300025916 Bacteria 282473
174 Ga0207663_10172269 3300025916 Bacteria 1538
175 Ga0207660_10066720 3300025917 Bacteria 2604
176 Ga0207660_10084155 3300025917 Bacteria 2344
177 Ga0207662_10086819 3300025918 Bacteria 1918
178 Ga0207652_10023838 3300025921 Bacteria 5074
179 Ga0207646_10000029 3300025922 Bacteria 223317
180 Ga0207646_10196486 3300025922 Bacteria 1822
181 Ga0207646_10440753 3300025922 Unclassified 1175
182 Ga0207646_10729195 3300025922 Bacteria 885
183 Ga0207681_10019128 3300025923 Bacteria 4325
184 Ga0207681_10657989 3300025923 Unclassified 869
185 Ga0207694_10051388 3300025924 Bacteria 3195
186 Ga0207687_10036323 3300025927 Bacteria 3356
187 Ga0207700_10007326 3300025928 Bacteria 6736
188 Ga0207700_10031266 3300025928 Bacteria 3779
189 Ga0207700_10541436 3300025928 Unclassified 1033
190 Ga0207664_10195762 3300025929 Bacteria 1742
191 Ga0207664_10580865 3300025929 Bacteria 1006
192 Ga0207686_10000026 3300025934 Bacteria 169189
193 Ga0207686_10189529 3300025934 Bacteria 1465
194 Ga0207709_10000142 3300025935 Bacteria 100236
195 Ga0207709_10319432 3300025935 Unclassified 1161
196 Ga0207665_10079165 3300025939 Bacteria 2259
197 Ga0207711_10127146 3300025941 Bacteria 2281
198 Ga0207711_10376976 3300025941 Unclassified 1316
199 Ga0207689_10350913 3300025942 Unclassified 1226
200 Ga0207661_10140300 3300025944 Bacteria 2079
201 Ga0207667_10013767 3300025949 Bacteria 9245
202 Ga0207677_10079154 3300026023 Bacteria 2350
203 Ga0207677_10288757 3300026023 Unclassified 1350
204 Ga0207677_10527968 3300026023 Unclassified 1025
205 Ga0207708_10605801 3300026075 Unclassified 928
206 Ga0207648_10302087 3300026089 Unclassified 1436
207 Ga0207676_10263227 3300026095 Bacteria 1558
208 Ga0207676_10441734 3300026095 Unclassified 1225
209 Ga0207674_10321118 3300026116 Unclassified 1498
210 Ga0207674_10354665 3300026116 Unclassified 1418
211 Ga0207675_100358278 3300026118 Bacteria 1431
212 Ga0207698_10409081 3300026142 Bacteria 1299
213 Ga0209588_1024719 3300027671 Bacteria 1898
214 Ga0209588_1037936 3300027671 Unclassified 1552
215 Ga0207428_10035484 3300027907 Bacteria 4076
216 Ga0207428_10406253 3300027907 Unclassified 997
217 Ga0268265_10075744 3300028380 Unclassified 2637
218 Ga0268264_10010115 3300028381 Bacteria 7806
219 Ga0268264_10220404 3300028381 Bacteria 1746
220 Ga0265338_10321546 3300028800 Bacteria 1120
221 Ga0373926_0047427 3300035083 Unclassified 1543
222 Ga0373955_0003329 3300035172 Bacteria 7059
223 Ga0373924_0084213 3300035410 Bacteria 1355
224 Ga0373924_0270840 3300035410 Unclassified 753
225 Ga0373935_0001133 3300035692 Bacteria 14565
226 Ga0373927_0202494 3300035695 Unclassified 1303
227 Ga0373933_0079255 3300035724 Bacteria 2011
228 Ga0373947_0002708 3300035725 Bacteria 10637
229 Ga0373937_0034916 3300036401 Bacteria 4575
230 Ga0373937_0103284 3300036401 Bacteria 2647
231 Ga0373937_0133028 3300036401 Bacteria 2324
232 Ga0373925_0009082 3300037068 Bacteria 7236
233 Ga0373925_0086254 3300037068 Bacteria 2394
234 Ga0373925_0566737 3300037068 Unclassified 934
235 Ga0451839_0682334 3300041496 Bacteria 1066
236 Ga0451577_0417666 3300042876 Bacteria 1218
237 Ga0451577_0426345 3300042876 Bacteria 1204
238 Ga0453683_0009925 3300044673 Bacteria 6335
239 Ga0453684_0003355 3300044712 Bacteria 36253
240 Ga0453684_0046591 3300044712 Bacteria 5764
241 Ga0466959_0008805 3300045049 Bacteria 7150
242 Ga0451576_0157281 3300045051 Bacteria 2371
243 Ga0495651_0017059 3300046462 Bacteria 5626
244 Ga0495651_0507919 3300046462 Bacteria 771
245 Ga0495580_0034002 3300046472 Bacteria 3671
246 Ga0495580_0039542 3300046472 Bacteria 3375
247 Ga0495582_0248686 3300046473 Bacteria 1019
248 Ga0495639_0118122 3300046475 Bacteria 1263
249 Ga0495594_0227109 3300046499 Unclassified 1064
250 Ga0495630_0007796 3300046517 Bacteria 7664
251 Ga0495630_0249604 3300046517 Unclassified 1356
252 Ga0495621_0074877 3300046539 Bacteria 1253
253 Ga0495667_0009194 3300046559 Bacteria 6710
254 Ga0495635_0369574 3300046663 Bacteria 955
255 Ga0495623_0056699 3300046679 Bacteria 2466
256 Ga0495581_0047179 3300047315 Bacteria 2490
257 Ga0495581_0048381 3300047315 Bacteria 2456
258 Ga0495674_0018405 3300047319 Bacteria 6504
259 Ga0496100_0060135 3300048903 Bacteria 2500
260 Ga0496100_0510068 3300048903 Bacteria 927
261 Ga0496102_0027409 3300048905 Bacteria 5088
262 Ga0496102_0219035 3300048905 Bacteria 1794
263 Ga0496103_0363360 3300048906 Bacteria 931
264 Ga0496104_0016409 3300048907 Bacteria 6727
265 Ga0496104_0037845 3300048907 Bacteria 4511
266 Ga0496105_0011590 3300048908 Bacteria 6972
267 Ga0496110_0178140 3300048913 Bacteria 1930
268 Ga0496111_0023135 3300048914 Bacteria 4360
269 Ga0496112_0037861 3300048915 Bacteria 4710
270 Ga0496112_1024394 3300048915 Unclassified 745
271 Ga0496113_0001910 3300048916 Bacteria 11900
272 Ga0501031_0332190 3300049568 Unclassified 984
273 Ga0501040_0050155 3300049576 Bacteria 2854
274 Ga0501048_0199525 3300049582 Unclassified 1418
275 Ga0501074_0174130 3300049590 Bacteria 1536
276 Ga0501075_0501950 3300049591 Unclassified 926
277 Ga0501076_0223067 3300049592 Unclassified 1540
278 Ga0501079_0054019 3300049741 Bacteria 3099
279 nmdc:mga05p37_256_c1 3300050507 Bacteria 54932
280 nmdc:mga05p37_265852_c1 3300050507 Bacteria 2051
281 nmdc:mga05p37_471961_c1 3300050507 Bacteria 1447
282 nmdc:mga05p37_715093_c1 3300050507 Unclassified 1110
283 nmdc:mga05p37_746516_c1 3300050507 Bacteria 1079
284 nmdc:mga05p37_901480_c1 3300050507 Unclassified 953
285 nmdc:mga09592_24279_c1 3300050508 Bacteria 5012
286 nmdc:mga09592_353631_c1 3300050508 Unclassified 1271
287 nmdc:mga0n895_125232_c1 3300050512 Bacteria 2593
288 nmdc:mga0n895_128323_c1 3300050512 Unclassified 2560
289 nmdc:mga0n895_354793_c1 3300050512 Bacteria 1485
290 nmdc:mga0rr50_122451_c1 3300050513 Unclassified 2072
291 nmdc:mga0rr50_400134_c1 3300050513 Unclassified 1160
292 nmdc:mga08x19_20_c1 3300050514 Bacteria 304974
293 nmdc:mga08x19_33402_c1 3300050514 Bacteria 3247
294 Ga0495601_0008793 3300053077 Bacteria 5960
295 Ga0501084_0055151 3300054114 Bacteria 3325
296 Ga0501082_0300712 3300060353 Unclassified 1397
297 Ga0530510_0106490 3300061734 Bacteria 2052

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100003306 Ga0070707_10000330616 171
2 3300005471 Ga0070698_100006776 Ga0070698_10000677615 171
3 3300005518 Ga0070699_100012364 Ga0070699_1000123648 171
4 3300005547 Ga0070693_100010869 Ga0070693_1000108694 174
5 3300005614 Ga0068856_100180585 Ga0068856_1001805852 174
6 3300005616 Ga0068852_100026024 Ga0068852_1000260244 174
7 3300006175 Ga0070712_100079071 Ga0070712_1000790712 174
8 3300025898 Ga0207692_10195214 Ga0207692_101952141 174
9 3300025915 Ga0207693_10104841 Ga0207693_101048412 174
10 3300048905 Ga0496102_0027409 Ga0496102_0027409_3190_3783 174
11 3300048915 Ga0496112_0037861 Ga0496112_0037861_1615_2208 174
12 3300005458 Ga0070681_10849611 Ga0070681_108496111 178
13 3300025912 Ga0207707_10611620 Ga0207707_106116202 178
14 3300026095 Ga0207676_10441734 Ga0207676_104417342 184
15 3300005518 Ga0070699_100248537 Ga0070699_1002485372 188
16 3300005436 Ga0070713_100189550 Ga0070713_1001895501 189
17 3300005458 Ga0070681_10053179 Ga0070681_100531792 189
18 3300011119 Ga0105246_10278664 Ga0105246_102786642 189
19 3300025928 Ga0207700_10007326 Ga0207700_100073265 189
20 3300026142 Ga0207698_10409081 Ga0207698_104090812 189
21 3300041496 Ga0451839_0682334 Ga0451839_0682334_385_1026 189
22 3300005336 Ga0070680_100172193 Ga0070680_1001721932 190
23 3300005338 Ga0068868_100023889 Ga0068868_1000238892 190
24 3300005434 Ga0070709_10129420 Ga0070709_101294202 190
25 3300005435 Ga0070714_100073516 Ga0070714_1000735163 190
26 3300005436 Ga0070713_100026641 Ga0070713_1000266414 190
27 3300005436 Ga0070713_100087054 Ga0070713_1000870541 190
28 3300005437 Ga0070710_10389211 Ga0070710_103892111 190
29 3300005439 Ga0070711_100042678 Ga0070711_1000426782 190
30 3300005535 Ga0070684_100038880 Ga0070684_1000388803 190
31 3300005549 Ga0070704_100566767 Ga0070704_1005667671 190
32 3300005577 Ga0068857_100294525 Ga0068857_1002945252 190
33 3300005616 Ga0068852_100451608 Ga0068852_1004516081 190
34 3300005844 Ga0068862_100068383 Ga0068862_1000683834 190
35 3300006028 Ga0070717_10027811 Ga0070717_100278115 190
36 3300006175 Ga0070712_100041842 Ga0070712_1000418422 190
37 3300006871 Ga0075434_101033426 Ga0075434_1010334261 190
38 3300006880 Ga0075429_100049220 Ga0075429_1000492205 190
39 3300007265 Ga0099794_10190880 Ga0099794_101908802 190
40 3300007788 Ga0099795_10004895 Ga0099795_100048951 190
41 3300009098 Ga0105245_10015195 Ga0105245_100151955 190
42 3300009147 Ga0114129_10960107 Ga0114129_109601072 190
43 3300009176 Ga0105242_10075634 Ga0105242_100756343 190
44 3300010375 Ga0105239_11380257 Ga0105239_113802572 190
45 3300013105 Ga0157369_10033368 Ga0157369_100333684 190
46 3300013105 Ga0157369_10127491 Ga0157369_101274913 190
47 3300013296 Ga0157374_10870973 Ga0157374_108709731 190
48 3300025898 Ga0207692_10347261 Ga0207692_103472611 190
49 3300025912 Ga0207707_10194554 Ga0207707_101945542 190
50 3300025915 Ga0207693_10042709 Ga0207693_100427092 190
51 3300025916 Ga0207663_10172269 Ga0207663_101722692 190
52 3300025924 Ga0207694_10051388 Ga0207694_100513883 190
53 3300025927 Ga0207687_10036323 Ga0207687_100363233 190
54 3300025928 Ga0207700_10031266 Ga0207700_100312664 190
55 3300025929 Ga0207664_10195762 Ga0207664_101957622 190
56 3300025934 Ga0207686_10189529 Ga0207686_101895292 190
57 3300025944 Ga0207661_10140300 Ga0207661_101403001 190
58 3300026023 Ga0207677_10079154 Ga0207677_100791543 190
59 3300026116 Ga0207674_10321118 Ga0207674_103211182 190
60 3300027671 Ga0209588_1024719 Ga0209588_10247192 190
61 3300028800 Ga0265338_10321546 Ga0265338_103215462 190
62 3300035410 Ga0373924_0270840 Ga0373924_0270840_90_734 190
63 3300035692 Ga0373935_0001133 Ga0373935_0001133_224_865 190
64 3300035695 Ga0373927_0202494 Ga0373927_0202494_398_1039 190
65 3300035724 Ga0373933_0079255 Ga0373933_0079255_1264_1911 190
66 3300035725 Ga0373947_0002708 Ga0373947_0002708_9704_10345 190
67 3300036401 Ga0373937_0103284 Ga0373937_0103284_914_1561 190
68 3300036401 Ga0373937_0133028 Ga0373937_0133028_65_709 190
69 3300037068 Ga0373925_0086254 Ga0373925_0086254_1414_2055 190
70 3300046462 Ga0495651_0017059 Ga0495651_0017059_4967_5611 190
71 3300046462 Ga0495651_0507919 Ga0495651_0507919_34_675 190
72 3300046473 Ga0495582_0248686 Ga0495582_0248686_225_866 190
73 3300046475 Ga0495639_0118122 Ga0495639_0118122_569_1210 190
74 3300046517 Ga0495630_0007796 Ga0495630_0007796_514_1155 190
75 3300046559 Ga0495667_0009194 Ga0495667_0009194_5990_6631 190
76 3300046663 Ga0495635_0369574 Ga0495635_0369574_80_721 190
77 3300046679 Ga0495623_0056699 Ga0495623_0056699_576_1217 190
78 3300047315 Ga0495581_0047179 Ga0495581_0047179_1591_2232 190
79 3300047315 Ga0495581_0048381 Ga0495581_0048381_1752_2393 190
80 3300048907 Ga0496104_0016409 Ga0496104_0016409_2981_3652 190
81 3300048907 Ga0496104_0037845 Ga0496104_0037845_3476_4147 190
82 3300048908 Ga0496105_0011590 Ga0496105_0011590_5065_5739 190
83 3300048913 Ga0496110_0178140 Ga0496110_0178140_1088_1732 190
84 3300048914 Ga0496111_0023135 Ga0496111_0023135_1468_2112 190
85 3300048915 Ga0496112_1024394 Ga0496112_1024394_13_687 190
86 3300048916 Ga0496113_0001910 Ga0496113_0001910_9369_10010 190
87 3300050507 nmdc:mga05p37_746516_c1 nmdc:mga05p37_746516_c1_290_922 190
88 3300050508 nmdc:mga09592_24279_c1 nmdc:mga09592_24279_c1_2232_2864 190
89 3300053077 Ga0495601_0008793 Ga0495601_0008793_1234_1890 190
90 3300005468 Ga0070707_100377574 Ga0070707_1003775741 191
91 3300006028 Ga0070717_10083200 Ga0070717_100832002 191
92 3300006163 Ga0070715_10050089 Ga0070715_100500892 191
93 3300006175 Ga0070712_100077853 Ga0070712_1000778532 191
94 3300025915 Ga0207693_10010812 Ga0207693_100108123 191
95 3300025928 Ga0207700_10541436 Ga0207700_105414362 191
96 3300025929 Ga0207664_10580865 Ga0207664_105808651 191
97 3300025939 Ga0207665_10079165 Ga0207665_100791652 191
98 3300035172 Ga0373955_0003329 Ga0373955_0003329_791_1438 191
99 3300035410 Ga0373924_0084213 Ga0373924_0084213_608_1264 191
100 3300036401 Ga0373937_0034916 Ga0373937_0034916_2435_3082 191
101 3300037068 Ga0373925_0009082 Ga0373925_0009082_6457_7104 191
102 3300045049 Ga0466959_0008805 Ga0466959_0008805_780_1370 191
103 3300046499 Ga0495594_0227109 Ga0495594_0227109_345_992 191
104 3300050513 nmdc:mga0rr50_122451_c1 nmdc:mga0rr50_122451_c1_336_917 191
105 3300005293 Ga0065715_10273213 Ga0065715_102732131 192
106 3300005343 Ga0070687_100033313 Ga0070687_1000333134 192
107 3300005406 Ga0070703_10000164 Ga0070703_1000016414 192
108 3300005439 Ga0070711_100000010 Ga0070711_10000001083 192
109 3300005440 Ga0070705_100000590 Ga0070705_10000059015 192
110 3300005440 Ga0070705_100073440 Ga0070705_1000734402 192
111 3300005440 Ga0070705_100330535 Ga0070705_1003305352 192
112 3300005441 Ga0070700_100526169 Ga0070700_1005261692 192
113 3300005444 Ga0070694_100049210 Ga0070694_1000492103 192
114 3300005444 Ga0070694_100309491 Ga0070694_1003094912 192
115 3300005444 Ga0070694_100394025 Ga0070694_1003940252 192
116 3300005445 Ga0070708_100094051 Ga0070708_1000940512 192
117 3300005467 Ga0070706_100006423 Ga0070706_1000064234 192
118 3300005468 Ga0070707_100000001 Ga0070707_100000001118 192
119 3300005468 Ga0070707_100593732 Ga0070707_1005937321 192
120 3300005518 Ga0070699_100000090 Ga0070699_10000009056 192
121 3300005518 Ga0070699_100065612 Ga0070699_1000656123 192
122 3300005536 Ga0070697_100000949 Ga0070697_1000009499 192
123 3300005536 Ga0070697_100154715 Ga0070697_1001547153 192
124 3300005536 Ga0070697_100213339 Ga0070697_1002133391 192
125 3300005545 Ga0070695_100118896 Ga0070695_1001188962 192
126 3300005545 Ga0070695_100190406 Ga0070695_1001904062 192
127 3300005546 Ga0070696_100000001 Ga0070696_10000000145 192
128 3300005546 Ga0070696_100001311 Ga0070696_1000013114 192
129 3300005546 Ga0070696_100145267 Ga0070696_1001452673 192
130 3300005549 Ga0070704_100129408 Ga0070704_1001294082 192
131 3300005617 Ga0068859_100406049 Ga0068859_1004060492 192
132 3300005843 Ga0068860_100008958 Ga0068860_1000089585 192
133 3300006237 Ga0097621_100972943 Ga0097621_1009729431 192
134 3300006852 Ga0075433_10801335 Ga0075433_108013351 192
135 3300006871 Ga0075434_100081335 Ga0075434_1000813354 192
136 3300006871 Ga0075434_100288071 Ga0075434_1002880712 192
137 3300006880 Ga0075429_100161205 Ga0075429_1001612051 192
138 3300006914 Ga0075436_100000854 Ga0075436_10000085422 192
139 3300006914 Ga0075436_100065023 Ga0075436_1000650232 192
140 3300006931 Ga0097620_100406064 Ga0097620_1004060642 192
141 3300007076 Ga0075435_100668233 Ga0075435_1006682331 192
142 3300007788 Ga0099795_10063914 Ga0099795_100639142 192
143 3300009094 Ga0111539_10341593 Ga0111539_103415933 192
144 3300009098 Ga0105245_10244757 Ga0105245_102447572 192
145 3300009101 Ga0105247_10080130 Ga0105247_100801303 192
146 3300009147 Ga0114129_10022848 Ga0114129_100228483 192
147 3300009147 Ga0114129_10652438 Ga0114129_106524381 192
148 3300009147 Ga0114129_10845364 Ga0114129_108453641 192
149 3300009148 Ga0105243_10371284 Ga0105243_103712842 192
150 3300009176 Ga0105242_10228750 Ga0105242_102287502 192
151 3300009177 Ga0105248_10162391 Ga0105248_101623913 192
152 3300009177 Ga0105248_10272359 Ga0105248_102723593 192
153 3300010375 Ga0105239_10087207 Ga0105239_100872073 192
154 3300011119 Ga0105246_10342722 Ga0105246_103427222 192
155 3300013297 Ga0157378_10000496 Ga0157378_1000049633 192
156 3300013306 Ga0163162_10049791 Ga0163162_100497912 192
157 3300014325 Ga0163163_10714682 Ga0163163_107146821 192
158 3300014326 Ga0157380_11025791 Ga0157380_110257912 192
159 3300014968 Ga0157379_10064739 Ga0157379_100647393 192
160 3300025885 Ga0207653_10000348 Ga0207653_1000034814 192
161 3300025904 Ga0207647_10418610 Ga0207647_104186101 192
162 3300025910 Ga0207684_10000102 Ga0207684_1000010254 192
163 3300025916 Ga0207663_10000005 Ga0207663_10000005140 192
164 3300025918 Ga0207662_10086819 Ga0207662_100868194 192
165 3300025922 Ga0207646_10000029 Ga0207646_1000002984 192
166 3300025922 Ga0207646_10196486 Ga0207646_101964864 192
167 3300025923 Ga0207681_10019128 Ga0207681_100191282 192
168 3300025923 Ga0207681_10657989 Ga0207681_106579891 192
169 3300025935 Ga0207709_10319432 Ga0207709_103194321 192
170 3300025941 Ga0207711_10127146 Ga0207711_101271463 192
171 3300025941 Ga0207711_10376976 Ga0207711_103769762 192
172 3300026023 Ga0207677_10288757 Ga0207677_102887572 192
173 3300026075 Ga0207708_10605801 Ga0207708_106058011 192
174 3300026095 Ga0207676_10263227 Ga0207676_102632272 192
175 3300026118 Ga0207675_100358278 Ga0207675_1003582781 192
176 3300027907 Ga0207428_10035484 Ga0207428_100354845 192
177 3300027907 Ga0207428_10406253 Ga0207428_104062531 192
178 3300028381 Ga0268264_10010115 Ga0268264_100101152 192
179 3300035083 Ga0373926_0047427 Ga0373926_0047427_132_788 192
180 3300046472 Ga0495580_0039542 Ga0495580_0039542_2530_3186 192
181 3300046517 Ga0495630_0249604 Ga0495630_0249604_680_1336 192
182 3300046539 Ga0495621_0074877 Ga0495621_0074877_527_1165 192
183 3300047319 Ga0495674_0018405 Ga0495674_0018405_70_726 192
184 3300048903 Ga0496100_0060135 Ga0496100_0060135_644_1300 192
185 3300049568 Ga0501031_0332190 Ga0501031_0332190_107_745 192
186 3300049576 Ga0501040_0050155 Ga0501040_0050155_1994_2632 192
187 3300049582 Ga0501048_0199525 Ga0501048_0199525_194_832 192
188 3300049590 Ga0501074_0174130 Ga0501074_0174130_790_1431 192
189 3300049591 Ga0501075_0501950 Ga0501075_0501950_178_816 192
190 3300049592 Ga0501076_0223067 Ga0501076_0223067_333_971 192
191 3300049741 Ga0501079_0054019 Ga0501079_0054019_2194_2832 192
192 3300050507 nmdc:mga05p37_256_c1 nmdc:mga05p37_256_c1_18316_18954 192
193 3300050507 nmdc:mga05p37_715093_c1 nmdc:mga05p37_715093_c1_438_1079 192
194 3300050507 nmdc:mga05p37_901480_c1 nmdc:mga05p37_901480_c1_286_930 192
195 3300050508 nmdc:mga09592_353631_c1 nmdc:mga09592_353631_c1_501_1145 192
196 3300050512 nmdc:mga0n895_125232_c1 nmdc:mga0n895_125232_c1_1083_1721 192
197 3300050512 nmdc:mga0n895_354793_c1 nmdc:mga0n895_354793_c1_736_1374 192
198 3300050513 nmdc:mga0rr50_400134_c1 nmdc:mga0rr50_400134_c1_488_1126 192
199 3300050514 nmdc:mga08x19_20_c1 nmdc:mga08x19_20_c1_263_871 192
200 3300050514 nmdc:mga08x19_33402_c1 nmdc:mga08x19_33402_c1_2146_2802 192
201 3300054114 Ga0501084_0055151 Ga0501084_0055151_2610_3248 192
202 3300060353 Ga0501082_0300712 Ga0501082_0300712_508_1146 192
203 3300061734 Ga0530510_0106490 Ga0530510_0106490_161_802 192
204 3300005330 Ga0070690_100038484 Ga0070690_1000384843 193
205 3300005330 Ga0070690_100051653 Ga0070690_1000516533 193
206 3300005336 Ga0070680_100012488 Ga0070680_1000124886 193
207 3300005434 Ga0070709_10465093 Ga0070709_104650932 193
208 3300005440 Ga0070705_100000809 Ga0070705_10000080914 193
209 3300005444 Ga0070694_100001600 Ga0070694_1000016007 193
210 3300005444 Ga0070694_100009187 Ga0070694_1000091873 193
211 3300005445 Ga0070708_100001390 Ga0070708_10000139013 193
212 3300005445 Ga0070708_100069293 Ga0070708_1000692932 193
213 3300005445 Ga0070708_100078813 Ga0070708_1000788131 193
214 3300005467 Ga0070706_100053027 Ga0070706_1000530273 193
215 3300005518 Ga0070699_100025563 Ga0070699_1000255634 193
216 3300005518 Ga0070699_100101576 Ga0070699_1001015765 193
217 3300005530 Ga0070679_100012641 Ga0070679_1000126418 193
218 3300005536 Ga0070697_100324160 Ga0070697_1003241601 193
219 3300005545 Ga0070695_100003308 Ga0070695_1000033083 193
220 3300005546 Ga0070696_100001149 Ga0070696_1000011493 193
221 3300005547 Ga0070693_100000054 Ga0070693_10000005415 193
222 3300005547 Ga0070693_100131539 Ga0070693_1001315392 193
223 3300005549 Ga0070704_100007216 Ga0070704_1000072164 193
224 3300006173 Ga0070716_100682748 Ga0070716_1006827481 193
225 3300007265 Ga0099794_10021338 Ga0099794_100213382 193
226 3300009147 Ga0114129_10835902 Ga0114129_108359021 193
227 3300009147 Ga0114129_11646976 Ga0114129_116469761 193
228 3300013297 Ga0157378_10097844 Ga0157378_100978442 193
229 3300013297 Ga0157378_10442915 Ga0157378_104429152 193
230 3300025906 Ga0207699_10274686 Ga0207699_102746862 193
231 3300025910 Ga0207684_10013380 Ga0207684_100133805 193
232 3300025917 Ga0207660_10066720 Ga0207660_100667203 193
233 3300025921 Ga0207652_10023838 Ga0207652_100238384 193
234 3300025922 Ga0207646_10729195 Ga0207646_107291952 193
235 3300026023 Ga0207677_10527968 Ga0207677_105279681 193
236 3300027671 Ga0209588_1037936 Ga0209588_10379363 193
237 3300037068 Ga0373925_0566737 Ga0373925_0566737_141_785 193
238 3300042876 Ga0451577_0417666 Ga0451577_0417666_446_1090 193
239 3300042876 Ga0451577_0426345 Ga0451577_0426345_153_797 193
240 3300044673 Ga0453683_0009925 Ga0453683_0009925_2367_3011 193
241 3300044712 Ga0453684_0003355 Ga0453684_0003355_29317_29961 193
242 3300044712 Ga0453684_0046591 Ga0453684_0046591_2496_3140 193
243 3300045051 Ga0451576_0157281 Ga0451576_0157281_172_816 193
244 3300046472 Ga0495580_0034002 Ga0495580_0034002_165_827 193
245 3300050507 nmdc:mga05p37_471961_c1 nmdc:mga05p37_471961_c1_812_1396 193
246 3300004800 Ga0058861_11258896 Ga0058861_112588961 194
247 3300005563 Ga0068855_100115943 Ga0068855_1001159432 194
248 3300005937 Ga0081455_10012499 Ga0081455_100124996 194
249 3300009147 Ga0114129_10142688 Ga0114129_101426883 194
250 3300010375 Ga0105239_10769844 Ga0105239_107698442 194
251 3300013105 Ga0157369_10083310 Ga0157369_100833102 194
252 3300013105 Ga0157369_10148118 Ga0157369_101481185 194
253 3300025917 Ga0207660_10084155 Ga0207660_100841552 194
254 3300025949 Ga0207667_10013767 Ga0207667_100137678 194
255 3300048903 Ga0496100_0510068 Ga0496100_0510068_168_890 194
256 3300048905 Ga0496102_0219035 Ga0496102_0219035_271_993 194
257 3300048906 Ga0496103_0363360 Ga0496103_0363360_123_845 194
258 3300050507 nmdc:mga05p37_265852_c1 nmdc:mga05p37_265852_c1_486_1139 194
259 3300005334 Ga0068869_100244214 Ga0068869_1002442143 196
260 3300005340 Ga0070689_100258899 Ga0070689_1002588993 196
261 3300005467 Ga0070706_100179980 Ga0070706_1001799803 196
262 3300005468 Ga0070707_100749114 Ga0070707_1007491142 196
263 3300005618 Ga0068864_100069895 Ga0068864_1000698955 196
264 3300005843 Ga0068860_100254948 Ga0068860_1002549481 196
265 3300006914 Ga0075436_100227652 Ga0075436_1002276522 196
266 3300025922 Ga0207646_10440753 Ga0207646_104407531 196
267 3300025942 Ga0207689_10350913 Ga0207689_103509132 196
268 3300028381 Ga0268264_10220404 Ga0268264_102204041 196
269 2162886006 SwRhRL3b_contig_2111430 SwRhRL3b_0361.00001970 197
270 3300005437 Ga0070710_10302214 Ga0070710_103022142 197
271 3300005440 Ga0070705_100551585 Ga0070705_1005515851 197
272 3300005441 Ga0070700_100226699 Ga0070700_1002266992 197
273 3300005444 Ga0070694_100058323 Ga0070694_1000583233 197
274 3300005468 Ga0070707_100017087 Ga0070707_1000170875 197
275 3300005518 Ga0070699_100794295 Ga0070699_1007942951 197
276 3300005546 Ga0070696_100346839 Ga0070696_1003468392 197
277 3300005549 Ga0070704_100032428 Ga0070704_1000324284 197
278 3300005577 Ga0068857_100140211 Ga0068857_1001402112 197
279 3300005617 Ga0068859_100009568 Ga0068859_1000095683 197
280 3300005617 Ga0068859_100039013 Ga0068859_1000390134 197
281 3300005618 Ga0068864_100391730 Ga0068864_1003917302 197
282 3300005844 Ga0068862_100254660 Ga0068862_1002546602 197
283 3300006844 Ga0075428_100494565 Ga0075428_1004945651 197
284 3300006871 Ga0075434_100646067 Ga0075434_1006460672 197
285 3300006880 Ga0075429_100424946 Ga0075429_1004249462 197
286 3300006931 Ga0097620_100009565 Ga0097620_1000095653 197
287 3300006931 Ga0097620_100039014 Ga0097620_1000390144 197
288 3300007265 Ga0099794_10017110 Ga0099794_100171103 197
289 3300009148 Ga0105243_10000096 Ga0105243_1000009665 197
290 3300009176 Ga0105242_10002474 Ga0105242_1000247410 197
291 3300025898 Ga0207692_10249061 Ga0207692_102490612 197
292 3300025934 Ga0207686_10000026 Ga0207686_1000002667 197
293 3300025935 Ga0207709_10000142 Ga0207709_1000014266 197
294 3300026089 Ga0207648_10302087 Ga0207648_103020873 197
295 3300026116 Ga0207674_10354665 Ga0207674_103546652 197
296 3300028380 Ga0268265_10075744 Ga0268265_100757443 197
297 3300050512 nmdc:mga0n895_128323_c1 nmdc:mga0n895_128323_c1_169_762 197

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ax2-assembly3.cif.gz_E crystal structure of rat tom20-aldh presequence complex: a disulfide-tethered complex with a non-optimized, long linker 0.9536 110 144
4ja7-assembly1.cif.gz_A rat pp5 co-crystallized with p5sa-2 0.934 110 157
4gcn-assembly2.cif.gz_B n-terminal domain of stress-induced protein-1 (sti-1) from c.elegans 0.9277 107 157
6hpg-assembly4.cif.gz_D arabidopsis om64 tpr domain 0.9238 110 157
6q3q-assembly1.cif.gz_B arabidopsis om64 tpr domain 0.9223 110 157
ID Description Score Start End Superfamily
af_Q54D83_458_612_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9478 109 157 1.25.40.10
af_C6KSL8_218_286_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9449 114 157 1.25.40.10
af_C6KTE5_218_285_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9446 114 157 1.25.40.10
af_I1MHE8_338_489_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9436 114 157 1.25.40.10
af_I1L1N9_297_477_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9429 114 157 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2M8BES3-F1-model_v4 Protein kinase domain-containing protein 0.9346 105 157 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0016020
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A1V6IFX7-F1-model_v4 Lipoprotein NlpI 0.8983 107 157
AF-A0A126SXY6-F1-model_v4 Putative MSHA biogenesis protein MshN 0.8978 107 157 GO:0016020
AF-A0A537YGQ1-F1-model_v4 Tetratricopeptide repeat protein 0.8918 68 186
AF-A0A538IG26-F1-model_v4 Tetratricopeptide repeat protein 0.8915 68 186

Feature Viewer

pLDDT pTM Quality
76.91 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map