F393887
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 297 | 158 | 297 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300048903|Ga0496100_0510068|Ga0496100_0510068_168_890 |
| Length | 240 |
| Sequence | LDLPGWQAIYQQLKDKNFEIISVAQDTGGAKDAGPWIDPLHYLEAKPGLPKETIETARKIGPLGYTVLIDEKHLVSKLYNMVNVPTGVWINEKGRIVRPNEVAFVDDRFKNFSGLDSAPYLSALKDWVERGEKSAYVMSEDRLREKLAAQDPSLAMAAAEFGLGEQLYKSGHAAEAIPHFKEAQRLNPRSWSYKRQAWALSDAKRDYGTSFREEVDKIGGSKVYYTPPDLPAEKKPEKPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 54 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 108 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 109 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 110 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 112 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 113 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 117 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 118 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 119 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 120 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 121 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 122 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 136 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 137 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 138 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 139 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 140 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 141 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 142 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 143 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.38 |
| Rhizosphere | 95.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_2111430 | 2162886006 | Unclassified | 1025 |
| 2 | Ga0058861_11258896 | 3300004800 | Unclassified | 1063 |
| 3 | Ga0065715_10273213 | 3300005293 | Unclassified | 1093 |
| 4 | Ga0070690_100038484 | 3300005330 | Bacteria | 3019 |
| 5 | Ga0070690_100051653 | 3300005330 | Unclassified | 2625 |
| 6 | Ga0068869_100244214 | 3300005334 | Unclassified | 1431 |
| 7 | Ga0070680_100012488 | 3300005336 | Bacteria | 6601 |
| 8 | Ga0070680_100172193 | 3300005336 | Bacteria | 1822 |
| 9 | Ga0068868_100023889 | 3300005338 | Bacteria | 4632 |
| 10 | Ga0070689_100258899 | 3300005340 | Unclassified | 1438 |
| 11 | Ga0070687_100033313 | 3300005343 | Bacteria | 2542 |
| 12 | Ga0070703_10000164 | 3300005406 | Bacteria | 33085 |
| 13 | Ga0070709_10129420 | 3300005434 | Unclassified | 1721 |
| 14 | Ga0070709_10465093 | 3300005434 | Unclassified | 955 |
| 15 | Ga0070714_100073516 | 3300005435 | Bacteria | 2962 |
| 16 | Ga0070713_100026641 | 3300005436 | Bacteria | 4542 |
| 17 | Ga0070713_100087054 | 3300005436 | Unclassified | 2679 |
| 18 | Ga0070713_100189550 | 3300005436 | Bacteria | 1852 |
| 19 | Ga0070710_10302214 | 3300005437 | Unclassified | 1045 |
| 20 | Ga0070710_10389211 | 3300005437 | Bacteria | 932 |
| 21 | Ga0070711_100000010 | 3300005439 | Bacteria | 164614 |
| 22 | Ga0070711_100042678 | 3300005439 | Unclassified | 3067 |
| 23 | Ga0070705_100000590 | 3300005440 | Bacteria | 21129 |
| 24 | Ga0070705_100000809 | 3300005440 | Bacteria | 17643 |
| 25 | Ga0070705_100073440 | 3300005440 | Unclassified | 2076 |
| 26 | Ga0070705_100330535 | 3300005440 | Unclassified | 1104 |
| 27 | Ga0070705_100551585 | 3300005440 | Unclassified | 884 |
| 28 | Ga0070700_100226699 | 3300005441 | Bacteria | 1327 |
| 29 | Ga0070700_100526169 | 3300005441 | Unclassified | 914 |
| 30 | Ga0070694_100001600 | 3300005444 | Bacteria | 13292 |
| 31 | Ga0070694_100009187 | 3300005444 | Bacteria | 6063 |
| 32 | Ga0070694_100049210 | 3300005444 | Unclassified | 2838 |
| 33 | Ga0070694_100058323 | 3300005444 | Bacteria | 2626 |
| 34 | Ga0070694_100309491 | 3300005444 | Bacteria | 1213 |
| 35 | Ga0070694_100394025 | 3300005444 | Bacteria | 1083 |
| 36 | Ga0070708_100001390 | 3300005445 | Bacteria | 18506 |
| 37 | Ga0070708_100069293 | 3300005445 | Bacteria | 3172 |
| 38 | Ga0070708_100078813 | 3300005445 | Bacteria | 2978 |
| 39 | Ga0070708_100094051 | 3300005445 | Unclassified | 2734 |
| 40 | Ga0070681_10053179 | 3300005458 | Bacteria | 4035 |
| 41 | Ga0070681_10849611 | 3300005458 | Bacteria | 830 |
| 42 | Ga0070706_100006423 | 3300005467 | Bacteria | 11105 |
| 43 | Ga0070706_100053027 | 3300005467 | Bacteria | 3743 |
| 44 | Ga0070706_100179980 | 3300005467 | Bacteria | 1974 |
| 45 | Ga0070707_100000001 | 3300005468 | Bacteria | 320358 |
| 46 | Ga0070707_100003306 | 3300005468 | Bacteria | 15220 |
| 47 | Ga0070707_100017087 | 3300005468 | Bacteria | 6814 |
| 48 | Ga0070707_100377574 | 3300005468 | Unclassified | 1377 |
| 49 | Ga0070707_100593732 | 3300005468 | Bacteria | 1070 |
| 50 | Ga0070707_100749114 | 3300005468 | Unclassified | 940 |
| 51 | Ga0070698_100006776 | 3300005471 | Bacteria | 12420 |
| 52 | Ga0070699_100000090 | 3300005518 | Bacteria | 87042 |
| 53 | Ga0070699_100012364 | 3300005518 | Bacteria | 7364 |
| 54 | Ga0070699_100025563 | 3300005518 | Bacteria | 5089 |
| 55 | Ga0070699_100065612 | 3300005518 | Bacteria | 3151 |
| 56 | Ga0070699_100101576 | 3300005518 | Bacteria | 2521 |
| 57 | Ga0070699_100248537 | 3300005518 | Bacteria | 1589 |
| 58 | Ga0070699_100794295 | 3300005518 | Unclassified | 866 |
| 59 | Ga0070679_100012641 | 3300005530 | Bacteria | 8075 |
| 60 | Ga0070684_100038880 | 3300005535 | Bacteria | 4090 |
| 61 | Ga0070697_100000949 | 3300005536 | Bacteria | 21843 |
| 62 | Ga0070697_100154715 | 3300005536 | Unclassified | 1935 |
| 63 | Ga0070697_100213339 | 3300005536 | Bacteria | 1644 |
| 64 | Ga0070697_100324160 | 3300005536 | Bacteria | 1327 |
| 65 | Ga0070695_100003308 | 3300005545 | Bacteria | 9420 |
| 66 | Ga0070695_100118896 | 3300005545 | Unclassified | 1805 |
| 67 | Ga0070695_100190406 | 3300005545 | Bacteria | 1459 |
| 68 | Ga0070696_100000001 | 3300005546 | Bacteria | 174282 |
| 69 | Ga0070696_100001149 | 3300005546 | Bacteria | 17168 |
| 70 | Ga0070696_100001311 | 3300005546 | Bacteria | 16240 |
| 71 | Ga0070696_100145267 | 3300005546 | Unclassified | 1737 |
| 72 | Ga0070696_100346839 | 3300005546 | Unclassified | 1149 |
| 73 | Ga0070693_100000054 | 3300005547 | Bacteria | 43910 |
| 74 | Ga0070693_100010869 | 3300005547 | Bacteria | 4571 |
| 75 | Ga0070693_100131539 | 3300005547 | Unclassified | 1565 |
| 76 | Ga0070704_100007216 | 3300005549 | Bacteria | 6607 |
| 77 | Ga0070704_100032428 | 3300005549 | Bacteria | 3524 |
| 78 | Ga0070704_100129408 | 3300005549 | Bacteria | 1954 |
| 79 | Ga0070704_100566767 | 3300005549 | Unclassified | 994 |
| 80 | Ga0068855_100115943 | 3300005563 | Unclassified | 3070 |
| 81 | Ga0068857_100140211 | 3300005577 | Bacteria | 2185 |
| 82 | Ga0068857_100294525 | 3300005577 | Unclassified | 1495 |
| 83 | Ga0068856_100180585 | 3300005614 | Bacteria | 2123 |
| 84 | Ga0068852_100026024 | 3300005616 | Bacteria | 4749 |
| 85 | Ga0068852_100451608 | 3300005616 | Bacteria | 1272 |
| 86 | Ga0068859_100009568 | 3300005617 | Bacteria | 9787 |
| 87 | Ga0068859_100039013 | 3300005617 | Bacteria | 4763 |
| 88 | Ga0068859_100406049 | 3300005617 | Bacteria | 1458 |
| 89 | Ga0068864_100069895 | 3300005618 | Bacteria | 3054 |
| 90 | Ga0068864_100391730 | 3300005618 | Unclassified | 1319 |
| 91 | Ga0068860_100008958 | 3300005843 | Bacteria | 9969 |
| 92 | Ga0068860_100254948 | 3300005843 | Bacteria | 1709 |
| 93 | Ga0068862_100068383 | 3300005844 | Bacteria | 3064 |
| 94 | Ga0068862_100254660 | 3300005844 | Unclassified | 1601 |
| 95 | Ga0081455_10012499 | 3300005937 | Bacteria | 8469 |
| 96 | Ga0070717_10027811 | 3300006028 | Bacteria | 4521 |
| 97 | Ga0070717_10083200 | 3300006028 | Bacteria | 2690 |
| 98 | Ga0070715_10050089 | 3300006163 | Bacteria | 1792 |
| 99 | Ga0070716_100682748 | 3300006173 | Unclassified | 782 |
| 100 | Ga0070712_100041842 | 3300006175 | Unclassified | 3148 |
| 101 | Ga0070712_100077853 | 3300006175 | Bacteria | 2391 |
| 102 | Ga0070712_100079071 | 3300006175 | Unclassified | 2376 |
| 103 | Ga0097621_100972943 | 3300006237 | Unclassified | 793 |
| 104 | Ga0075428_100494565 | 3300006844 | Bacteria | 1309 |
| 105 | Ga0075433_10801335 | 3300006852 | Bacteria | 823 |
| 106 | Ga0075434_100081335 | 3300006871 | Unclassified | 3237 |
| 107 | Ga0075434_100288071 | 3300006871 | Bacteria | 1662 |
| 108 | Ga0075434_100646067 | 3300006871 | Bacteria | 1076 |
| 109 | Ga0075434_101033426 | 3300006871 | Unclassified | 835 |
| 110 | Ga0075429_100049220 | 3300006880 | Bacteria | 3665 |
| 111 | Ga0075429_100161205 | 3300006880 | Unclassified | 1964 |
| 112 | Ga0075429_100424946 | 3300006880 | Bacteria | 1164 |
| 113 | Ga0075436_100000854 | 3300006914 | Bacteria | 20259 |
| 114 | Ga0075436_100065023 | 3300006914 | Bacteria | 2522 |
| 115 | Ga0075436_100227652 | 3300006914 | Bacteria | 1324 |
| 116 | Ga0097620_100009565 | 3300006931 | Bacteria | 9787 |
| 117 | Ga0097620_100039014 | 3300006931 | Bacteria | 4763 |
| 118 | Ga0097620_100406064 | 3300006931 | Bacteria | 1458 |
| 119 | Ga0075435_100668233 | 3300007076 | Bacteria | 902 |
| 120 | Ga0099794_10017110 | 3300007265 | Unclassified | 3227 |
| 121 | Ga0099794_10021338 | 3300007265 | Bacteria | 2942 |
| 122 | Ga0099794_10190880 | 3300007265 | Bacteria | 1047 |
| 123 | Ga0099795_10004895 | 3300007788 | Bacteria | 3505 |
| 124 | Ga0099795_10063914 | 3300007788 | Bacteria | 1373 |
| 125 | Ga0111539_10341593 | 3300009094 | Unclassified | 1743 |
| 126 | Ga0105245_10015195 | 3300009098 | Bacteria | 6707 |
| 127 | Ga0105245_10244757 | 3300009098 | Unclassified | 1740 |
| 128 | Ga0105247_10080130 | 3300009101 | Bacteria | 2056 |
| 129 | Ga0114129_10022848 | 3300009147 | Bacteria | 8869 |
| 130 | Ga0114129_10142688 | 3300009147 | Unclassified | 3281 |
| 131 | Ga0114129_10652438 | 3300009147 | Unclassified | 1358 |
| 132 | Ga0114129_10835902 | 3300009147 | Unclassified | 1172 |
| 133 | Ga0114129_10845364 | 3300009147 | Bacteria | 1164 |
| 134 | Ga0114129_10960107 | 3300009147 | Bacteria | 1079 |
| 135 | Ga0114129_11646976 | 3300009147 | Unclassified | 784 |
| 136 | Ga0105243_10000096 | 3300009148 | Bacteria | 100257 |
| 137 | Ga0105243_10371284 | 3300009148 | Bacteria | 1320 |
| 138 | Ga0105242_10002474 | 3300009176 | Bacteria | 14490 |
| 139 | Ga0105242_10075634 | 3300009176 | Bacteria | 2804 |
| 140 | Ga0105242_10228750 | 3300009176 | Unclassified | 1666 |
| 141 | Ga0105248_10162391 | 3300009177 | Bacteria | 2519 |
| 142 | Ga0105248_10272359 | 3300009177 | Bacteria | 1906 |
| 143 | Ga0105239_10087207 | 3300010375 | Bacteria | 3440 |
| 144 | Ga0105239_10769844 | 3300010375 | Unclassified | 1102 |
| 145 | Ga0105239_11380257 | 3300010375 | Bacteria | 813 |
| 146 | Ga0105246_10278664 | 3300011119 | Unclassified | 1340 |
| 147 | Ga0105246_10342722 | 3300011119 | Bacteria | 1222 |
| 148 | Ga0157369_10033368 | 3300013105 | Bacteria | 5657 |
| 149 | Ga0157369_10083310 | 3300013105 | Bacteria | 3421 |
| 150 | Ga0157369_10127491 | 3300013105 | Bacteria | 2697 |
| 151 | Ga0157369_10148118 | 3300013105 | Bacteria | 2481 |
| 152 | Ga0157374_10870973 | 3300013296 | Bacteria | 918 |
| 153 | Ga0157378_10000496 | 3300013297 | Bacteria | 37321 |
| 154 | Ga0157378_10097844 | 3300013297 | Bacteria | 2675 |
| 155 | Ga0157378_10442915 | 3300013297 | Unclassified | 1288 |
| 156 | Ga0163162_10049791 | 3300013306 | Bacteria | 4200 |
| 157 | Ga0163163_10714682 | 3300014325 | Bacteria | 1065 |
| 158 | Ga0157380_11025791 | 3300014326 | Bacteria | 860 |
| 159 | Ga0157379_10064739 | 3300014968 | Bacteria | 3267 |
| 160 | Ga0207653_10000348 | 3300025885 | Bacteria | 23233 |
| 161 | Ga0207692_10195214 | 3300025898 | Bacteria | 1187 |
| 162 | Ga0207692_10249061 | 3300025898 | Unclassified | 1064 |
| 163 | Ga0207692_10347261 | 3300025898 | Bacteria | 914 |
| 164 | Ga0207647_10418610 | 3300025904 | Unclassified | 753 |
| 165 | Ga0207699_10274686 | 3300025906 | Unclassified | 1169 |
| 166 | Ga0207684_10000102 | 3300025910 | Bacteria | 162120 |
| 167 | Ga0207684_10013380 | 3300025910 | Bacteria | 7097 |
| 168 | Ga0207707_10194554 | 3300025912 | Bacteria | 1769 |
| 169 | Ga0207707_10611620 | 3300025912 | Bacteria | 921 |
| 170 | Ga0207693_10010812 | 3300025915 | Bacteria | 7409 |
| 171 | Ga0207693_10042709 | 3300025915 | Bacteria | 3569 |
| 172 | Ga0207693_10104841 | 3300025915 | Bacteria | 2217 |
| 173 | Ga0207663_10000005 | 3300025916 | Bacteria | 282473 |
| 174 | Ga0207663_10172269 | 3300025916 | Bacteria | 1538 |
| 175 | Ga0207660_10066720 | 3300025917 | Bacteria | 2604 |
| 176 | Ga0207660_10084155 | 3300025917 | Bacteria | 2344 |
| 177 | Ga0207662_10086819 | 3300025918 | Bacteria | 1918 |
| 178 | Ga0207652_10023838 | 3300025921 | Bacteria | 5074 |
| 179 | Ga0207646_10000029 | 3300025922 | Bacteria | 223317 |
| 180 | Ga0207646_10196486 | 3300025922 | Bacteria | 1822 |
| 181 | Ga0207646_10440753 | 3300025922 | Unclassified | 1175 |
| 182 | Ga0207646_10729195 | 3300025922 | Bacteria | 885 |
| 183 | Ga0207681_10019128 | 3300025923 | Bacteria | 4325 |
| 184 | Ga0207681_10657989 | 3300025923 | Unclassified | 869 |
| 185 | Ga0207694_10051388 | 3300025924 | Bacteria | 3195 |
| 186 | Ga0207687_10036323 | 3300025927 | Bacteria | 3356 |
| 187 | Ga0207700_10007326 | 3300025928 | Bacteria | 6736 |
| 188 | Ga0207700_10031266 | 3300025928 | Bacteria | 3779 |
| 189 | Ga0207700_10541436 | 3300025928 | Unclassified | 1033 |
| 190 | Ga0207664_10195762 | 3300025929 | Bacteria | 1742 |
| 191 | Ga0207664_10580865 | 3300025929 | Bacteria | 1006 |
| 192 | Ga0207686_10000026 | 3300025934 | Bacteria | 169189 |
| 193 | Ga0207686_10189529 | 3300025934 | Bacteria | 1465 |
| 194 | Ga0207709_10000142 | 3300025935 | Bacteria | 100236 |
| 195 | Ga0207709_10319432 | 3300025935 | Unclassified | 1161 |
| 196 | Ga0207665_10079165 | 3300025939 | Bacteria | 2259 |
| 197 | Ga0207711_10127146 | 3300025941 | Bacteria | 2281 |
| 198 | Ga0207711_10376976 | 3300025941 | Unclassified | 1316 |
| 199 | Ga0207689_10350913 | 3300025942 | Unclassified | 1226 |
| 200 | Ga0207661_10140300 | 3300025944 | Bacteria | 2079 |
| 201 | Ga0207667_10013767 | 3300025949 | Bacteria | 9245 |
| 202 | Ga0207677_10079154 | 3300026023 | Bacteria | 2350 |
| 203 | Ga0207677_10288757 | 3300026023 | Unclassified | 1350 |
| 204 | Ga0207677_10527968 | 3300026023 | Unclassified | 1025 |
| 205 | Ga0207708_10605801 | 3300026075 | Unclassified | 928 |
| 206 | Ga0207648_10302087 | 3300026089 | Unclassified | 1436 |
| 207 | Ga0207676_10263227 | 3300026095 | Bacteria | 1558 |
| 208 | Ga0207676_10441734 | 3300026095 | Unclassified | 1225 |
| 209 | Ga0207674_10321118 | 3300026116 | Unclassified | 1498 |
| 210 | Ga0207674_10354665 | 3300026116 | Unclassified | 1418 |
| 211 | Ga0207675_100358278 | 3300026118 | Bacteria | 1431 |
| 212 | Ga0207698_10409081 | 3300026142 | Bacteria | 1299 |
| 213 | Ga0209588_1024719 | 3300027671 | Bacteria | 1898 |
| 214 | Ga0209588_1037936 | 3300027671 | Unclassified | 1552 |
| 215 | Ga0207428_10035484 | 3300027907 | Bacteria | 4076 |
| 216 | Ga0207428_10406253 | 3300027907 | Unclassified | 997 |
| 217 | Ga0268265_10075744 | 3300028380 | Unclassified | 2637 |
| 218 | Ga0268264_10010115 | 3300028381 | Bacteria | 7806 |
| 219 | Ga0268264_10220404 | 3300028381 | Bacteria | 1746 |
| 220 | Ga0265338_10321546 | 3300028800 | Bacteria | 1120 |
| 221 | Ga0373926_0047427 | 3300035083 | Unclassified | 1543 |
| 222 | Ga0373955_0003329 | 3300035172 | Bacteria | 7059 |
| 223 | Ga0373924_0084213 | 3300035410 | Bacteria | 1355 |
| 224 | Ga0373924_0270840 | 3300035410 | Unclassified | 753 |
| 225 | Ga0373935_0001133 | 3300035692 | Bacteria | 14565 |
| 226 | Ga0373927_0202494 | 3300035695 | Unclassified | 1303 |
| 227 | Ga0373933_0079255 | 3300035724 | Bacteria | 2011 |
| 228 | Ga0373947_0002708 | 3300035725 | Bacteria | 10637 |
| 229 | Ga0373937_0034916 | 3300036401 | Bacteria | 4575 |
| 230 | Ga0373937_0103284 | 3300036401 | Bacteria | 2647 |
| 231 | Ga0373937_0133028 | 3300036401 | Bacteria | 2324 |
| 232 | Ga0373925_0009082 | 3300037068 | Bacteria | 7236 |
| 233 | Ga0373925_0086254 | 3300037068 | Bacteria | 2394 |
| 234 | Ga0373925_0566737 | 3300037068 | Unclassified | 934 |
| 235 | Ga0451839_0682334 | 3300041496 | Bacteria | 1066 |
| 236 | Ga0451577_0417666 | 3300042876 | Bacteria | 1218 |
| 237 | Ga0451577_0426345 | 3300042876 | Bacteria | 1204 |
| 238 | Ga0453683_0009925 | 3300044673 | Bacteria | 6335 |
| 239 | Ga0453684_0003355 | 3300044712 | Bacteria | 36253 |
| 240 | Ga0453684_0046591 | 3300044712 | Bacteria | 5764 |
| 241 | Ga0466959_0008805 | 3300045049 | Bacteria | 7150 |
| 242 | Ga0451576_0157281 | 3300045051 | Bacteria | 2371 |
| 243 | Ga0495651_0017059 | 3300046462 | Bacteria | 5626 |
| 244 | Ga0495651_0507919 | 3300046462 | Bacteria | 771 |
| 245 | Ga0495580_0034002 | 3300046472 | Bacteria | 3671 |
| 246 | Ga0495580_0039542 | 3300046472 | Bacteria | 3375 |
| 247 | Ga0495582_0248686 | 3300046473 | Bacteria | 1019 |
| 248 | Ga0495639_0118122 | 3300046475 | Bacteria | 1263 |
| 249 | Ga0495594_0227109 | 3300046499 | Unclassified | 1064 |
| 250 | Ga0495630_0007796 | 3300046517 | Bacteria | 7664 |
| 251 | Ga0495630_0249604 | 3300046517 | Unclassified | 1356 |
| 252 | Ga0495621_0074877 | 3300046539 | Bacteria | 1253 |
| 253 | Ga0495667_0009194 | 3300046559 | Bacteria | 6710 |
| 254 | Ga0495635_0369574 | 3300046663 | Bacteria | 955 |
| 255 | Ga0495623_0056699 | 3300046679 | Bacteria | 2466 |
| 256 | Ga0495581_0047179 | 3300047315 | Bacteria | 2490 |
| 257 | Ga0495581_0048381 | 3300047315 | Bacteria | 2456 |
| 258 | Ga0495674_0018405 | 3300047319 | Bacteria | 6504 |
| 259 | Ga0496100_0060135 | 3300048903 | Bacteria | 2500 |
| 260 | Ga0496100_0510068 | 3300048903 | Bacteria | 927 |
| 261 | Ga0496102_0027409 | 3300048905 | Bacteria | 5088 |
| 262 | Ga0496102_0219035 | 3300048905 | Bacteria | 1794 |
| 263 | Ga0496103_0363360 | 3300048906 | Bacteria | 931 |
| 264 | Ga0496104_0016409 | 3300048907 | Bacteria | 6727 |
| 265 | Ga0496104_0037845 | 3300048907 | Bacteria | 4511 |
| 266 | Ga0496105_0011590 | 3300048908 | Bacteria | 6972 |
| 267 | Ga0496110_0178140 | 3300048913 | Bacteria | 1930 |
| 268 | Ga0496111_0023135 | 3300048914 | Bacteria | 4360 |
| 269 | Ga0496112_0037861 | 3300048915 | Bacteria | 4710 |
| 270 | Ga0496112_1024394 | 3300048915 | Unclassified | 745 |
| 271 | Ga0496113_0001910 | 3300048916 | Bacteria | 11900 |
| 272 | Ga0501031_0332190 | 3300049568 | Unclassified | 984 |
| 273 | Ga0501040_0050155 | 3300049576 | Bacteria | 2854 |
| 274 | Ga0501048_0199525 | 3300049582 | Unclassified | 1418 |
| 275 | Ga0501074_0174130 | 3300049590 | Bacteria | 1536 |
| 276 | Ga0501075_0501950 | 3300049591 | Unclassified | 926 |
| 277 | Ga0501076_0223067 | 3300049592 | Unclassified | 1540 |
| 278 | Ga0501079_0054019 | 3300049741 | Bacteria | 3099 |
| 279 | nmdc:mga05p37_256_c1 | 3300050507 | Bacteria | 54932 |
| 280 | nmdc:mga05p37_265852_c1 | 3300050507 | Bacteria | 2051 |
| 281 | nmdc:mga05p37_471961_c1 | 3300050507 | Bacteria | 1447 |
| 282 | nmdc:mga05p37_715093_c1 | 3300050507 | Unclassified | 1110 |
| 283 | nmdc:mga05p37_746516_c1 | 3300050507 | Bacteria | 1079 |
| 284 | nmdc:mga05p37_901480_c1 | 3300050507 | Unclassified | 953 |
| 285 | nmdc:mga09592_24279_c1 | 3300050508 | Bacteria | 5012 |
| 286 | nmdc:mga09592_353631_c1 | 3300050508 | Unclassified | 1271 |
| 287 | nmdc:mga0n895_125232_c1 | 3300050512 | Bacteria | 2593 |
| 288 | nmdc:mga0n895_128323_c1 | 3300050512 | Unclassified | 2560 |
| 289 | nmdc:mga0n895_354793_c1 | 3300050512 | Bacteria | 1485 |
| 290 | nmdc:mga0rr50_122451_c1 | 3300050513 | Unclassified | 2072 |
| 291 | nmdc:mga0rr50_400134_c1 | 3300050513 | Unclassified | 1160 |
| 292 | nmdc:mga08x19_20_c1 | 3300050514 | Bacteria | 304974 |
| 293 | nmdc:mga08x19_33402_c1 | 3300050514 | Bacteria | 3247 |
| 294 | Ga0495601_0008793 | 3300053077 | Bacteria | 5960 |
| 295 | Ga0501084_0055151 | 3300054114 | Bacteria | 3325 |
| 296 | Ga0501082_0300712 | 3300060353 | Unclassified | 1397 |
| 297 | Ga0530510_0106490 | 3300061734 | Bacteria | 2052 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005468 | Ga0070707_100003306 | Ga0070707_10000330616 | 171 |
| 2 | 3300005471 | Ga0070698_100006776 | Ga0070698_10000677615 | 171 |
| 3 | 3300005518 | Ga0070699_100012364 | Ga0070699_1000123648 | 171 |
| 4 | 3300005547 | Ga0070693_100010869 | Ga0070693_1000108694 | 174 |
| 5 | 3300005614 | Ga0068856_100180585 | Ga0068856_1001805852 | 174 |
| 6 | 3300005616 | Ga0068852_100026024 | Ga0068852_1000260244 | 174 |
| 7 | 3300006175 | Ga0070712_100079071 | Ga0070712_1000790712 | 174 |
| 8 | 3300025898 | Ga0207692_10195214 | Ga0207692_101952141 | 174 |
| 9 | 3300025915 | Ga0207693_10104841 | Ga0207693_101048412 | 174 |
| 10 | 3300048905 | Ga0496102_0027409 | Ga0496102_0027409_3190_3783 | 174 |
| 11 | 3300048915 | Ga0496112_0037861 | Ga0496112_0037861_1615_2208 | 174 |
| 12 | 3300005458 | Ga0070681_10849611 | Ga0070681_108496111 | 178 |
| 13 | 3300025912 | Ga0207707_10611620 | Ga0207707_106116202 | 178 |
| 14 | 3300026095 | Ga0207676_10441734 | Ga0207676_104417342 | 184 |
| 15 | 3300005518 | Ga0070699_100248537 | Ga0070699_1002485372 | 188 |
| 16 | 3300005436 | Ga0070713_100189550 | Ga0070713_1001895501 | 189 |
| 17 | 3300005458 | Ga0070681_10053179 | Ga0070681_100531792 | 189 |
| 18 | 3300011119 | Ga0105246_10278664 | Ga0105246_102786642 | 189 |
| 19 | 3300025928 | Ga0207700_10007326 | Ga0207700_100073265 | 189 |
| 20 | 3300026142 | Ga0207698_10409081 | Ga0207698_104090812 | 189 |
| 21 | 3300041496 | Ga0451839_0682334 | Ga0451839_0682334_385_1026 | 189 |
| 22 | 3300005336 | Ga0070680_100172193 | Ga0070680_1001721932 | 190 |
| 23 | 3300005338 | Ga0068868_100023889 | Ga0068868_1000238892 | 190 |
| 24 | 3300005434 | Ga0070709_10129420 | Ga0070709_101294202 | 190 |
| 25 | 3300005435 | Ga0070714_100073516 | Ga0070714_1000735163 | 190 |
| 26 | 3300005436 | Ga0070713_100026641 | Ga0070713_1000266414 | 190 |
| 27 | 3300005436 | Ga0070713_100087054 | Ga0070713_1000870541 | 190 |
| 28 | 3300005437 | Ga0070710_10389211 | Ga0070710_103892111 | 190 |
| 29 | 3300005439 | Ga0070711_100042678 | Ga0070711_1000426782 | 190 |
| 30 | 3300005535 | Ga0070684_100038880 | Ga0070684_1000388803 | 190 |
| 31 | 3300005549 | Ga0070704_100566767 | Ga0070704_1005667671 | 190 |
| 32 | 3300005577 | Ga0068857_100294525 | Ga0068857_1002945252 | 190 |
| 33 | 3300005616 | Ga0068852_100451608 | Ga0068852_1004516081 | 190 |
| 34 | 3300005844 | Ga0068862_100068383 | Ga0068862_1000683834 | 190 |
| 35 | 3300006028 | Ga0070717_10027811 | Ga0070717_100278115 | 190 |
| 36 | 3300006175 | Ga0070712_100041842 | Ga0070712_1000418422 | 190 |
| 37 | 3300006871 | Ga0075434_101033426 | Ga0075434_1010334261 | 190 |
| 38 | 3300006880 | Ga0075429_100049220 | Ga0075429_1000492205 | 190 |
| 39 | 3300007265 | Ga0099794_10190880 | Ga0099794_101908802 | 190 |
| 40 | 3300007788 | Ga0099795_10004895 | Ga0099795_100048951 | 190 |
| 41 | 3300009098 | Ga0105245_10015195 | Ga0105245_100151955 | 190 |
| 42 | 3300009147 | Ga0114129_10960107 | Ga0114129_109601072 | 190 |
| 43 | 3300009176 | Ga0105242_10075634 | Ga0105242_100756343 | 190 |
| 44 | 3300010375 | Ga0105239_11380257 | Ga0105239_113802572 | 190 |
| 45 | 3300013105 | Ga0157369_10033368 | Ga0157369_100333684 | 190 |
| 46 | 3300013105 | Ga0157369_10127491 | Ga0157369_101274913 | 190 |
| 47 | 3300013296 | Ga0157374_10870973 | Ga0157374_108709731 | 190 |
| 48 | 3300025898 | Ga0207692_10347261 | Ga0207692_103472611 | 190 |
| 49 | 3300025912 | Ga0207707_10194554 | Ga0207707_101945542 | 190 |
| 50 | 3300025915 | Ga0207693_10042709 | Ga0207693_100427092 | 190 |
| 51 | 3300025916 | Ga0207663_10172269 | Ga0207663_101722692 | 190 |
| 52 | 3300025924 | Ga0207694_10051388 | Ga0207694_100513883 | 190 |
| 53 | 3300025927 | Ga0207687_10036323 | Ga0207687_100363233 | 190 |
| 54 | 3300025928 | Ga0207700_10031266 | Ga0207700_100312664 | 190 |
| 55 | 3300025929 | Ga0207664_10195762 | Ga0207664_101957622 | 190 |
| 56 | 3300025934 | Ga0207686_10189529 | Ga0207686_101895292 | 190 |
| 57 | 3300025944 | Ga0207661_10140300 | Ga0207661_101403001 | 190 |
| 58 | 3300026023 | Ga0207677_10079154 | Ga0207677_100791543 | 190 |
| 59 | 3300026116 | Ga0207674_10321118 | Ga0207674_103211182 | 190 |
| 60 | 3300027671 | Ga0209588_1024719 | Ga0209588_10247192 | 190 |
| 61 | 3300028800 | Ga0265338_10321546 | Ga0265338_103215462 | 190 |
| 62 | 3300035410 | Ga0373924_0270840 | Ga0373924_0270840_90_734 | 190 |
| 63 | 3300035692 | Ga0373935_0001133 | Ga0373935_0001133_224_865 | 190 |
| 64 | 3300035695 | Ga0373927_0202494 | Ga0373927_0202494_398_1039 | 190 |
| 65 | 3300035724 | Ga0373933_0079255 | Ga0373933_0079255_1264_1911 | 190 |
| 66 | 3300035725 | Ga0373947_0002708 | Ga0373947_0002708_9704_10345 | 190 |
| 67 | 3300036401 | Ga0373937_0103284 | Ga0373937_0103284_914_1561 | 190 |
| 68 | 3300036401 | Ga0373937_0133028 | Ga0373937_0133028_65_709 | 190 |
| 69 | 3300037068 | Ga0373925_0086254 | Ga0373925_0086254_1414_2055 | 190 |
| 70 | 3300046462 | Ga0495651_0017059 | Ga0495651_0017059_4967_5611 | 190 |
| 71 | 3300046462 | Ga0495651_0507919 | Ga0495651_0507919_34_675 | 190 |
| 72 | 3300046473 | Ga0495582_0248686 | Ga0495582_0248686_225_866 | 190 |
| 73 | 3300046475 | Ga0495639_0118122 | Ga0495639_0118122_569_1210 | 190 |
| 74 | 3300046517 | Ga0495630_0007796 | Ga0495630_0007796_514_1155 | 190 |
| 75 | 3300046559 | Ga0495667_0009194 | Ga0495667_0009194_5990_6631 | 190 |
| 76 | 3300046663 | Ga0495635_0369574 | Ga0495635_0369574_80_721 | 190 |
| 77 | 3300046679 | Ga0495623_0056699 | Ga0495623_0056699_576_1217 | 190 |
| 78 | 3300047315 | Ga0495581_0047179 | Ga0495581_0047179_1591_2232 | 190 |
| 79 | 3300047315 | Ga0495581_0048381 | Ga0495581_0048381_1752_2393 | 190 |
| 80 | 3300048907 | Ga0496104_0016409 | Ga0496104_0016409_2981_3652 | 190 |
| 81 | 3300048907 | Ga0496104_0037845 | Ga0496104_0037845_3476_4147 | 190 |
| 82 | 3300048908 | Ga0496105_0011590 | Ga0496105_0011590_5065_5739 | 190 |
| 83 | 3300048913 | Ga0496110_0178140 | Ga0496110_0178140_1088_1732 | 190 |
| 84 | 3300048914 | Ga0496111_0023135 | Ga0496111_0023135_1468_2112 | 190 |
| 85 | 3300048915 | Ga0496112_1024394 | Ga0496112_1024394_13_687 | 190 |
| 86 | 3300048916 | Ga0496113_0001910 | Ga0496113_0001910_9369_10010 | 190 |
| 87 | 3300050507 | nmdc:mga05p37_746516_c1 | nmdc:mga05p37_746516_c1_290_922 | 190 |
| 88 | 3300050508 | nmdc:mga09592_24279_c1 | nmdc:mga09592_24279_c1_2232_2864 | 190 |
| 89 | 3300053077 | Ga0495601_0008793 | Ga0495601_0008793_1234_1890 | 190 |
| 90 | 3300005468 | Ga0070707_100377574 | Ga0070707_1003775741 | 191 |
| 91 | 3300006028 | Ga0070717_10083200 | Ga0070717_100832002 | 191 |
| 92 | 3300006163 | Ga0070715_10050089 | Ga0070715_100500892 | 191 |
| 93 | 3300006175 | Ga0070712_100077853 | Ga0070712_1000778532 | 191 |
| 94 | 3300025915 | Ga0207693_10010812 | Ga0207693_100108123 | 191 |
| 95 | 3300025928 | Ga0207700_10541436 | Ga0207700_105414362 | 191 |
| 96 | 3300025929 | Ga0207664_10580865 | Ga0207664_105808651 | 191 |
| 97 | 3300025939 | Ga0207665_10079165 | Ga0207665_100791652 | 191 |
| 98 | 3300035172 | Ga0373955_0003329 | Ga0373955_0003329_791_1438 | 191 |
| 99 | 3300035410 | Ga0373924_0084213 | Ga0373924_0084213_608_1264 | 191 |
| 100 | 3300036401 | Ga0373937_0034916 | Ga0373937_0034916_2435_3082 | 191 |
| 101 | 3300037068 | Ga0373925_0009082 | Ga0373925_0009082_6457_7104 | 191 |
| 102 | 3300045049 | Ga0466959_0008805 | Ga0466959_0008805_780_1370 | 191 |
| 103 | 3300046499 | Ga0495594_0227109 | Ga0495594_0227109_345_992 | 191 |
| 104 | 3300050513 | nmdc:mga0rr50_122451_c1 | nmdc:mga0rr50_122451_c1_336_917 | 191 |
| 105 | 3300005293 | Ga0065715_10273213 | Ga0065715_102732131 | 192 |
| 106 | 3300005343 | Ga0070687_100033313 | Ga0070687_1000333134 | 192 |
| 107 | 3300005406 | Ga0070703_10000164 | Ga0070703_1000016414 | 192 |
| 108 | 3300005439 | Ga0070711_100000010 | Ga0070711_10000001083 | 192 |
| 109 | 3300005440 | Ga0070705_100000590 | Ga0070705_10000059015 | 192 |
| 110 | 3300005440 | Ga0070705_100073440 | Ga0070705_1000734402 | 192 |
| 111 | 3300005440 | Ga0070705_100330535 | Ga0070705_1003305352 | 192 |
| 112 | 3300005441 | Ga0070700_100526169 | Ga0070700_1005261692 | 192 |
| 113 | 3300005444 | Ga0070694_100049210 | Ga0070694_1000492103 | 192 |
| 114 | 3300005444 | Ga0070694_100309491 | Ga0070694_1003094912 | 192 |
| 115 | 3300005444 | Ga0070694_100394025 | Ga0070694_1003940252 | 192 |
| 116 | 3300005445 | Ga0070708_100094051 | Ga0070708_1000940512 | 192 |
| 117 | 3300005467 | Ga0070706_100006423 | Ga0070706_1000064234 | 192 |
| 118 | 3300005468 | Ga0070707_100000001 | Ga0070707_100000001118 | 192 |
| 119 | 3300005468 | Ga0070707_100593732 | Ga0070707_1005937321 | 192 |
| 120 | 3300005518 | Ga0070699_100000090 | Ga0070699_10000009056 | 192 |
| 121 | 3300005518 | Ga0070699_100065612 | Ga0070699_1000656123 | 192 |
| 122 | 3300005536 | Ga0070697_100000949 | Ga0070697_1000009499 | 192 |
| 123 | 3300005536 | Ga0070697_100154715 | Ga0070697_1001547153 | 192 |
| 124 | 3300005536 | Ga0070697_100213339 | Ga0070697_1002133391 | 192 |
| 125 | 3300005545 | Ga0070695_100118896 | Ga0070695_1001188962 | 192 |
| 126 | 3300005545 | Ga0070695_100190406 | Ga0070695_1001904062 | 192 |
| 127 | 3300005546 | Ga0070696_100000001 | Ga0070696_10000000145 | 192 |
| 128 | 3300005546 | Ga0070696_100001311 | Ga0070696_1000013114 | 192 |
| 129 | 3300005546 | Ga0070696_100145267 | Ga0070696_1001452673 | 192 |
| 130 | 3300005549 | Ga0070704_100129408 | Ga0070704_1001294082 | 192 |
| 131 | 3300005617 | Ga0068859_100406049 | Ga0068859_1004060492 | 192 |
| 132 | 3300005843 | Ga0068860_100008958 | Ga0068860_1000089585 | 192 |
| 133 | 3300006237 | Ga0097621_100972943 | Ga0097621_1009729431 | 192 |
| 134 | 3300006852 | Ga0075433_10801335 | Ga0075433_108013351 | 192 |
| 135 | 3300006871 | Ga0075434_100081335 | Ga0075434_1000813354 | 192 |
| 136 | 3300006871 | Ga0075434_100288071 | Ga0075434_1002880712 | 192 |
| 137 | 3300006880 | Ga0075429_100161205 | Ga0075429_1001612051 | 192 |
| 138 | 3300006914 | Ga0075436_100000854 | Ga0075436_10000085422 | 192 |
| 139 | 3300006914 | Ga0075436_100065023 | Ga0075436_1000650232 | 192 |
| 140 | 3300006931 | Ga0097620_100406064 | Ga0097620_1004060642 | 192 |
| 141 | 3300007076 | Ga0075435_100668233 | Ga0075435_1006682331 | 192 |
| 142 | 3300007788 | Ga0099795_10063914 | Ga0099795_100639142 | 192 |
| 143 | 3300009094 | Ga0111539_10341593 | Ga0111539_103415933 | 192 |
| 144 | 3300009098 | Ga0105245_10244757 | Ga0105245_102447572 | 192 |
| 145 | 3300009101 | Ga0105247_10080130 | Ga0105247_100801303 | 192 |
| 146 | 3300009147 | Ga0114129_10022848 | Ga0114129_100228483 | 192 |
| 147 | 3300009147 | Ga0114129_10652438 | Ga0114129_106524381 | 192 |
| 148 | 3300009147 | Ga0114129_10845364 | Ga0114129_108453641 | 192 |
| 149 | 3300009148 | Ga0105243_10371284 | Ga0105243_103712842 | 192 |
| 150 | 3300009176 | Ga0105242_10228750 | Ga0105242_102287502 | 192 |
| 151 | 3300009177 | Ga0105248_10162391 | Ga0105248_101623913 | 192 |
| 152 | 3300009177 | Ga0105248_10272359 | Ga0105248_102723593 | 192 |
| 153 | 3300010375 | Ga0105239_10087207 | Ga0105239_100872073 | 192 |
| 154 | 3300011119 | Ga0105246_10342722 | Ga0105246_103427222 | 192 |
| 155 | 3300013297 | Ga0157378_10000496 | Ga0157378_1000049633 | 192 |
| 156 | 3300013306 | Ga0163162_10049791 | Ga0163162_100497912 | 192 |
| 157 | 3300014325 | Ga0163163_10714682 | Ga0163163_107146821 | 192 |
| 158 | 3300014326 | Ga0157380_11025791 | Ga0157380_110257912 | 192 |
| 159 | 3300014968 | Ga0157379_10064739 | Ga0157379_100647393 | 192 |
| 160 | 3300025885 | Ga0207653_10000348 | Ga0207653_1000034814 | 192 |
| 161 | 3300025904 | Ga0207647_10418610 | Ga0207647_104186101 | 192 |
| 162 | 3300025910 | Ga0207684_10000102 | Ga0207684_1000010254 | 192 |
| 163 | 3300025916 | Ga0207663_10000005 | Ga0207663_10000005140 | 192 |
| 164 | 3300025918 | Ga0207662_10086819 | Ga0207662_100868194 | 192 |
| 165 | 3300025922 | Ga0207646_10000029 | Ga0207646_1000002984 | 192 |
| 166 | 3300025922 | Ga0207646_10196486 | Ga0207646_101964864 | 192 |
| 167 | 3300025923 | Ga0207681_10019128 | Ga0207681_100191282 | 192 |
| 168 | 3300025923 | Ga0207681_10657989 | Ga0207681_106579891 | 192 |
| 169 | 3300025935 | Ga0207709_10319432 | Ga0207709_103194321 | 192 |
| 170 | 3300025941 | Ga0207711_10127146 | Ga0207711_101271463 | 192 |
| 171 | 3300025941 | Ga0207711_10376976 | Ga0207711_103769762 | 192 |
| 172 | 3300026023 | Ga0207677_10288757 | Ga0207677_102887572 | 192 |
| 173 | 3300026075 | Ga0207708_10605801 | Ga0207708_106058011 | 192 |
| 174 | 3300026095 | Ga0207676_10263227 | Ga0207676_102632272 | 192 |
| 175 | 3300026118 | Ga0207675_100358278 | Ga0207675_1003582781 | 192 |
| 176 | 3300027907 | Ga0207428_10035484 | Ga0207428_100354845 | 192 |
| 177 | 3300027907 | Ga0207428_10406253 | Ga0207428_104062531 | 192 |
| 178 | 3300028381 | Ga0268264_10010115 | Ga0268264_100101152 | 192 |
| 179 | 3300035083 | Ga0373926_0047427 | Ga0373926_0047427_132_788 | 192 |
| 180 | 3300046472 | Ga0495580_0039542 | Ga0495580_0039542_2530_3186 | 192 |
| 181 | 3300046517 | Ga0495630_0249604 | Ga0495630_0249604_680_1336 | 192 |
| 182 | 3300046539 | Ga0495621_0074877 | Ga0495621_0074877_527_1165 | 192 |
| 183 | 3300047319 | Ga0495674_0018405 | Ga0495674_0018405_70_726 | 192 |
| 184 | 3300048903 | Ga0496100_0060135 | Ga0496100_0060135_644_1300 | 192 |
| 185 | 3300049568 | Ga0501031_0332190 | Ga0501031_0332190_107_745 | 192 |
| 186 | 3300049576 | Ga0501040_0050155 | Ga0501040_0050155_1994_2632 | 192 |
| 187 | 3300049582 | Ga0501048_0199525 | Ga0501048_0199525_194_832 | 192 |
| 188 | 3300049590 | Ga0501074_0174130 | Ga0501074_0174130_790_1431 | 192 |
| 189 | 3300049591 | Ga0501075_0501950 | Ga0501075_0501950_178_816 | 192 |
| 190 | 3300049592 | Ga0501076_0223067 | Ga0501076_0223067_333_971 | 192 |
| 191 | 3300049741 | Ga0501079_0054019 | Ga0501079_0054019_2194_2832 | 192 |
| 192 | 3300050507 | nmdc:mga05p37_256_c1 | nmdc:mga05p37_256_c1_18316_18954 | 192 |
| 193 | 3300050507 | nmdc:mga05p37_715093_c1 | nmdc:mga05p37_715093_c1_438_1079 | 192 |
| 194 | 3300050507 | nmdc:mga05p37_901480_c1 | nmdc:mga05p37_901480_c1_286_930 | 192 |
| 195 | 3300050508 | nmdc:mga09592_353631_c1 | nmdc:mga09592_353631_c1_501_1145 | 192 |
| 196 | 3300050512 | nmdc:mga0n895_125232_c1 | nmdc:mga0n895_125232_c1_1083_1721 | 192 |
| 197 | 3300050512 | nmdc:mga0n895_354793_c1 | nmdc:mga0n895_354793_c1_736_1374 | 192 |
| 198 | 3300050513 | nmdc:mga0rr50_400134_c1 | nmdc:mga0rr50_400134_c1_488_1126 | 192 |
| 199 | 3300050514 | nmdc:mga08x19_20_c1 | nmdc:mga08x19_20_c1_263_871 | 192 |
| 200 | 3300050514 | nmdc:mga08x19_33402_c1 | nmdc:mga08x19_33402_c1_2146_2802 | 192 |
| 201 | 3300054114 | Ga0501084_0055151 | Ga0501084_0055151_2610_3248 | 192 |
| 202 | 3300060353 | Ga0501082_0300712 | Ga0501082_0300712_508_1146 | 192 |
| 203 | 3300061734 | Ga0530510_0106490 | Ga0530510_0106490_161_802 | 192 |
| 204 | 3300005330 | Ga0070690_100038484 | Ga0070690_1000384843 | 193 |
| 205 | 3300005330 | Ga0070690_100051653 | Ga0070690_1000516533 | 193 |
| 206 | 3300005336 | Ga0070680_100012488 | Ga0070680_1000124886 | 193 |
| 207 | 3300005434 | Ga0070709_10465093 | Ga0070709_104650932 | 193 |
| 208 | 3300005440 | Ga0070705_100000809 | Ga0070705_10000080914 | 193 |
| 209 | 3300005444 | Ga0070694_100001600 | Ga0070694_1000016007 | 193 |
| 210 | 3300005444 | Ga0070694_100009187 | Ga0070694_1000091873 | 193 |
| 211 | 3300005445 | Ga0070708_100001390 | Ga0070708_10000139013 | 193 |
| 212 | 3300005445 | Ga0070708_100069293 | Ga0070708_1000692932 | 193 |
| 213 | 3300005445 | Ga0070708_100078813 | Ga0070708_1000788131 | 193 |
| 214 | 3300005467 | Ga0070706_100053027 | Ga0070706_1000530273 | 193 |
| 215 | 3300005518 | Ga0070699_100025563 | Ga0070699_1000255634 | 193 |
| 216 | 3300005518 | Ga0070699_100101576 | Ga0070699_1001015765 | 193 |
| 217 | 3300005530 | Ga0070679_100012641 | Ga0070679_1000126418 | 193 |
| 218 | 3300005536 | Ga0070697_100324160 | Ga0070697_1003241601 | 193 |
| 219 | 3300005545 | Ga0070695_100003308 | Ga0070695_1000033083 | 193 |
| 220 | 3300005546 | Ga0070696_100001149 | Ga0070696_1000011493 | 193 |
| 221 | 3300005547 | Ga0070693_100000054 | Ga0070693_10000005415 | 193 |
| 222 | 3300005547 | Ga0070693_100131539 | Ga0070693_1001315392 | 193 |
| 223 | 3300005549 | Ga0070704_100007216 | Ga0070704_1000072164 | 193 |
| 224 | 3300006173 | Ga0070716_100682748 | Ga0070716_1006827481 | 193 |
| 225 | 3300007265 | Ga0099794_10021338 | Ga0099794_100213382 | 193 |
| 226 | 3300009147 | Ga0114129_10835902 | Ga0114129_108359021 | 193 |
| 227 | 3300009147 | Ga0114129_11646976 | Ga0114129_116469761 | 193 |
| 228 | 3300013297 | Ga0157378_10097844 | Ga0157378_100978442 | 193 |
| 229 | 3300013297 | Ga0157378_10442915 | Ga0157378_104429152 | 193 |
| 230 | 3300025906 | Ga0207699_10274686 | Ga0207699_102746862 | 193 |
| 231 | 3300025910 | Ga0207684_10013380 | Ga0207684_100133805 | 193 |
| 232 | 3300025917 | Ga0207660_10066720 | Ga0207660_100667203 | 193 |
| 233 | 3300025921 | Ga0207652_10023838 | Ga0207652_100238384 | 193 |
| 234 | 3300025922 | Ga0207646_10729195 | Ga0207646_107291952 | 193 |
| 235 | 3300026023 | Ga0207677_10527968 | Ga0207677_105279681 | 193 |
| 236 | 3300027671 | Ga0209588_1037936 | Ga0209588_10379363 | 193 |
| 237 | 3300037068 | Ga0373925_0566737 | Ga0373925_0566737_141_785 | 193 |
| 238 | 3300042876 | Ga0451577_0417666 | Ga0451577_0417666_446_1090 | 193 |
| 239 | 3300042876 | Ga0451577_0426345 | Ga0451577_0426345_153_797 | 193 |
| 240 | 3300044673 | Ga0453683_0009925 | Ga0453683_0009925_2367_3011 | 193 |
| 241 | 3300044712 | Ga0453684_0003355 | Ga0453684_0003355_29317_29961 | 193 |
| 242 | 3300044712 | Ga0453684_0046591 | Ga0453684_0046591_2496_3140 | 193 |
| 243 | 3300045051 | Ga0451576_0157281 | Ga0451576_0157281_172_816 | 193 |
| 244 | 3300046472 | Ga0495580_0034002 | Ga0495580_0034002_165_827 | 193 |
| 245 | 3300050507 | nmdc:mga05p37_471961_c1 | nmdc:mga05p37_471961_c1_812_1396 | 193 |
| 246 | 3300004800 | Ga0058861_11258896 | Ga0058861_112588961 | 194 |
| 247 | 3300005563 | Ga0068855_100115943 | Ga0068855_1001159432 | 194 |
| 248 | 3300005937 | Ga0081455_10012499 | Ga0081455_100124996 | 194 |
| 249 | 3300009147 | Ga0114129_10142688 | Ga0114129_101426883 | 194 |
| 250 | 3300010375 | Ga0105239_10769844 | Ga0105239_107698442 | 194 |
| 251 | 3300013105 | Ga0157369_10083310 | Ga0157369_100833102 | 194 |
| 252 | 3300013105 | Ga0157369_10148118 | Ga0157369_101481185 | 194 |
| 253 | 3300025917 | Ga0207660_10084155 | Ga0207660_100841552 | 194 |
| 254 | 3300025949 | Ga0207667_10013767 | Ga0207667_100137678 | 194 |
| 255 | 3300048903 | Ga0496100_0510068 | Ga0496100_0510068_168_890 | 194 |
| 256 | 3300048905 | Ga0496102_0219035 | Ga0496102_0219035_271_993 | 194 |
| 257 | 3300048906 | Ga0496103_0363360 | Ga0496103_0363360_123_845 | 194 |
| 258 | 3300050507 | nmdc:mga05p37_265852_c1 | nmdc:mga05p37_265852_c1_486_1139 | 194 |
| 259 | 3300005334 | Ga0068869_100244214 | Ga0068869_1002442143 | 196 |
| 260 | 3300005340 | Ga0070689_100258899 | Ga0070689_1002588993 | 196 |
| 261 | 3300005467 | Ga0070706_100179980 | Ga0070706_1001799803 | 196 |
| 262 | 3300005468 | Ga0070707_100749114 | Ga0070707_1007491142 | 196 |
| 263 | 3300005618 | Ga0068864_100069895 | Ga0068864_1000698955 | 196 |
| 264 | 3300005843 | Ga0068860_100254948 | Ga0068860_1002549481 | 196 |
| 265 | 3300006914 | Ga0075436_100227652 | Ga0075436_1002276522 | 196 |
| 266 | 3300025922 | Ga0207646_10440753 | Ga0207646_104407531 | 196 |
| 267 | 3300025942 | Ga0207689_10350913 | Ga0207689_103509132 | 196 |
| 268 | 3300028381 | Ga0268264_10220404 | Ga0268264_102204041 | 196 |
| 269 | 2162886006 | SwRhRL3b_contig_2111430 | SwRhRL3b_0361.00001970 | 197 |
| 270 | 3300005437 | Ga0070710_10302214 | Ga0070710_103022142 | 197 |
| 271 | 3300005440 | Ga0070705_100551585 | Ga0070705_1005515851 | 197 |
| 272 | 3300005441 | Ga0070700_100226699 | Ga0070700_1002266992 | 197 |
| 273 | 3300005444 | Ga0070694_100058323 | Ga0070694_1000583233 | 197 |
| 274 | 3300005468 | Ga0070707_100017087 | Ga0070707_1000170875 | 197 |
| 275 | 3300005518 | Ga0070699_100794295 | Ga0070699_1007942951 | 197 |
| 276 | 3300005546 | Ga0070696_100346839 | Ga0070696_1003468392 | 197 |
| 277 | 3300005549 | Ga0070704_100032428 | Ga0070704_1000324284 | 197 |
| 278 | 3300005577 | Ga0068857_100140211 | Ga0068857_1001402112 | 197 |
| 279 | 3300005617 | Ga0068859_100009568 | Ga0068859_1000095683 | 197 |
| 280 | 3300005617 | Ga0068859_100039013 | Ga0068859_1000390134 | 197 |
| 281 | 3300005618 | Ga0068864_100391730 | Ga0068864_1003917302 | 197 |
| 282 | 3300005844 | Ga0068862_100254660 | Ga0068862_1002546602 | 197 |
| 283 | 3300006844 | Ga0075428_100494565 | Ga0075428_1004945651 | 197 |
| 284 | 3300006871 | Ga0075434_100646067 | Ga0075434_1006460672 | 197 |
| 285 | 3300006880 | Ga0075429_100424946 | Ga0075429_1004249462 | 197 |
| 286 | 3300006931 | Ga0097620_100009565 | Ga0097620_1000095653 | 197 |
| 287 | 3300006931 | Ga0097620_100039014 | Ga0097620_1000390144 | 197 |
| 288 | 3300007265 | Ga0099794_10017110 | Ga0099794_100171103 | 197 |
| 289 | 3300009148 | Ga0105243_10000096 | Ga0105243_1000009665 | 197 |
| 290 | 3300009176 | Ga0105242_10002474 | Ga0105242_1000247410 | 197 |
| 291 | 3300025898 | Ga0207692_10249061 | Ga0207692_102490612 | 197 |
| 292 | 3300025934 | Ga0207686_10000026 | Ga0207686_1000002667 | 197 |
| 293 | 3300025935 | Ga0207709_10000142 | Ga0207709_1000014266 | 197 |
| 294 | 3300026089 | Ga0207648_10302087 | Ga0207648_103020873 | 197 |
| 295 | 3300026116 | Ga0207674_10354665 | Ga0207674_103546652 | 197 |
| 296 | 3300028380 | Ga0268265_10075744 | Ga0268265_100757443 | 197 |
| 297 | 3300050512 | nmdc:mga0n895_128323_c1 | nmdc:mga0n895_128323_c1_169_762 | 197 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ax2-assembly3.cif.gz_E | crystal structure of rat tom20-aldh presequence complex: a disulfide-tethered complex with a non-optimized, long linker | 0.9536 | 110 | 144 |
| 4ja7-assembly1.cif.gz_A | rat pp5 co-crystallized with p5sa-2 | 0.934 | 110 | 157 |
| 4gcn-assembly2.cif.gz_B | n-terminal domain of stress-induced protein-1 (sti-1) from c.elegans | 0.9277 | 107 | 157 |
| 6hpg-assembly4.cif.gz_D | arabidopsis om64 tpr domain | 0.9238 | 110 | 157 |
| 6q3q-assembly1.cif.gz_B | arabidopsis om64 tpr domain | 0.9223 | 110 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54D83_458_612_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9478 | 109 | 157 | 1.25.40.10 |
| af_C6KSL8_218_286_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9449 | 114 | 157 | 1.25.40.10 |
| af_C6KTE5_218_285_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9446 | 114 | 157 | 1.25.40.10 |
| af_I1MHE8_338_489_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9436 | 114 | 157 | 1.25.40.10 |
| af_I1L1N9_297_477_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9429 | 114 | 157 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M8BES3-F1-model_v4 | Protein kinase domain-containing protein | 0.9346 | 105 | 157 |
GO:0004676
GO:0004677 GO:0004679 GO:0004711 GO:0005524 GO:0016020 GO:0035175 GO:0035402 GO:0035403 GO:0035979 GO:0044022 GO:0044023 GO:0044024 GO:0044025 GO:0072354 GO:0072371 GO:0072518 GO:0140823 GO:0140855 GO:0140857 GO:1990244 |
| AF-A0A1V6IFX7-F1-model_v4 | Lipoprotein NlpI | 0.8983 | 107 | 157 |
|
| AF-A0A126SXY6-F1-model_v4 | Putative MSHA biogenesis protein MshN | 0.8978 | 107 | 157 |
GO:0016020
|
| AF-A0A537YGQ1-F1-model_v4 | Tetratricopeptide repeat protein | 0.8918 | 68 | 186 |
|
| AF-A0A538IG26-F1-model_v4 | Tetratricopeptide repeat protein | 0.8915 | 68 | 186 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar