F393836

General Info

Members Datasets Scaffolds Average Seq Length
297 191 594 277

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0052657|Ga0466957_0052657_1184_2131
Length 315
Sequence MVGRHLRDRPTGGVPIVDAGRTLGQDGEAVTTNDNDGLVVLAVDDEEPALMELAYLLEQDQRVSTVLKANDSISALRILTGGDQVNIGGFGTPPSGISAPAKQSDVDVLFLDIRMPGLDGLELAQVLSRYVIPPSVVFVTAHDDRAVEAFDVGAVDYLLKPLRPERLYASLTRILASRGTTVPVEPAVEEEGDDEVIPVELAGTTKLVQRSTVRWVEAQGDYARLHTTEGSHLVRIPLSVLEERWSDAGFVRIHRSYLVALPLITELRLAGSGYVVRLGNGGGTGEVAELPVSRRHTRELKDRLVRSTKQAWGRR

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
117 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
118 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
167 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
168 2558860280 Kutzneria sp. 744 Isolate Unclassified
169 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
170 2643221613 Oerskovia sp. Root22 Isolate Unclassified
171 2643221711 Terrabacter sp. Root85 Isolate Unclassified
172 2643221721 Oerskovia sp. Root918 Isolate Unclassified
173 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
174 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
175 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
176 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
177 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
178 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
179 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
180 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
181 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
182 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
183 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
184 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
185 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
186 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
187 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
188 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
189 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
190 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
191 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.57
Metatranscriptomes 0.34
Isolates 9.09

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 13.13
Rhizosphere 70.37
Stem 0
Stem Tuber 0.34
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0052657 3300044842 Bacteria 2479
2 Ga0070658_10159604 3300005327 Bacteria 1891
3 Ga0070683_100112488 3300005329 Bacteria 2569
4 Ga0068869_100165309 3300005334 Bacteria 1725
5 Ga0070680_100333359 3300005336 Bacteria 1289
6 Ga0070682_100141516 3300005337 Bacteria 1640
7 Ga0068868_100051274 3300005338 Bacteria 3245
8 Ga0068868_100251886 3300005338 Bacteria 1486
9 Ga0070689_100239215 3300005340 Bacteria 1495
10 Ga0070691_10163292 3300005341 Bacteria 1150
11 Ga0070661_100148013 3300005344 Bacteria 1774
12 Ga0070668_100029685 3300005347 Bacteria 4154
13 Ga0070668_100231246 3300005347 Bacteria 1528
14 Ga0070669_100088747 3300005353 Bacteria 2315
15 Ga0070671_100005459 3300005355 Bacteria 10153
16 Ga0070671_100010714 3300005355 Bacteria 7361
17 Ga0070674_100400953 3300005356 Bacteria 1121
18 Ga0070673_100164196 3300005364 Bacteria 1891
19 Ga0070688_100095715 3300005365 Bacteria 1949
20 Ga0070667_100231996 3300005367 Bacteria 1646
21 Ga0070714_100197114 3300005435 Bacteria 1840
22 Ga0070713_100055187 3300005436 Bacteria 3300
23 Ga0070700_100026921 3300005441 Bacteria 3403
24 Ga0070700_100045589 3300005441 Bacteria 2705
25 Ga0070663_100003610 3300005455 Bacteria 8942
26 Ga0070662_100334007 3300005457 Bacteria 1238
27 Ga0070685_10142697 3300005466 Bacteria 1509
28 Ga0070684_100268115 3300005535 Bacteria 1562
29 Ga0068853_100011680 3300005539 Bacteria 7138
30 Ga0070672_100339839 3300005543 Bacteria 1278
31 Ga0070665_100002945 3300005548 Bacteria 18399
32 Ga0070665_100003392 3300005548 Bacteria 17033
33 Ga0070665_100097402 3300005548 Bacteria 2946
34 Ga0068857_100022815 3300005577 Bacteria 5506
35 Ga0070702_100332849 3300005615 Bacteria 1062
36 Ga0068852_100041836 3300005616 Bacteria 3876
37 Ga0068861_100076998 3300005719 Bacteria 2600
38 Ga0068863_100000693 3300005841 Bacteria 33877
39 Ga0068863_100009244 3300005841 Bacteria 9614
40 Ga0068863_100121090 3300005841 Bacteria 2495
41 Ga0068860_100050207 3300005843 Bacteria 3971
42 Ga0068860_100297078 3300005843 Bacteria 1581
43 Ga0081455_10004003 3300005937 Bacteria 16722
44 Ga0081455_10135873 3300005937 Bacteria 1916
45 Ga0081539_10000070 3300005985 Bacteria 235651
46 Ga0070717_10085300 3300006028 Bacteria 2657
47 Ga0075432_10070448 3300006058 Bacteria 1255
48 Ga0075428_100002497 3300006844 Bacteria 19975
49 Ga0075428_100017497 3300006844 Bacteria 7919
50 Ga0075428_100475108 3300006844 Bacteria 1338
51 Ga0075430_100024311 3300006846 Bacteria 5156
52 Ga0075430_100079365 3300006846 Bacteria 2750
53 Ga0075430_100146295 3300006846 Bacteria 1968
54 Ga0075431_100001005 3300006847 Bacteria 25119
55 Ga0075431_100001137 3300006847 Bacteria 23885
56 Ga0075431_100046142 3300006847 Bacteria 4492
57 Ga0075431_100066811 3300006847 Bacteria 3713
58 Ga0075431_100385542 3300006847 Bacteria 1405
59 Ga0075429_100002528 3300006880 Bacteria 15400
60 Ga0075429_100059721 3300006880 Bacteria 3321
61 Ga0075429_100113140 3300006880 Bacteria 2372
62 Ga0075429_100147138 3300006880 Bacteria 2062
63 Ga0105251_10110300 3300009011 Bacteria 1254
64 Ga0111539_10331459 3300009094 Bacteria 1771
65 Ga0105245_10575715 3300009098 Bacteria 1150
66 Ga0105247_10012952 3300009101 Bacteria 5001
67 Ga0114129_10000557 3300009147 Bacteria 45780
68 Ga0114129_10016040 3300009147 Bacteria 10654
69 Ga0114129_10111563 3300009147 Bacteria 3773
70 Ga0105238_10169766 3300009551 Bacteria 2157
71 Ga0105249_10245709 3300009553 Bacteria 1772
72 Ga0157371_10126070 3300013102 Bacteria 1821
73 Ga0157370_10269011 3300013104 Bacteria 1575
74 Ga0157369_10171119 3300013105 Bacteria 2289
75 Ga0157369_10872296 3300013105 Bacteria 923
76 Ga0157374_10163459 3300013296 Bacteria 2169
77 Ga0157378_10230717 3300013297 Bacteria 1764
78 Ga0157378_10230786 3300013297 Bacteria 1763
79 Ga0157372_10121814 3300013307 Bacteria 2997
80 Ga0157375_10345868 3300013308 Bacteria 1652
81 Ga0157379_10013933 3300014968 Bacteria 7047
82 Ga0157379_10153970 3300014968 Bacteria 2074
83 Ga0163161_10078232 3300017792 Bacteria 2430
84 Ga0213875_10002348 3300021388 Bacteria 11429
85 Ga0224712_10113091 3300022467 Bacteria 1167
86 Ga0207688_10050635 3300025901 Bacteria 2325
87 Ga0207680_10104673 3300025903 Bacteria 1824
88 Ga0207645_10049138 3300025907 Bacteria 2694
89 Ga0207643_10063908 3300025908 Bacteria 2106
90 Ga0207654_10058534 3300025911 Bacteria 2244
91 Ga0207662_10034843 3300025918 Bacteria 2938
92 Ga0207652_10506631 3300025921 Bacteria 1086
93 Ga0207694_10130317 3300025924 Bacteria 2015
94 Ga0207650_10447381 3300025925 Bacteria 1075
95 Ga0207659_10113564 3300025926 Bacteria 2063
96 Ga0207687_10458823 3300025927 Bacteria 1058
97 Ga0207664_10008069 3300025929 Bacteria 7323
98 Ga0207644_10001201 3300025931 Bacteria 16672
99 Ga0207644_10002585 3300025931 Bacteria 11649
100 Ga0207706_10342174 3300025933 Bacteria 1301
101 Ga0207704_10050806 3300025938 Bacteria 2503
102 Ga0207691_10091270 3300025940 Bacteria 2730
103 Ga0207689_10069785 3300025942 Bacteria 2887
104 Ga0207689_10165953 3300025942 Bacteria 1819
105 Ga0207712_10067930 3300025961 Bacteria 2552
106 Ga0207668_10005346 3300025972 Bacteria 7555
107 Ga0207668_10041692 3300025972 Bacteria 3105
108 Ga0207668_10079136 3300025972 Bacteria 2376
109 Ga0207668_10160107 3300025972 Bacteria 1753
110 Ga0207668_10478570 3300025972 Bacteria 1067
111 Ga0207640_10259886 3300025981 Bacteria 1352
112 Ga0207658_10201466 3300025986 Bacteria 1662
113 Ga0207639_10016104 3300026041 Bacteria 5283
114 Ga0207678_10000379 3300026067 Bacteria 40530
115 Ga0207678_10093973 3300026067 Bacteria 2562
116 Ga0207708_10109222 3300026075 Bacteria 2146
117 Ga0207708_10282176 3300026075 Bacteria 1346
118 Ga0207702_10205854 3300026078 Bacteria 1827
119 Ga0207641_10002078 3300026088 Bacteria 18981
120 Ga0207641_10028527 3300026088 Bacteria 4612
121 Ga0207641_10095555 3300026088 Bacteria 2609
122 Ga0207674_10020092 3300026116 Bacteria 7223
123 Ga0207674_10085156 3300026116 Bacteria 3157
124 Ga0207674_10115820 3300026116 Bacteria 2652
125 Ga0207675_100010963 3300026118 Bacteria 8490
126 Ga0207683_10165994 3300026121 Bacteria 1998
127 Ga0207698_10398604 3300026142 Bacteria 1314
128 Ga0207428_10003673 3300027907 Bacteria 14782
129 Ga0268266_10017505 3300028379 Bacteria 6113
130 Ga0268266_10193581 3300028379 Bacteria 1857
131 Ga0268265_10044407 3300028380 Bacteria 3309
132 Ga0265334_10008840 3300028573 Bacteria 4278
133 Ga0307511_10000004 3300030521 Bacteria 190823
134 Ga0307511_10001347 3300030521 Bacteria 26036
135 Ga0265340_10021555 3300031247 Bacteria 3305
136 Ga0307513_10004331 3300031456 Bacteria 18961
137 Ga0307513_10174986 3300031456 Bacteria 2018
138 Ga0316576_10036082 3300031727 Bacteria 3533
139 Ga0316578_10037599 3300031728 Bacteria 2789
140 Ga0307413_10029194 3300031824 Bacteria 3082
141 Ga0307518_10000119 3300031838 Bacteria 55173
142 Ga0307415_100590517 3300032126 Bacteria 987
143 Ga0307507_10004207 3300033179 Bacteria 26027
144 Ga0307510_10005945 3300033180 Bacteria 14566
145 Ga0373932_0026572 3300035112 Bacteria 1576
146 Ga0373956_0000218 3300035119 Bacteria 22632
147 Ga0373957_0087623 3300035120 Bacteria 1234
148 Ga0316574_0221914 3300035398 Bacteria 1211
149 Ga0373937_0044763 3300036401 Bacteria 4043
150 Ga0316584_0079593 3300036712 Bacteria 2455
151 Ga0373925_0109596 3300037068 Bacteria 2131
152 Ga0395900_0018247 3300037418 Bacteria 7158
153 Ga0395900_0402884 3300037418 Bacteria 1332
154 Ga0395900_0534285 3300037418 Bacteria 1119
155 Ga0395905_0100097 3300037471 Bacteria 2722
156 Ga0436364_1509580 3300037853 Bacteria 36008
157 Ga0395901_0143178 3300038443 Bacteria 2513
158 Ga0395901_0448576 3300038443 Bacteria 1320
159 Ga0436365_1253918 3300039437 Bacteria 7152
160 Ga0439436_0028736 3300041404 Bacteria 1622
161 Ga0439439_0054177 3300041406 Bacteria 1056
162 Ga0451833_1173248 3300041491 Bacteria 961
163 Ga0466969_0012178 3300044656 Bacteria 4544
164 Ga0466969_0012889 3300044656 Bacteria 4404
165 Ga0466972_0017180 3300044658 Bacteria 3619
166 Ga0466972_0074593 3300044658 Bacteria 1616
167 Ga0466965_0041034 3300044683 Bacteria 2279
168 Ga0466966_0002182 3300044684 Bacteria 12708
169 Ga0466966_0209477 3300044684 Bacteria 1178
170 Ga0466961_0001471 3300044693 Bacteria 14629
171 Ga0466963_0031200 3300044694 Bacteria 3444
172 Ga0466963_0043450 3300044694 Bacteria 2955
173 Ga0466963_0085694 3300044694 Bacteria 2139
174 Ga0466963_0273983 3300044694 Bacteria 1186
175 Ga0466971_0059446 3300044719 Bacteria 1726
176 Ga0466968_0060118 3300044735 Bacteria 1638
177 Ga0466970_0000940 3300044765 Bacteria 14065
178 Ga0466957_0191375 3300044842 Bacteria 1340
179 Ga0466960_0001650 3300044901 Bacteria 8172
180 Ga0466960_0015326 3300044901 Bacteria 3302
181 Ga0466960_0033520 3300044901 Bacteria 2387
182 Ga0466960_0078907 3300044901 Bacteria 1654
183 Ga0466960_0173536 3300044901 Bacteria 1165
184 Ga0466958_0197103 3300045836 Bacteria 1281
185 Ga0466967_0002711 3300045976 Bacteria 11193
186 Ga0466967_0122651 3300045976 Bacteria 2404
187 Ga0466967_0137121 3300045976 Bacteria 2276
188 Ga0466967_0383242 3300045976 Bacteria 1365
189 Ga0466967_0546902 3300045976 Bacteria 1139
190 Ga0466967_0658984 3300045976 Bacteria 1035
191 Ga0466967_0934275 3300045976 Bacteria 863
192 Ga0495665_0150046 3300046531 Bacteria 1217
193 Ga0495581_0014259 3300047315 Bacteria 4609
194 Ga0496100_0006836 3300048903 Bacteria 6250
195 Ga0496100_0011305 3300048903 Bacteria 5080
196 Ga0496100_0011838 3300048903 Bacteria 4978
197 Ga0496100_0023693 3300048903 Bacteria 3733
198 Ga0496100_0299744 3300048903 Bacteria 1203
199 Ga0496101_0001678 3300048904 Bacteria 13268
200 Ga0496101_0133112 3300048904 Bacteria 1889
201 Ga0496101_0188678 3300048904 Bacteria 1590
202 Ga0496102_0000017 3300048905 Bacteria 284200
203 Ga0496102_0000080 3300048905 Bacteria 140541
204 Ga0496102_0002441 3300048905 Bacteria 15850
205 Ga0496102_0264746 3300048905 Bacteria 1621
206 Ga0496103_0000019 3300048906 Bacteria 234311
207 Ga0496103_0000118 3300048906 Bacteria 86519
208 Ga0496104_0068427 3300048907 Bacteria 3374
209 Ga0496104_0097778 3300048907 Bacteria 2809
210 Ga0496104_0121941 3300048907 Bacteria 2503
211 Ga0496104_0144278 3300048907 Bacteria 2286
212 Ga0496105_0008554 3300048908 Bacteria 7949
213 Ga0496105_0056517 3300048908 Bacteria 3239
214 Ga0496105_0437847 3300048908 Bacteria 1033
215 Ga0496108_0042982 3300048911 Bacteria 3774
216 Ga0496109_0068808 3300048912 Bacteria 3245
217 Ga0496109_0073537 3300048912 Bacteria 3141
218 Ga0496109_0298893 3300048912 Bacteria 1518
219 Ga0496109_0387952 3300048912 Bacteria 1319
220 Ga0496110_0155108 3300048913 Bacteria 2074
221 Ga0496110_0170506 3300048913 Bacteria 1974
222 Ga0496110_0263193 3300048913 Bacteria 1570
223 Ga0496111_0099744 3300048914 Bacteria 2133
224 Ga0496112_0128995 3300048915 Bacteria 2500
225 Ga0496112_0296452 3300048915 Bacteria 1563
226 Ga0496113_0094151 3300048916 Bacteria 2314
227 Ga0496113_0244073 3300048916 Bacteria 1433
228 Ga0496113_0327725 3300048916 Bacteria 1228
229 Ga0496113_0333046 3300048916 Bacteria 1217
230 Ga0496114_0021029 3300048917 Bacteria 5302
231 Ga0496114_0190458 3300048917 Bacteria 1794
232 Ga0496115_0372831 3300048918 Bacteria 1162
233 Ga0496116_0000241 3300048919 Bacteria 100186
234 Ga0496116_0000363 3300048919 Bacteria 69750
235 Ga0496117_0000101 3300048920 Bacteria 191796
236 Ga0496117_0000287 3300048920 Bacteria 91621
237 Ga0496118_0000266 3300048921 Bacteria 91632
238 Ga0496118_0000267 3300048921 Bacteria 91458
239 Ga0496119_0001079 3300048922 Bacteria 34469
240 Ga0496119_0005823 3300048922 Bacteria 11650
241 Ga0496120_0032680 3300048923 Bacteria 3134
242 Ga0496120_0032894 3300048923 Bacteria 3121
243 Ga0496121_0002464 3300048924 Bacteria 28251
244 Ga0496121_0027673 3300048924 Bacteria 5299
245 Ga0496124_0007423 3300048927 Bacteria 11656
246 Ga0496124_0020018 3300048927 Bacteria 6199
247 Ga0496125_0011134 3300048928 Bacteria 9020
248 Ga0496126_0000198 3300048929 Bacteria 133897
249 Ga0496126_0000383 3300048929 Bacteria 91602
250 Ga0501034_0406568 3300049571 Bacteria 1284
251 Ga0501039_0292877 3300049575 Bacteria 1280
252 nmdc:mga05p37_190841_c1 3300050507 Bacteria 2488
253 nmdc:mga05p37_573_c1 3300050507 Bacteria 40363
254 nmdc:mga05p37_61_c1 3300050507 Bacteria 94943
255 nmdc:mga09592_17_c1 3300050508 Bacteria 95560
256 nmdc:mga09592_296803_c1 3300050508 Bacteria 1401
257 nmdc:mga09592_409949_c1 3300050508 Bacteria 1171
258 nmdc:mga09592_468148_c1 3300050508 Bacteria 1087
259 nmdc:mga09592_572_c1 3300050508 Bacteria 27956
260 nmdc:mga0qj67_1351_c1 3300050509 Bacteria 17252
261 nmdc:mga0qj67_32_c1 3300050509 Bacteria 98555
262 nmdc:mga06r32_115797_c1 3300050510 Bacteria 2640
263 nmdc:mga06r32_192_c1 3300050510 Bacteria 6621
264 nmdc:mga06r32_26_c1 3300050510 Bacteria 90558
265 nmdc:mga08y16_1031_c1 3300050511 Bacteria 27337
266 nmdc:mga08y16_604470_c1 3300050511 Bacteria 1105
267 nmdc:mga0n895_370016_c1 3300050512 Bacteria 1451
268 nmdc:mga0a205_583291_c1 3300050515 Bacteria 972
269 Ga0500616_0001905 3300053153 Bacteria 18682
270 Ga0530510_0035923 3300061734 Bacteria 3572
271 2558910118 2558860112 Bacteria 9931328
272 2559427874 2558860280 Bacteria 11429938
273 2586057496 2585427649 Bacteria 9053857
274 2644084386 2643221613 Bacteria 4622396
275 2644611472 2643221711 Bacteria 4865335
276 2644664436 2643221721 Bacteria 4486924
277 2795780773 2795385470 Bacteria 8317180
278 2809585658 2808606522 Bacteria 9488490
279 2816506397 2816332139 Bacteria 9138787
280 2819428132 2818991318 Bacteria 5266538
281 2819668315 2818991458 Bacteria 4794049
282 2819692164 2818991462 Bacteria 4320267
283 2819729905 2818991469 Bacteria 4644110
284 2866612375 2866612099 Bacteria 7543886
285 2870782714 2870782633 Bacteria 9624083
286 2891332026 2891326441 Bacteria 6439512
287 2899376188 2899370129 Bacteria 6781179
288 2915361509 2915358134 Bacteria 6050864
289 2915363666 2915358134 Bacteria 6050864
290 2915776179 2915768154 Bacteria 8424322
291 2917744992 2917736166 Bacteria 9690793
292 2935891904 2935890801 Bacteria 4593001
293 2974318619 2974315732 Bacteria 4602776
294 2984526860 2984523437 Bacteria 4508481
295 8003314584 8003314358 Bacteria 10575343
296 8054472392 8054472261 Bacteria 7464355
297 8054476089 8054472261 Bacteria 7464355
298 Ga0466957_0052657
299 Ga0070658_10159604
300 Ga0070683_100112488
301 Ga0068869_100165309
302 Ga0070680_100333359
303 Ga0070682_100141516
304 Ga0068868_100051274
305 Ga0068868_100251886
306 Ga0070689_100239215
307 Ga0070691_10163292
308 Ga0070661_100148013
309 Ga0070668_100029685
310 Ga0070668_100231246
311 Ga0070669_100088747
312 Ga0070671_100005459
313 Ga0070671_100010714
314 Ga0070674_100400953
315 Ga0070673_100164196
316 Ga0070688_100095715
317 Ga0070667_100231996
318 Ga0070714_100197114
319 Ga0070713_100055187
320 Ga0070700_100026921
321 Ga0070700_100045589
322 Ga0070663_100003610
323 Ga0070662_100334007
324 Ga0070685_10142697
325 Ga0070684_100268115
326 Ga0068853_100011680
327 Ga0070672_100339839
328 Ga0070665_100002945
329 Ga0070665_100003392
330 Ga0070665_100097402
331 Ga0068857_100022815
332 Ga0070702_100332849
333 Ga0068852_100041836
334 Ga0068861_100076998
335 Ga0068863_100000693
336 Ga0068863_100009244
337 Ga0068863_100121090
338 Ga0068860_100050207
339 Ga0068860_100297078
340 Ga0081455_10004003
341 Ga0081455_10135873
342 Ga0081539_10000070
343 Ga0070717_10085300
344 Ga0075432_10070448
345 Ga0075428_100002497
346 Ga0075428_100017497
347 Ga0075428_100475108
348 Ga0075430_100024311
349 Ga0075430_100079365
350 Ga0075430_100146295
351 Ga0075431_100001005
352 Ga0075431_100001137
353 Ga0075431_100046142
354 Ga0075431_100066811
355 Ga0075431_100385542
356 Ga0075429_100002528
357 Ga0075429_100059721
358 Ga0075429_100113140
359 Ga0075429_100147138
360 Ga0105251_10110300
361 Ga0111539_10331459
362 Ga0105245_10575715
363 Ga0105247_10012952
364 Ga0114129_10000557
365 Ga0114129_10016040
366 Ga0114129_10111563
367 Ga0105238_10169766
368 Ga0105249_10245709
369 Ga0157371_10126070
370 Ga0157370_10269011
371 Ga0157369_10171119
372 Ga0157369_10872296
373 Ga0157374_10163459
374 Ga0157378_10230717
375 Ga0157378_10230786
376 Ga0157372_10121814
377 Ga0157375_10345868
378 Ga0157379_10013933
379 Ga0157379_10153970
380 Ga0163161_10078232
381 Ga0213875_10002348
382 Ga0224712_10113091
383 Ga0207688_10050635
384 Ga0207680_10104673
385 Ga0207645_10049138
386 Ga0207643_10063908
387 Ga0207654_10058534
388 Ga0207662_10034843
389 Ga0207652_10506631
390 Ga0207694_10130317
391 Ga0207650_10447381
392 Ga0207659_10113564
393 Ga0207687_10458823
394 Ga0207664_10008069
395 Ga0207644_10001201
396 Ga0207644_10002585
397 Ga0207706_10342174
398 Ga0207704_10050806
399 Ga0207691_10091270
400 Ga0207689_10069785
401 Ga0207689_10165953
402 Ga0207712_10067930
403 Ga0207668_10005346
404 Ga0207668_10041692
405 Ga0207668_10079136
406 Ga0207668_10160107
407 Ga0207668_10478570
408 Ga0207640_10259886
409 Ga0207658_10201466
410 Ga0207639_10016104
411 Ga0207678_10000379
412 Ga0207678_10093973
413 Ga0207708_10109222
414 Ga0207708_10282176
415 Ga0207702_10205854
416 Ga0207641_10002078
417 Ga0207641_10028527
418 Ga0207641_10095555
419 Ga0207674_10020092
420 Ga0207674_10085156
421 Ga0207674_10115820
422 Ga0207675_100010963
423 Ga0207683_10165994
424 Ga0207698_10398604
425 Ga0207428_10003673
426 Ga0268266_10017505
427 Ga0268266_10193581
428 Ga0268265_10044407
429 Ga0265334_10008840
430 Ga0307511_10000004
431 Ga0307511_10001347
432 Ga0265340_10021555
433 Ga0307513_10004331
434 Ga0307513_10174986
435 Ga0316576_10036082
436 Ga0316578_10037599
437 Ga0307413_10029194
438 Ga0307518_10000119
439 Ga0307415_100590517
440 Ga0307507_10004207
441 Ga0307510_10005945
442 Ga0373932_0026572
443 Ga0373956_0000218
444 Ga0373957_0087623
445 Ga0316574_0221914
446 Ga0373937_0044763
447 Ga0316584_0079593
448 Ga0373925_0109596
449 Ga0395900_0018247
450 Ga0395900_0402884
451 Ga0395900_0534285
452 Ga0395905_0100097
453 Ga0436364_1509580
454 Ga0395901_0143178
455 Ga0395901_0448576
456 Ga0436365_1253918
457 Ga0439436_0028736
458 Ga0439439_0054177
459 Ga0451833_1173248
460 Ga0466969_0012178
461 Ga0466969_0012889
462 Ga0466972_0017180
463 Ga0466972_0074593
464 Ga0466965_0041034
465 Ga0466966_0002182
466 Ga0466966_0209477
467 Ga0466961_0001471
468 Ga0466963_0031200
469 Ga0466963_0043450
470 Ga0466963_0085694
471 Ga0466963_0273983
472 Ga0466971_0059446
473 Ga0466968_0060118
474 Ga0466970_0000940
475 Ga0466957_0191375
476 Ga0466960_0001650
477 Ga0466960_0015326
478 Ga0466960_0033520
479 Ga0466960_0078907
480 Ga0466960_0173536
481 Ga0466958_0197103
482 Ga0466967_0002711
483 Ga0466967_0122651
484 Ga0466967_0137121
485 Ga0466967_0383242
486 Ga0466967_0546902
487 Ga0466967_0658984
488 Ga0466967_0934275
489 Ga0495665_0150046
490 Ga0495581_0014259
491 Ga0496100_0006836
492 Ga0496100_0011305
493 Ga0496100_0011838
494 Ga0496100_0023693
495 Ga0496100_0299744
496 Ga0496101_0001678
497 Ga0496101_0133112
498 Ga0496101_0188678
499 Ga0496102_0000017
500 Ga0496102_0000080
501 Ga0496102_0002441
502 Ga0496102_0264746
503 Ga0496103_0000019
504 Ga0496103_0000118
505 Ga0496104_0068427
506 Ga0496104_0097778
507 Ga0496104_0121941
508 Ga0496104_0144278
509 Ga0496105_0008554
510 Ga0496105_0056517
511 Ga0496105_0437847
512 Ga0496108_0042982
513 Ga0496109_0068808
514 Ga0496109_0073537
515 Ga0496109_0298893
516 Ga0496109_0387952
517 Ga0496110_0155108
518 Ga0496110_0170506
519 Ga0496110_0263193
520 Ga0496111_0099744
521 Ga0496112_0128995
522 Ga0496112_0296452
523 Ga0496113_0094151
524 Ga0496113_0244073
525 Ga0496113_0327725
526 Ga0496113_0333046
527 Ga0496114_0021029
528 Ga0496114_0190458
529 Ga0496115_0372831
530 Ga0496116_0000241
531 Ga0496116_0000363
532 Ga0496117_0000101
533 Ga0496117_0000287
534 Ga0496118_0000266
535 Ga0496118_0000267
536 Ga0496119_0001079
537 Ga0496119_0005823
538 Ga0496120_0032680
539 Ga0496120_0032894
540 Ga0496121_0002464
541 Ga0496121_0027673
542 Ga0496124_0007423
543 Ga0496124_0020018
544 Ga0496125_0011134
545 Ga0496126_0000198
546 Ga0496126_0000383
547 Ga0501034_0406568
548 Ga0501039_0292877
549 nmdc:mga05p37_190841_c1
550 nmdc:mga05p37_573_c1
551 nmdc:mga05p37_61_c1
552 nmdc:mga09592_17_c1
553 nmdc:mga09592_296803_c1
554 nmdc:mga09592_409949_c1
555 nmdc:mga09592_468148_c1
556 nmdc:mga09592_572_c1
557 nmdc:mga0qj67_1351_c1
558 nmdc:mga0qj67_32_c1
559 nmdc:mga06r32_115797_c1
560 nmdc:mga06r32_192_c1
561 nmdc:mga06r32_26_c1
562 nmdc:mga08y16_1031_c1
563 nmdc:mga08y16_604470_c1
564 nmdc:mga0n895_370016_c1
565 nmdc:mga0a205_583291_c1
566 Ga0500616_0001905
567 Ga0530510_0035923
568 2558910118
569 2559427874
570 2586057496
571 2644084386
572 2644611472
573 2644664436
574 2795780773
575 2809585658
576 2816506397
577 2819428132
578 2819668315
579 2819692164
580 2819729905
581 2866612375
582 2870782714
583 2891332026
584 2899376188
585 2915361509
586 2915363666
587 2915776179
588 2917744992
589 2935891904
590 2974318619
591 2984526860
592 8003314584
593 8054472392
594 8054476089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

203

305

0.92

PF00072

Response_reg

Response regulator receiver domain

40

172

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mav-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ 0.9096 10 154
1mb3-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ 0.9032 10 154
4qyw-assembly1.cif.gz_A structure of phosphono-chey from t.maritima 0.9007 9 154
1xhf-assembly1.cif.gz_A crystal structure of the bef3-activated receiver domain of redox response regulator arca 0.8995 8 157
2id7-assembly1.cif.gz_A 1.75 a structure of t87i phosphono-chey 0.8981 9 159
ID Description Score Start End Superfamily
af_P60611_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9279 10 168 3.40.50.2300
af_P60611_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9073 10 168 3.40.50.2300
af_A0A1D6EDG3_15_141_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9023 12 153 3.40.50.2300
3a10A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8997 11 155 3.40.50.2300
af_Q9M9B9_30_156_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8927 8 158 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7Y9ELP4-F1-model_v4 DNA-binding LytR/AlgR family response regulator 0.9717 172 283 GO:0000156
GO:0003677
AF-A0A5C4J7Q9-F1-model_v4 LytTR family transcriptional regulator 0.9648 173 284 GO:0000156
GO:0003677
AF-A0A6B3CWD3-F1-model_v4 LytTR family transcriptional regulator 0.9628 176 278 GO:0000156
GO:0003677
AF-A0A6B3CWD3-F1-model_v4 LytTR family transcriptional regulator 0.9442 176 278 GO:0000156
GO:0003677
AF-A0A1Q7DC68-F1-model_v4 Response regulatory domain-containing protein 0.9359 10 153 GO:0000160

Map