F393839

General Info

Members Datasets Scaffolds Average Seq Length
297 210 594 151

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0004389|Ga0451576_0004389_7152_7625
Length 157
Sequence VTATAPTVDPDDAARVRAWFLELARHVQAVDFAAARHLFSPDLIAFGTFTDFIDGRDGAEAQQWRNVWQTIDGFTWREGIRALVSPDRLFAVGMAVWDSTGYMPDGARFDRRGRATVSFSRGAIGEPWVATHTHMSLFRGTPDRSFGPGGVAKPMAS

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
152 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
153 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
154 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
210 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 1.01
Isolates 1.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.56
Nodule 1.68
Rhizoplane 0.67
Rhizosphere 73.06
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0004389 3300045051 Bacteria 18369
2 JGI25406J46586_10031665 3300003203 Bacteria 1975
3 Ga0070683_100078360 3300005329 Bacteria 3091
4 Ga0070666_10268342 3300005335 Bacteria 1211
5 Ga0070680_100450855 3300005336 Bacteria 1099
6 Ga0070689_100009108 3300005340 Bacteria 7028
7 Ga0070689_100105413 3300005340 Bacteria 2236
8 Ga0070661_100314114 3300005344 Bacteria 1222
9 Ga0070661_100434054 3300005344 Bacteria 1043
10 Ga0070675_100263608 3300005354 Bacteria 1511
11 Ga0070671_100157673 3300005355 Bacteria 1918
12 Ga0070674_101116917 3300005356 Bacteria 697
13 Ga0070673_100703924 3300005364 Bacteria 928
14 Ga0070659_100216021 3300005366 Bacteria 1581
15 Ga0070709_10002304 3300005434 Bacteria 10365
16 Ga0070709_10257299 3300005434 Bacteria 1260
17 Ga0070713_100019796 3300005436 Bacteria 5150
18 Ga0070710_10004965 3300005437 Bacteria 6294
19 Ga0070710_10410898 3300005437 Bacteria 909
20 Ga0070701_10063271 3300005438 Bacteria 1957
21 Ga0070708_100688411 3300005445 Bacteria 963
22 Ga0070708_100839933 3300005445 Bacteria 863
23 Ga0070663_100393714 3300005455 Bacteria 1131
24 Ga0070678_100047018 3300005456 Bacteria 3099
25 Ga0070681_10865654 3300005458 Bacteria 822
26 Ga0070706_100100286 3300005467 Bacteria 2690
27 Ga0070707_100728673 3300005468 Bacteria 955
28 Ga0070698_100005878 3300005471 Bacteria 13396
29 Ga0070699_100242073 3300005518 Bacteria 1611
30 Ga0070699_101144827 3300005518 Bacteria 714
31 Ga0070679_100456229 3300005530 Bacteria 1223
32 Ga0070684_100419802 3300005535 Bacteria 1235
33 Ga0070697_100040710 3300005536 Bacteria 3761
34 Ga0068853_101440188 3300005539 Bacteria 667
35 Ga0070686_100503869 3300005544 Bacteria 940
36 Ga0070665_100387012 3300005548 Bacteria 1406
37 Ga0070665_101263822 3300005548 Bacteria 748
38 Ga0068855_100246181 3300005563 Bacteria 1995
39 Ga0070664_100111726 3300005564 Bacteria 2385
40 Ga0068857_100072642 3300005577 Bacteria 3066
41 Ga0068857_100208463 3300005577 Bacteria 1783
42 Ga0068856_100105263 3300005614 Bacteria 2815
43 Ga0068852_100454520 3300005616 Bacteria 1268
44 Ga0068859_101701833 3300005617 Bacteria 697
45 Ga0068863_100436688 3300005841 Bacteria 1283
46 Ga0068860_100483099 3300005843 Bacteria 1235
47 Ga0068862_101248502 3300005844 Bacteria 743
48 Ga0081455_10009609 3300005937 Bacteria 9932
49 Ga0081455_10013628 3300005937 Bacteria 8010
50 Ga0081455_10446340 3300005937 Bacteria 885
51 Ga0081539_10000608 3300005985 Bacteria 72799
52 Ga0081539_10001566 3300005985 Bacteria 37942
53 Ga0081539_10014051 3300005985 Bacteria 5959
54 Ga0081539_10071144 3300005985 Bacteria 1864
55 Ga0075365_10060723 3300006038 Bacteria 2523
56 Ga0075365_10155334 3300006038 Bacteria 1592
57 Ga0075365_10178478 3300006038 Bacteria 1484
58 Ga0075365_10274685 3300006038 Bacteria 1185
59 Ga0075365_10917294 3300006038 Bacteria 617
60 Ga0075368_10126912 3300006042 Bacteria 1059
61 Ga0075368_10324871 3300006042 Bacteria 667
62 Ga0075363_100223875 3300006048 Bacteria 1079
63 Ga0075363_100257039 3300006048 Bacteria 1007
64 Ga0075364_10431685 3300006051 Bacteria 900
65 Ga0070712_100238323 3300006175 Bacteria 1448
66 Ga0070712_101218932 3300006175 Bacteria 655
67 Ga0075362_10081034 3300006177 Bacteria 1496
68 Ga0075362_10130805 3300006177 Bacteria 1193
69 Ga0075362_10172551 3300006177 Bacteria 1045
70 Ga0075362_10181390 3300006177 Bacteria 1020
71 Ga0075362_10506476 3300006177 Bacteria 618
72 Ga0075367_10291419 3300006178 Bacteria 1027
73 Ga0075367_10378474 3300006178 Bacteria 894
74 Ga0075367_10691273 3300006178 Bacteria 649
75 Ga0075367_10816795 3300006178 Bacteria 594
76 Ga0075369_10005860 3300006186 Bacteria 4618
77 Ga0075369_10014703 3300006186 Bacteria 3131
78 Ga0075369_10193733 3300006186 Bacteria 937
79 Ga0075369_10305854 3300006186 Bacteria 743
80 Ga0075366_10006126 3300006195 Bacteria 6557
81 Ga0075366_10117831 3300006195 Bacteria 1599
82 Ga0075366_10156410 3300006195 Bacteria 1381
83 Ga0075366_10190680 3300006195 Bacteria 1246
84 Ga0097621_101198803 3300006237 Bacteria 715
85 Ga0075370_10017132 3300006353 Bacteria 3910
86 Ga0075370_10142031 3300006353 Bacteria 1404
87 Ga0075370_10221034 3300006353 Bacteria 1119
88 Ga0075430_100183132 3300006846 Unclassified 1742
89 Ga0075433_10649776 3300006852 Bacteria 925
90 Ga0075434_101852279 3300006871 Bacteria 610
91 Ga0097620_101701829 3300006931 Bacteria 697
92 Ga0099794_10066558 3300007265 Bacteria 1758
93 Ga0099795_10337270 3300007788 Bacteria 671
94 Ga0105240_10147133 3300009093 Bacteria 2810
95 Ga0111539_10568791 3300009094 Bacteria 1320
96 Ga0111539_11556268 3300009094 Bacteria 767
97 Ga0111539_11825392 3300009094 Bacteria 705
98 Ga0105243_12105930 3300009148 Bacteria 600
99 Ga0105242_11844199 3300009176 Bacteria 644
100 Ga0105237_10365214 3300009545 Bacteria 1448
101 Ga0105238_10118507 3300009551 Bacteria 2627
102 Ga0105249_11695413 3300009553 Bacteria 704
103 Ga0105148_120794 3300009978 Bacteria 527
104 Ga0099796_10025067 3300010159 Bacteria 1879
105 Ga0105239_10152816 3300010375 Bacteria 2576
106 Ga0105246_11004458 3300011119 Bacteria 755
107 Ga0157373_11268774 3300013100 Bacteria 557
108 Ga0157371_10176556 3300013102 Bacteria 1527
109 Ga0157370_10140666 3300013104 Bacteria 2249
110 Ga0157369_10224910 3300013105 Bacteria 1963
111 Ga0157369_10582577 3300013105 Bacteria 1155
112 Ga0157378_12208094 3300013297 Bacteria 602
113 Ga0163162_11126059 3300013306 Bacteria 890
114 Ga0157372_11711553 3300013307 Bacteria 723
115 Ga0157375_10812130 3300013308 Bacteria 1083
116 Ga0157380_10313595 3300014326 Bacteria 1451
117 Ga0157379_10700188 3300014968 Bacteria 951
118 Ga0157376_12855364 3300014969 Bacteria 523
119 Ga0163161_11362505 3300017792 Bacteria 618
120 Ga0206356_11132137 3300020070 Bacteria 593
121 Ga0206354_11446149 3300020081 Bacteria 1514
122 Ga0206353_11442026 3300020082 Bacteria 982
123 Ga0213872_10085929 3300021361 Bacteria 1410
124 Ga0213876_10006746 3300021384 Bacteria 6269
125 Ga0213871_10005727 3300021441 Bacteria 2585
126 Ga0207426_1010793 3300025302 Bacteria 3525
127 Ga0207426_1066636 3300025302 Bacteria 1017
128 Ga0207692_10645225 3300025898 Bacteria 684
129 Ga0207647_10164302 3300025904 Bacteria 1294
130 Ga0207699_10009885 3300025906 Bacteria 4766
131 Ga0207699_10199653 3300025906 Bacteria 1354
132 Ga0207645_10162992 3300025907 Bacteria 1459
133 Ga0207705_10595052 3300025909 Bacteria 860
134 Ga0207707_10145920 3300025912 Bacteria 2069
135 Ga0207695_10156873 3300025913 Bacteria 2210
136 Ga0207663_10034850 3300025916 Bacteria 3014
137 Ga0207660_10140559 3300025917 Bacteria 1846
138 Ga0207662_10176671 3300025918 Bacteria 1372
139 Ga0207649_10889670 3300025920 Bacteria 698
140 Ga0207681_10247765 3300025923 Bacteria 1390
141 Ga0207694_10087248 3300025924 Bacteria 2458
142 Ga0207700_10025617 3300025928 Bacteria 4100
143 Ga0207664_11433091 3300025929 Bacteria 612
144 Ga0207706_10347506 3300025933 Bacteria 1290
145 Ga0207709_10827207 3300025935 Bacteria 749
146 Ga0207670_10010035 3300025936 Bacteria 5434
147 Ga0207670_10347770 3300025936 Bacteria 1173
148 Ga0207704_10170919 3300025938 Bacteria 1559
149 Ga0207665_10774684 3300025939 Bacteria 757
150 Ga0207691_10130270 3300025940 Bacteria 2223
151 Ga0207711_10293438 3300025941 Bacteria 1499
152 Ga0207679_10027802 3300025945 Bacteria 3917
153 Ga0207667_10317099 3300025949 Bacteria 1592
154 Ga0207651_10897073 3300025960 Bacteria 789
155 Ga0207651_11411770 3300025960 Bacteria 627
156 Ga0207678_10295679 3300026067 Bacteria 1391
157 Ga0207708_10419891 3300026075 Bacteria 1109
158 Ga0207702_10101833 3300026078 Bacteria 2537
159 Ga0207648_10841350 3300026089 Bacteria 855
160 Ga0207674_10061434 3300026116 Bacteria 3796
161 Ga0207675_102082218 3300026118 Bacteria 584
162 Ga0207683_10014835 3300026121 Bacteria 6634
163 Ga0207698_10246400 3300026142 Bacteria 1632
164 Ga0207428_10494238 3300027907 Bacteria 889
165 Ga0268264_10498619 3300028381 Bacteria 1187
166 Ga0268264_12562119 3300028381 Bacteria 515
167 Ga0265334_10019943 3300028573 Bacteria 2750
168 Ga0265332_10058144 3300031238 Bacteria 1656
169 Ga0265325_10178074 3300031241 Bacteria 991
170 Ga0265316_10323084 3300031344 Bacteria 1121
171 Ga0307406_10394080 3300031901 Bacteria 1096
172 Ga0307407_10211201 3300031903 Bacteria 1307
173 Ga0307407_11115032 3300031903 Bacteria 614
174 Ga0307412_10177866 3300031911 Bacteria 1597
175 Ga0307416_100988669 3300032002 Bacteria 944
176 Ga0307416_101527396 3300032002 Bacteria 773
177 Ga0307415_100442223 3300032126 Bacteria 1122
178 Ga0307415_100666776 3300032126 Bacteria 934
179 Ga0373941_0099172 3300035115 Bacteria 1011
180 Ga0373943_0334431 3300035170 Bacteria 865
181 Ga0373931_0012726 3300035691 Bacteria 4083
182 Ga0373935_0104742 3300035692 Bacteria 1870
183 Ga0373933_0385764 3300035724 Bacteria 913
184 Ga0373947_0183772 3300035725 Bacteria 1362
185 Ga0373937_0236356 3300036401 Bacteria 1721
186 Ga0373937_1897403 3300036401 Bacteria 542
187 Ga0373925_0683942 3300037068 Bacteria 846
188 Ga0373925_0803127 3300037068 Bacteria 776
189 Ga0395899_0006876 3300037312 Bacteria 8813
190 Ga0395899_0168718 3300037312 Bacteria 1542
191 Ga0395899_0203159 3300037312 Bacteria 1380
192 Ga0395900_0008489 3300037418 Bacteria 10560
193 Ga0395900_0061126 3300037418 Bacteria 3874
194 Ga0395900_0150412 3300037418 Bacteria 2378
195 Ga0395900_0632318 3300037418 Bacteria 1008
196 Ga0395898_0022020 3300037466 Bacteria 6456
197 Ga0395898_0189632 3300037466 Bacteria 1964
198 Ga0395901_0011442 3300038443 Bacteria 8990
199 Ga0395901_0303727 3300038443 Bacteria 1654
200 Ga0436365_0570232 3300039437 Bacteria 5784
201 Ga0436365_1220462 3300039437 Bacteria 3642
202 Ga0436360_0220855 3300039438 Bacteria 1791
203 Ga0436360_0284657 3300039438 Bacteria 2197
204 Ga0436360_0955188 3300039438 Bacteria 3565
205 Ga0436361_0927033 3300039447 Bacteria 1258
206 Ga0436362_0069748 3300039453 Bacteria 1471
207 Ga0439466_0064979 3300041411 Bacteria 1170
208 Ga0439465_0023162 3300041413 Bacteria 1954
209 Ga0451798_0448890 3300041458 Bacteria 588
210 Ga0451845_0454150 3300041501 Bacteria 739
211 Ga0451847_0236198 3300041503 Bacteria 539
212 Ga0439442_029212 3300042002 Bacteria 1150
213 Ga0439448_0008773 3300042005 Bacteria 2965
214 Ga0439452_048002 3300042010 Bacteria 986
215 Ga0439458_0205538 3300042157 Bacteria 540
216 Ga0439459_0191471 3300042438 Bacteria 554
217 Ga0466969_0186485 3300044656 Bacteria 949
218 Ga0466965_0080072 3300044683 Bacteria 1651
219 Ga0466966_0322700 3300044684 Bacteria 928
220 Ga0466961_0171295 3300044693 Bacteria 1350
221 Ga0466963_0467301 3300044694 Bacteria 890
222 Ga0466964_0158442 3300044706 Bacteria 1056
223 Ga0466971_0231547 3300044719 Bacteria 877
224 Ga0466971_0349177 3300044719 Bacteria 716
225 Ga0466957_0155707 3300044842 Bacteria 1481
226 Ga0466957_0606989 3300044842 Bacteria 766
227 Ga0466959_0188164 3300045049 Bacteria 1441
228 Ga0466959_0928999 3300045049 Bacteria 580
229 Ga0466967_0113326 3300045976 Bacteria 2494
230 Ga0466967_2360877 3300045976 Unclassified 527
231 Ga0495664_0021299 3300046477 Bacteria 3745
232 Ga0495594_0427992 3300046499 Bacteria 753
233 Ga0495652_0903558 3300046529 Bacteria 582
234 Ga0495640_0787556 3300046533 Bacteria 567
235 Ga0495597_0390688 3300046542 Bacteria 530
236 Ga0495645_0229150 3300046543 Bacteria 1245
237 Ga0495599_0070545 3300046678 Bacteria 2181
238 Ga0495647_0191063 3300046681 Bacteria 895
239 Ga0495658_0438914 3300046683 Bacteria 834
240 Ga0496115_0704797 3300048918 Bacteria 793
241 Ga0496126_0012440 3300048929 Bacteria 8717
242 Ga0501033_0249399 3300049570 Bacteria 1258
243 Ga0501034_0011574 3300049571 Bacteria 9135
244 Ga0501034_0088926 3300049571 Bacteria 3086
245 Ga0501043_0589653 3300049579 Bacteria 822
246 Ga0501068_0004233 3300049584 Bacteria 7783
247 Ga0501070_0302889 3300049586 Bacteria 1302
248 Ga0501070_0464613 3300049586 Bacteria 1019
249 Ga0501080_0278869 3300049742 Bacteria 1520
250 Ga0501044_0077123 3300049823 Bacteria 3380
251 nmdc:mga03683_190339_c1 3300050489 Bacteria 938
252 nmdc:mga03683_20321_c1 3300050489 Bacteria 2547
253 nmdc:mga03683_2445_c1 3300050489 Bacteria 5767
254 nmdc:mga00v17_334963_c1 3300050491 Bacteria 983
255 nmdc:mga00v17_499868_c1 3300050491 Bacteria 788
256 nmdc:mga00v17_855616_c1 3300050491 Bacteria 577
257 nmdc:mga0yw44_164632_c1 3300050492 Bacteria 1453
258 nmdc:mga0yw44_194324_c1 3300050492 Bacteria 1339
259 nmdc:mga0yw44_213434_c1 3300050492 Bacteria 1277
260 nmdc:mga0yw44_418528_c1 3300050492 Bacteria 907
261 nmdc:mga0yw44_56705_c1 3300050492 Bacteria 2388
262 nmdc:mga0k408_110552_c1 3300050493 Bacteria 1624
263 nmdc:mga0k408_339017_c1 3300050493 Bacteria 896
264 nmdc:mga0k408_91621_c1 3300050493 Bacteria 1786
265 nmdc:mga06z11_25974_c1 3300050494 Bacteria 1959
266 nmdc:mga06z11_322949_c1 3300050494 Bacteria 921
267 nmdc:mga06z11_447433_c1 3300050494 Bacteria 780
268 nmdc:mga06z11_84010_c1 3300050494 Bacteria 1714
269 nmdc:mga07m45_133899_c1 3300050496 Bacteria 1434
270 nmdc:mga07m45_241492_c1 3300050496 Bacteria 1051
271 nmdc:mga07m45_3424_c1 3300050496 Bacteria 7642
272 nmdc:mga08y16_232336_c1 3300050511 Bacteria 1907
273 nmdc:mga08y16_819296_c1 3300050511 Bacteria 922
274 nmdc:mga0a205_713444_c1 3300050515 Bacteria 852
275 nmdc:mga0sz30_163093_c1 3300050516 Bacteria 987
276 nmdc:mga0sz30_56505_c1 3300050516 Bacteria 1672
277 nmdc:mga0sz30_7524_c1 3300050516 Bacteria 4086
278 Ga0495612_0073430 3300053078 Bacteria 1429
279 Ga0500635_0275392 3300053080 Bacteria 662
280 Ga0500647_0019423 3300053091 Bacteria 3156
281 Ga0500651_0041348 3300053093 Bacteria 2906
282 Ga0500651_0598976 3300053093 Bacteria 598
283 Ga0500641_0000678 3300053096 Bacteria 12275
284 Ga0500658_0106374 3300053134 Bacteria 1230
285 Ga0500658_0331145 3300053134 Bacteria 700
286 Ga0500568_0003295 3300053139 Bacteria 9106
287 Ga0500577_0148950 3300053142 Bacteria 992
288 Ga0500616_0000335 3300053153 Bacteria 67106
289 Ga0500620_260016 3300053155 Bacteria 575
290 Ga0501084_0623742 3300054114 Bacteria 911
291 Ga0466962_0165107 3300061719 Bacteria 1077
292 Ga0530510_1285310 3300061734 Bacteria 561
293 2835313759 2835312727 Bacteria 7413381
294 2835316130 2835312727 Bacteria 7413381
295 2894235680 2894232714 Bacteria 8834183
296 2894235896 2894232714 Bacteria 8834183
297 2894236406 2894232714 Bacteria 8834183
298 Ga0451576_0004389
299 JGI25406J46586_10031665
300 Ga0070683_100078360
301 Ga0070666_10268342
302 Ga0070680_100450855
303 Ga0070689_100009108
304 Ga0070689_100105413
305 Ga0070661_100314114
306 Ga0070661_100434054
307 Ga0070675_100263608
308 Ga0070671_100157673
309 Ga0070674_101116917
310 Ga0070673_100703924
311 Ga0070659_100216021
312 Ga0070709_10002304
313 Ga0070709_10257299
314 Ga0070713_100019796
315 Ga0070710_10004965
316 Ga0070710_10410898
317 Ga0070701_10063271
318 Ga0070708_100688411
319 Ga0070708_100839933
320 Ga0070663_100393714
321 Ga0070678_100047018
322 Ga0070681_10865654
323 Ga0070706_100100286
324 Ga0070707_100728673
325 Ga0070698_100005878
326 Ga0070699_100242073
327 Ga0070699_101144827
328 Ga0070679_100456229
329 Ga0070684_100419802
330 Ga0070697_100040710
331 Ga0068853_101440188
332 Ga0070686_100503869
333 Ga0070665_100387012
334 Ga0070665_101263822
335 Ga0068855_100246181
336 Ga0070664_100111726
337 Ga0068857_100072642
338 Ga0068857_100208463
339 Ga0068856_100105263
340 Ga0068852_100454520
341 Ga0068859_101701833
342 Ga0068863_100436688
343 Ga0068860_100483099
344 Ga0068862_101248502
345 Ga0081455_10009609
346 Ga0081455_10013628
347 Ga0081455_10446340
348 Ga0081539_10000608
349 Ga0081539_10001566
350 Ga0081539_10014051
351 Ga0081539_10071144
352 Ga0075365_10060723
353 Ga0075365_10155334
354 Ga0075365_10178478
355 Ga0075365_10274685
356 Ga0075365_10917294
357 Ga0075368_10126912
358 Ga0075368_10324871
359 Ga0075363_100223875
360 Ga0075363_100257039
361 Ga0075364_10431685
362 Ga0070712_100238323
363 Ga0070712_101218932
364 Ga0075362_10081034
365 Ga0075362_10130805
366 Ga0075362_10172551
367 Ga0075362_10181390
368 Ga0075362_10506476
369 Ga0075367_10291419
370 Ga0075367_10378474
371 Ga0075367_10691273
372 Ga0075367_10816795
373 Ga0075369_10005860
374 Ga0075369_10014703
375 Ga0075369_10193733
376 Ga0075369_10305854
377 Ga0075366_10006126
378 Ga0075366_10117831
379 Ga0075366_10156410
380 Ga0075366_10190680
381 Ga0097621_101198803
382 Ga0075370_10017132
383 Ga0075370_10142031
384 Ga0075370_10221034
385 Ga0075430_100183132
386 Ga0075433_10649776
387 Ga0075434_101852279
388 Ga0097620_101701829
389 Ga0099794_10066558
390 Ga0099795_10337270
391 Ga0105240_10147133
392 Ga0111539_10568791
393 Ga0111539_11556268
394 Ga0111539_11825392
395 Ga0105243_12105930
396 Ga0105242_11844199
397 Ga0105237_10365214
398 Ga0105238_10118507
399 Ga0105249_11695413
400 Ga0105148_120794
401 Ga0099796_10025067
402 Ga0105239_10152816
403 Ga0105246_11004458
404 Ga0157373_11268774
405 Ga0157371_10176556
406 Ga0157370_10140666
407 Ga0157369_10224910
408 Ga0157369_10582577
409 Ga0157378_12208094
410 Ga0163162_11126059
411 Ga0157372_11711553
412 Ga0157375_10812130
413 Ga0157380_10313595
414 Ga0157379_10700188
415 Ga0157376_12855364
416 Ga0163161_11362505
417 Ga0206356_11132137
418 Ga0206354_11446149
419 Ga0206353_11442026
420 Ga0213872_10085929
421 Ga0213876_10006746
422 Ga0213871_10005727
423 Ga0207426_1010793
424 Ga0207426_1066636
425 Ga0207692_10645225
426 Ga0207647_10164302
427 Ga0207699_10009885
428 Ga0207699_10199653
429 Ga0207645_10162992
430 Ga0207705_10595052
431 Ga0207707_10145920
432 Ga0207695_10156873
433 Ga0207663_10034850
434 Ga0207660_10140559
435 Ga0207662_10176671
436 Ga0207649_10889670
437 Ga0207681_10247765
438 Ga0207694_10087248
439 Ga0207700_10025617
440 Ga0207664_11433091
441 Ga0207706_10347506
442 Ga0207709_10827207
443 Ga0207670_10010035
444 Ga0207670_10347770
445 Ga0207704_10170919
446 Ga0207665_10774684
447 Ga0207691_10130270
448 Ga0207711_10293438
449 Ga0207679_10027802
450 Ga0207667_10317099
451 Ga0207651_10897073
452 Ga0207651_11411770
453 Ga0207678_10295679
454 Ga0207708_10419891
455 Ga0207702_10101833
456 Ga0207648_10841350
457 Ga0207674_10061434
458 Ga0207675_102082218
459 Ga0207683_10014835
460 Ga0207698_10246400
461 Ga0207428_10494238
462 Ga0268264_10498619
463 Ga0268264_12562119
464 Ga0265334_10019943
465 Ga0265332_10058144
466 Ga0265325_10178074
467 Ga0265316_10323084
468 Ga0307406_10394080
469 Ga0307407_10211201
470 Ga0307407_11115032
471 Ga0307412_10177866
472 Ga0307416_100988669
473 Ga0307416_101527396
474 Ga0307415_100442223
475 Ga0307415_100666776
476 Ga0373941_0099172
477 Ga0373943_0334431
478 Ga0373931_0012726
479 Ga0373935_0104742
480 Ga0373933_0385764
481 Ga0373947_0183772
482 Ga0373937_0236356
483 Ga0373937_1897403
484 Ga0373925_0683942
485 Ga0373925_0803127
486 Ga0395899_0006876
487 Ga0395899_0168718
488 Ga0395899_0203159
489 Ga0395900_0008489
490 Ga0395900_0061126
491 Ga0395900_0150412
492 Ga0395900_0632318
493 Ga0395898_0022020
494 Ga0395898_0189632
495 Ga0395901_0011442
496 Ga0395901_0303727
497 Ga0436365_0570232
498 Ga0436365_1220462
499 Ga0436360_0220855
500 Ga0436360_0284657
501 Ga0436360_0955188
502 Ga0436361_0927033
503 Ga0436362_0069748
504 Ga0439466_0064979
505 Ga0439465_0023162
506 Ga0451798_0448890
507 Ga0451845_0454150
508 Ga0451847_0236198
509 Ga0439442_029212
510 Ga0439448_0008773
511 Ga0439452_048002
512 Ga0439458_0205538
513 Ga0439459_0191471
514 Ga0466969_0186485
515 Ga0466965_0080072
516 Ga0466966_0322700
517 Ga0466961_0171295
518 Ga0466963_0467301
519 Ga0466964_0158442
520 Ga0466971_0231547
521 Ga0466971_0349177
522 Ga0466957_0155707
523 Ga0466957_0606989
524 Ga0466959_0188164
525 Ga0466959_0928999
526 Ga0466967_0113326
527 Ga0466967_2360877
528 Ga0495664_0021299
529 Ga0495594_0427992
530 Ga0495652_0903558
531 Ga0495640_0787556
532 Ga0495597_0390688
533 Ga0495645_0229150
534 Ga0495599_0070545
535 Ga0495647_0191063
536 Ga0495658_0438914
537 Ga0496115_0704797
538 Ga0496126_0012440
539 Ga0501033_0249399
540 Ga0501034_0011574
541 Ga0501034_0088926
542 Ga0501043_0589653
543 Ga0501068_0004233
544 Ga0501070_0302889
545 Ga0501070_0464613
546 Ga0501080_0278869
547 Ga0501044_0077123
548 nmdc:mga03683_190339_c1
549 nmdc:mga03683_20321_c1
550 nmdc:mga03683_2445_c1
551 nmdc:mga00v17_334963_c1
552 nmdc:mga00v17_499868_c1
553 nmdc:mga00v17_855616_c1
554 nmdc:mga0yw44_164632_c1
555 nmdc:mga0yw44_194324_c1
556 nmdc:mga0yw44_213434_c1
557 nmdc:mga0yw44_418528_c1
558 nmdc:mga0yw44_56705_c1
559 nmdc:mga0k408_110552_c1
560 nmdc:mga0k408_339017_c1
561 nmdc:mga0k408_91621_c1
562 nmdc:mga06z11_25974_c1
563 nmdc:mga06z11_322949_c1
564 nmdc:mga06z11_447433_c1
565 nmdc:mga06z11_84010_c1
566 nmdc:mga07m45_133899_c1
567 nmdc:mga07m45_241492_c1
568 nmdc:mga07m45_3424_c1
569 nmdc:mga08y16_232336_c1
570 nmdc:mga08y16_819296_c1
571 nmdc:mga0a205_713444_c1
572 nmdc:mga0sz30_163093_c1
573 nmdc:mga0sz30_56505_c1
574 nmdc:mga0sz30_7524_c1
575 Ga0495612_0073430
576 Ga0500635_0275392
577 Ga0500647_0019423
578 Ga0500651_0041348
579 Ga0500651_0598976
580 Ga0500641_0000678
581 Ga0500658_0106374
582 Ga0500658_0331145
583 Ga0500568_0003295
584 Ga0500577_0148950
585 Ga0500616_0000335
586 Ga0500620_260016
587 Ga0501084_0623742
588 Ga0466962_0165107
589 Ga0530510_1285310
590 2835313759
591 2835316130
592 2894235680
593 2894235896
594 2894236406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hx8-assembly2.cif.gz_C crystal structure of putative ketosteroid isomerase (np_103587.1) from mesorhizobium loti at 1.45 a resolution 0.806 13 139
1gy6-assembly1.cif.gz_B ntf2 from rat, ammonium sulphate conditions 0.8011 21 136
3bb9-assembly3.cif.gz_E crystal structure of a putative ketosteroid isomerase (sfri_1973) from shewanella frigidimarina ncimb 400 at 1.80 a resolution 0.794 13 134
3hx8-assembly2.cif.gz_C crystal structure of putative ketosteroid isomerase (np_103587.1) from mesorhizobium loti at 1.45 a resolution 0.789 13 139
3h51-assembly1.cif.gz_B crystal structure of putative calcium/calmodulin dependent protein kinase ii association domain (np_636218.1) from xanthomonas campestris at 1.70 a resolution 0.785 13 139
ID Description Score Start End Superfamily
af_Q9V3H8_1_133_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7776 13 137 3.10.450.50
5hgrA02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7776 13 138 3.10.450.50
2chcB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7718 13 137 3.10.450.50
af_Q7KPV8_5_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7632 8 134 3.10.450.50
1u5oA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7618 4 136 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A359KIA0-F1-model_v4 Ketosteroid isomerase 0.9617 59 146 GO:0016853
AF-A0A2E7UYP3-F1-model_v4 SnoaL-like domain-containing protein 0.9462 11 146
AF-A0A7T9EQ09-F1-model_v4 deleted 0.9432 1 147
AF-A0A512NM59-F1-model_v4 Ketosteroid isomerase 0.9426 1 148
AF-A0A5C8P9W4-F1-model_v4 Ketosteroid isomerase 0.9416 1 147 GO:0016853

Map