F393764

General Info

Members Datasets Scaffolds Average Seq Length
297 181 294 216

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10047544|Ga0265327_100475442
Length 244
Sequence MMRFVPQRILTYATFPPHARRDVNSKKSMLGIYGGTFDPIHYGHLRTALEVKEALRLDELRLLPCRLPPHRGSPGATPGQRVAMLELALQNAEPGFAVDRRELEREGPSYMVDTLASLRGEFPGRPLCLIVGWDAFCGLPAWHRWRELFELAHLAVMRRPDATEPEWLDGLAEMVAERRTDELGDLRLTPAGRVVFLEVTQLAISATVIRHLVGEGKSPRYLLPEAVARMIRAEGLYRRDGGEK

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
3 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
126 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
138 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
139 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
140 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
141 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
142 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
178 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 1.68
Rhizosphere 91.92
Stem 0
Stem Tuber 0
Unclassified 5.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10182114 3300003316 Unclassified 1865
2 rootL2_10213749 3300003322 Unclassified 1908
3 Ga0065707_10014548 3300005295 Bacteria 1953
4 Ga0070658_10125009 3300005327 Bacteria 2140
5 Ga0070690_100196571 3300005330 Bacteria 1401
6 Ga0070670_100076803 3300005331 Bacteria 2870
7 Ga0070670_100147106 3300005331 Bacteria 2038
8 Ga0070670_100344012 3300005331 Bacteria 1309
9 Ga0070670_100354558 3300005331 Bacteria 1289
10 Ga0068869_100021784 3300005334 Bacteria 4411
11 Ga0068869_100052792 3300005334 Bacteria 2952
12 Ga0070666_10011720 3300005335 Bacteria 5512
13 Ga0070689_100060585 3300005340 Bacteria 2943
14 Ga0070691_10071126 3300005341 Bacteria 1688
15 Ga0070692_10057919 3300005345 Bacteria 2033
16 Ga0070668_100095682 3300005347 Bacteria 2346
17 Ga0070675_100217939 3300005354 Bacteria 1661
18 Ga0070675_100740694 3300005354 Unclassified 896
19 Ga0070671_100312525 3300005355 Bacteria 1338
20 Ga0070674_100128947 3300005356 Bacteria 1883
21 Ga0070673_100601953 3300005364 Bacteria 1003
22 Ga0070667_100003920 3300005367 Bacteria 12640
23 Ga0070667_100110005 3300005367 Unclassified 2388
24 Ga0070667_100438869 3300005367 Bacteria 1192
25 Ga0070713_100005301 3300005436 Bacteria 8795
26 Ga0070710_10161752 3300005437 Bacteria 1389
27 Ga0070701_10045163 3300005438 Bacteria 2260
28 Ga0070711_100074055 3300005439 Bacteria 2408
29 Ga0070705_100140459 3300005440 Bacteria 1589
30 Ga0070700_100060221 3300005441 Bacteria 2392
31 Ga0070700_100245507 3300005441 Unclassified 1281
32 Ga0070694_100151382 3300005444 Bacteria 1695
33 Ga0070708_100019388 3300005445 Bacteria 5715
34 Ga0070708_100191923 3300005445 Bacteria 1910
35 Ga0070678_100266833 3300005456 Bacteria 1442
36 Ga0068867_100022466 3300005459 Bacteria 4511
37 Ga0070672_100011537 3300005543 Bacteria 6164
38 Ga0070672_100406587 3300005543 Bacteria 1167
39 Ga0070686_100068095 3300005544 Bacteria 2321
40 Ga0070693_100180395 3300005547 Bacteria 1359
41 Ga0070665_100098844 3300005548 Bacteria 2923
42 Ga0070665_100266564 3300005548 Bacteria 1714
43 Ga0068855_100037286 3300005563 Bacteria 5783
44 Ga0068857_100232106 3300005577 Bacteria 1688
45 Ga0070702_100213386 3300005615 Bacteria 1286
46 Ga0068852_100423184 3300005616 Unclassified 1314
47 Ga0068852_101020558 3300005616 Bacteria 846
48 Ga0068859_100333503 3300005617 Bacteria 1611
49 Ga0068864_100000841 3300005618 Bacteria 25890
50 Ga0068864_100017969 3300005618 Bacteria 5900
51 Ga0068864_100125772 3300005618 Bacteria 2297
52 Ga0068864_100169517 3300005618 Unclassified 1990
53 Ga0068864_100260498 3300005618 Bacteria 1613
54 Ga0068864_100430593 3300005618 Bacteria 1258
55 Ga0068861_100397861 3300005719 Bacteria 1221
56 Ga0068863_100054476 3300005841 Bacteria 3789
57 Ga0068863_100234970 3300005841 Bacteria 1769
58 Ga0068858_100013104 3300005842 Bacteria 7818
59 Ga0068860_100053931 3300005843 Bacteria 3822
60 Ga0068860_100158803 3300005843 Bacteria 2179
61 Ga0068862_100010462 3300005844 Bacteria 7661
62 Ga0068862_100015990 3300005844 Bacteria 6238
63 Ga0068862_100546285 3300005844 Bacteria 1106
64 Ga0081455_10267975 3300005937 Unclassified 1240
65 Ga0070716_100080773 3300006173 Bacteria 1939
66 Ga0097621_100082531 3300006237 Bacteria 2677
67 Ga0068871_100454531 3300006358 Bacteria 1148
68 Ga0075430_100023766 3300006846 Bacteria 5219
69 Ga0075430_100284490 3300006846 Bacteria 1368
70 Ga0075431_100063008 3300006847 Bacteria 3826
71 Ga0075431_100245533 3300006847 Bacteria 1820
72 Ga0075433_10013806 3300006852 Bacteria 6583
73 Ga0075433_10055666 3300006852 Bacteria 3453
74 Ga0075429_100015102 3300006880 Bacteria 6693
75 Ga0097620_100333530 3300006931 Bacteria 1611
76 Ga0111539_11005646 3300009094 Bacteria 969
77 Ga0105245_10297455 3300009098 Bacteria 1583
78 Ga0105247_10025695 3300009101 Bacteria 3554
79 Ga0105243_10368378 3300009148 Bacteria 1325
80 Ga0105242_10031959 3300009176 Bacteria 4208
81 Ga0105242_11126271 3300009176 Unclassified 800
82 Ga0105248_10602909 3300009177 Bacteria 1239
83 Ga0105238_10000157 3300009551 Bacteria 74320
84 Ga0105249_10017355 3300009553 Bacteria 6391
85 Ga0157378_10293257 3300013297 Bacteria 1572
86 Ga0157378_10341379 3300013297 Bacteria 1461
87 Ga0163162_10089494 3300013306 Bacteria 3159
88 Ga0163162_10464168 3300013306 Unclassified 1398
89 Ga0163162_10830910 3300013306 Bacteria 1040
90 Ga0157372_10516568 3300013307 Bacteria 1392
91 Ga0157375_10027802 3300013308 Bacteria 5292
92 Ga0157375_10454780 3300013308 Bacteria 1446
93 Ga0163163_10648960 3300014325 Bacteria 1119
94 Ga0157380_10006331 3300014326 Bacteria 8320
95 Ga0157380_10058558 3300014326 Bacteria 3071
96 Ga0157380_10928790 3300014326 Bacteria 898
97 Ga0157376_10020169 3300014969 Bacteria 5151
98 Ga0157376_10065872 3300014969 Bacteria 3061
99 Ga0157376_10089912 3300014969 Bacteria 2656
100 Ga0163161_10181009 3300017792 Bacteria 1616
101 Ga0207697_10024531 3300025315 Bacteria 2468
102 Ga0207710_10038772 3300025900 Bacteria 2107
103 Ga0207680_10005288 3300025903 Bacteria 6163
104 Ga0207699_10208786 3300025906 Unclassified 1327
105 Ga0207645_10152450 3300025907 Bacteria 1509
106 Ga0207643_10029368 3300025908 Bacteria 3057
107 Ga0207693_10202758 3300025915 Bacteria 1560
108 Ga0207694_10002734 3300025924 Bacteria 14268
109 Ga0207650_10024261 3300025925 Bacteria 4310
110 Ga0207650_10184254 3300025925 Bacteria 1665
111 Ga0207650_10230826 3300025925 Bacteria 1492
112 Ga0207659_10003570 3300025926 Bacteria 9367
113 Ga0207659_10050484 3300025926 Bacteria 2955
114 Ga0207659_10137501 3300025926 Bacteria 1893
115 Ga0207687_10094668 3300025927 Bacteria 2186
116 Ga0207644_10551618 3300025931 Bacteria 954
117 Ga0207706_10008271 3300025933 Bacteria 9600
118 Ga0207706_10245544 3300025933 Bacteria 1564
119 Ga0207709_10095115 3300025935 Bacteria 1957
120 Ga0207670_10151617 3300025936 Bacteria 1721
121 Ga0207669_10186370 3300025937 Bacteria 1493
122 Ga0207669_10514682 3300025937 Bacteria 960
123 Ga0207665_10034647 3300025939 Bacteria 3349
124 Ga0207691_10012770 3300025940 Bacteria 8040
125 Ga0207691_10092944 3300025940 Bacteria 2701
126 Ga0207691_10169181 3300025940 Bacteria 1914
127 Ga0207711_10047502 3300025941 Bacteria 3670
128 Ga0207689_10001809 3300025942 Bacteria 20177
129 Ga0207689_10067957 3300025942 Bacteria 2928
130 Ga0207667_10065604 3300025949 Bacteria 3786
131 Ga0207668_10272492 3300025972 Bacteria 1384
132 Ga0207668_10536315 3300025972 Bacteria 1012
133 Ga0207658_10162406 3300025986 Unclassified 1832
134 Ga0207658_10438856 3300025986 Bacteria 1154
135 Ga0207658_10604162 3300025986 Bacteria 986
136 Ga0207658_10719033 3300025986 Unclassified 903
137 Ga0207703_10073732 3300026035 Bacteria 2824
138 Ga0207708_10100858 3300026075 Bacteria 2234
139 Ga0207702_10027749 3300026078 Bacteria 4704
140 Ga0207641_10141292 3300026088 Unclassified 2172
141 Ga0207641_10150075 3300026088 Bacteria 2110
142 Ga0207641_10478688 3300026088 Bacteria 1206
143 Ga0207648_10164521 3300026089 Bacteria 1960
144 Ga0207648_10175839 3300026089 Bacteria 1893
145 Ga0207676_10067463 3300026095 Bacteria 2857
146 Ga0207676_10078084 3300026095 Bacteria 2680
147 Ga0207676_10378849 3300026095 Bacteria 1316
148 Ga0207676_10450610 3300026095 Unclassified 1213
149 Ga0207676_10537117 3300026095 Bacteria 1115
150 Ga0207675_100020752 3300026118 Bacteria 6125
151 Ga0207675_100181343 3300026118 Bacteria 2016
152 Ga0207675_100507107 3300026118 Unclassified 1201
153 Ga0207683_10050174 3300026121 Bacteria 3654
154 Ga0209969_1016106 3300027360 Bacteria 1095
155 Ga0209995_1019749 3300027471 Bacteria 1113
156 Ga0268266_10151407 3300028379 Bacteria 2091
157 Ga0268265_10018818 3300028380 Bacteria 4791
158 Ga0268265_10104190 3300028380 Bacteria 2299
159 Ga0268264_10087182 3300028381 Bacteria 2683
160 Ga0307515_10175436 3300028794 Bacteria 2116
161 Ga0307515_10312150 3300028794 Bacteria 1246
162 Ga0265327_10005077 3300031251 Bacteria 11224
163 Ga0265327_10042661 3300031251 Bacteria 2433
164 Ga0265327_10047544 3300031251 Unclassified 2262
165 Ga0265327_10118551 3300031251 Bacteria 1257
166 Ga0265316_10000062 3300031344 Bacteria 113912
167 Ga0265316_10501666 3300031344 Bacteria 867
168 Ga0307509_10000009 3300031507 Bacteria 350890
169 Ga0307509_10159708 3300031507 Bacteria 2154
170 Ga0307408_100041067 3300031548 Bacteria 3278
171 Ga0307408_100605117 3300031548 Bacteria 974
172 Ga0307508_10097079 3300031616 Bacteria 2538
173 Ga0316575_10000370 3300031665 Bacteria 12802
174 Ga0316575_10055495 3300031665 Bacteria 1578
175 Ga0316576_10046125 3300031727 Bacteria 3153
176 Ga0316576_10131890 3300031727 Unclassified 1880
177 Ga0316576_10174670 3300031727 Bacteria 1621
178 Ga0316576_10188912 3300031727 Bacteria 1553
179 Ga0316576_10220267 3300031727 Bacteria 1428
180 Ga0316576_10223480 3300031727 Bacteria 1416
181 Ga0316578_10103542 3300031728 Bacteria 1707
182 Ga0316578_10249905 3300031728 Bacteria 1064
183 Ga0307405_10024144 3300031731 Bacteria 3468
184 Ga0307405_10162843 3300031731 Bacteria 1582
185 Ga0307405_10183955 3300031731 Bacteria 1503
186 Ga0307410_10014000 3300031852 Bacteria 4702
187 Ga0307406_10784776 3300031901 Bacteria 803
188 Ga0307407_10008880 3300031903 Bacteria 4645
189 Ga0307407_10071496 3300031903 Bacteria 2066
190 Ga0307412_10332436 3300031911 Bacteria 1213
191 Ga0307409_100019885 3300031995 Bacteria 4560
192 Ga0307409_100021584 3300031995 Bacteria 4418
193 Ga0307409_100075988 3300031995 Bacteria 2692
194 Ga0307409_100396973 3300031995 Bacteria 1316
195 Ga0307416_100003739 3300032002 Bacteria 9032
196 Ga0307416_100778045 3300032002 Bacteria 1051
197 Ga0307414_10596156 3300032004 Bacteria 990
198 Ga0307411_10006672 3300032005 Bacteria 5798
199 Ga0307411_10155883 3300032005 Bacteria 1703
200 Ga0316583_10005590 3300032133 Bacteria 4514
201 Ga0316583_10116566 3300032133 Bacteria 931
202 Ga0316585_10072049 3300032137 Bacteria 1122
203 Ga0373944_0024701 3300035089 Bacteria 1764
204 Ga0373939_0159674 3300035114 Bacteria 827
205 Ga0373956_0281243 3300035119 Bacteria 792
206 Ga0373943_0041107 3300035170 Unclassified 2235
207 Ga0373942_0342167 3300035207 Unclassified 527
208 Ga0316574_0026363 3300035398 Bacteria 3494
209 Ga0316574_0040830 3300035398 Bacteria 2857
210 Ga0316574_0073681 3300035398 Bacteria 2160
211 Ga0316574_0155395 3300035398 Bacteria 1474
212 Ga0373935_0083020 3300035692 Bacteria 2085
213 Ga0373937_0117796 3300036401 Bacteria 2474
214 Ga0316582_0063204 3300036647 Bacteria 2378
215 Ga0316582_0169352 3300036647 Bacteria 1482
216 Ga0316584_0055160 3300036712 Bacteria 2976
217 Ga0316584_0164000 3300036712 Bacteria 1650
218 Ga0316584_0426066 3300036712 Bacteria 942
219 Ga0400490_16260 3300038726 Bacteria 13490
220 Ga0400490_51411 3300038726 Bacteria 1748
221 Ga0400486_32189 3300038742 Bacteria 1658
222 Ga0400483_276404 3300039062 Bacteria 1427
223 Ga0439453_0045710 3300041408 Unclassified 872
224 Ga0451795_0939415 3300041456 Bacteria 1713
225 Ga0451800_0731181 3300041459 Bacteria 2257
226 Ga0451853_2189050 3300041512 Bacteria 1156
227 Ga0451577_0000105 3300042876 Bacteria 184360
228 Ga0451577_0004900 3300042876 Bacteria 13952
229 Ga0451577_0015034 3300042876 Bacteria 7201
230 Ga0451577_0023405 3300042876 Bacteria 5634
231 Ga0451577_0028012 3300042876 Bacteria 5097
232 Ga0451577_0044598 3300042876 Bacteria 3970
233 Ga0451577_0079845 3300042876 Bacteria 2916
234 Ga0453683_0000009 3300044673 Bacteria 491115
235 Ga0453684_0000123 3300044712 Bacteria 339304
236 Ga0453684_0001182 3300044712 Bacteria 80877
237 Ga0453684_0002182 3300044712 Bacteria 48823
238 Ga0453684_0002840 3300044712 Bacteria 40778
239 Ga0453684_0013318 3300044712 Bacteria 13383
240 Ga0453684_0049832 3300044712 Bacteria 5515
241 Ga0453684_0145811 3300044712 Bacteria 2820
242 Ga0453684_0337891 3300044712 Bacteria 1701
243 Ga0451576_0000358 3300045051 Bacteria 109586
244 Ga0451576_0021898 3300045051 Bacteria 6939
245 Ga0451576_0093478 3300045051 Bacteria 3127
246 Ga0451576_0134404 3300045051 Bacteria 2579
247 Ga0495580_0001225 3300046472 Bacteria 22641
248 Ga0495581_0032108 3300047315 Bacteria 3041
249 Ga0495680_0287734 3300047322 Bacteria 1157
250 Ga0495602_0230913 3300048088 Bacteria 1390
251 Ga0496105_0417717 3300048908 Unclassified 1062
252 Ga0496112_0151984 3300048915 Bacteria 2282
253 Ga0496112_0241339 3300048915 Bacteria 1759
254 Ga0501300_004881 3300049523 Bacteria 1983
255 Ga0501031_0550116 3300049568 Bacteria 743
256 Ga0501032_0476214 3300049569 Bacteria 799
257 Ga0501034_0020923 3300049571 Bacteria 6679
258 Ga0501034_0037633 3300049571 Bacteria 4900
259 Ga0501037_0357425 3300049573 Bacteria 1007
260 Ga0501038_0415839 3300049574 Bacteria 1038
261 Ga0501040_0269922 3300049576 Bacteria 1215
262 Ga0501040_0797799 3300049576 Bacteria 683
263 Ga0501043_0011233 3300049579 Bacteria 7015
264 Ga0501046_0020632 3300049580 Bacteria 5447
265 Ga0501046_0025890 3300049580 Bacteria 4795
266 Ga0501047_0004771 3300049581 Bacteria 12752
267 Ga0501047_0043907 3300049581 Bacteria 4317
268 Ga0501047_0689190 3300049581 Bacteria 839
269 Ga0501070_0000290 3300049586 Bacteria 47027
270 Ga0501071_0122537 3300049587 Bacteria 1928
271 Ga0501071_0402370 3300049587 Bacteria 1045
272 Ga0501075_0267711 3300049591 Bacteria 1302
273 Ga0501075_0284056 3300049591 Bacteria 1261
274 Ga0501076_0213482 3300049592 Bacteria 1577
275 Ga0501076_0263591 3300049592 Bacteria 1411
276 Ga0501079_0213247 3300049741 Bacteria 1508
277 Ga0501079_0355950 3300049741 Bacteria 1147
278 Ga0501079_0577736 3300049741 Bacteria 884
279 Ga0501280_000743 3300049776 Bacteria 7155
280 Ga0501044_0016744 3300049823 Bacteria 7869
281 Ga0501045_0276091 3300049824 Bacteria 1251
282 nmdc:mga09592_75248_c1 3300050508 Bacteria 2357
283 nmdc:mga0qj67_306604_c1 3300050509 Unclassified 1286
284 nmdc:mga0qj67_52506_c1 3300050509 Bacteria 3226
285 nmdc:mga06r32_474481_c1 3300050510 Bacteria 1229
286 nmdc:mga0a205_28175_c1 3300050515 Bacteria 5369
287 Ga0495619_0394489 3300053085 Unclassified 956
288 Ga0500641_0013748 3300053096 Bacteria 2977
289 Ga0500641_0064702 3300053096 Unclassified 1528
290 Ga0500650_0000047 3300053098 Bacteria 40133
291 Ga0500568_0104378 3300053139 Bacteria 1062
292 Ga0501082_0364252 3300060353 Bacteria 1261
293 Ga0501082_0833330 3300060353 Unclassified 807
294 Ga0530510_0294392 3300061734 Bacteria 1214

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035207 Ga0373942_0342167 Ga0373942_0342167_10_513 157
2 3300039062 Ga0400483_276404 Ga0400483_276404_22_567 168
3 3300026118 Ga0207675_100181343 Ga0207675_1001813432 171
4 3300028794 Ga0307515_10312150 Ga0307515_103121502 174
5 3300041456 Ga0451795_0939415 Ga0451795_0939415_350_970 180
6 3300006237 Ga0097621_100082531 Ga0097621_1000825312 181
7 3300014969 Ga0157376_10020169 Ga0157376_100201695 181
8 3300026088 Ga0207641_10141292 Ga0207641_101412923 181
9 3300031728 Ga0316578_10249905 Ga0316578_102499052 183
10 3300005437 Ga0070710_10161752 Ga0070710_101617521 184
11 3300005445 Ga0070708_100019388 Ga0070708_1000193886 184
12 3300005445 Ga0070708_100191923 Ga0070708_1001919232 184
13 3300006173 Ga0070716_100080773 Ga0070716_1000807732 184
14 3300013307 Ga0157372_10516568 Ga0157372_105165682 184
15 3300025906 Ga0207699_10208786 Ga0207699_102087862 184
16 3300025915 Ga0207693_10202758 Ga0207693_102027583 184
17 3300025939 Ga0207665_10034647 Ga0207665_100346474 184
18 3300026078 Ga0207702_10027749 Ga0207702_100277494 184
19 3300035089 Ga0373944_0024701 Ga0373944_0024701_825_1430 184
20 3300035170 Ga0373943_0041107 Ga0373943_0041107_1106_1711 184
21 3300035398 Ga0316574_0040830 Ga0316574_0040830_2144_2752 184
22 3300035692 Ga0373935_0083020 Ga0373935_0083020_540_1145 184
23 3300048915 Ga0496112_0241339 Ga0496112_0241339_331_915 184
24 iso_pu_bacteria 2643221654 2644302381 184
25 3300005367 Ga0070667_100003920 Ga0070667_1000039209 185
26 3300005548 Ga0070665_100098844 Ga0070665_1000988442 185
27 3300005841 Ga0068863_100234970 Ga0068863_1002349703 185
28 3300013306 Ga0163162_10464168 Ga0163162_104641681 185
29 3300025941 Ga0207711_10047502 Ga0207711_100475022 185
30 3300025986 Ga0207658_10719033 Ga0207658_107190331 185
31 3300028794 Ga0307515_10175436 Ga0307515_101754362 185
32 3300031507 Ga0307509_10159708 Ga0307509_101597081 185
33 3300031616 Ga0307508_10097079 Ga0307508_100970792 185
34 3300031731 Ga0307405_10162843 Ga0307405_101628432 185
35 3300041459 Ga0451800_0731181 Ga0451800_0731181_1349_2023 186
36 3300042876 Ga0451577_0028012 Ga0451577_0028012_4403_5074 186
37 3300044712 Ga0453684_0013318 Ga0453684_0013318_4531_5202 186
38 3300045051 Ga0451576_0021898 Ga0451576_0021898_1111_1782 186
39 iso_pu_bacteria 2894510363 2894510982 188
40 3300049581 Ga0501047_0689190 Ga0501047_0689190_205_819 189
41 3300031995 Ga0307409_100396973 Ga0307409_1003969732 190
42 3300038726 Ga0400490_51411 Ga0400490_51411_720_1331 190
43 3300006852 Ga0075433_10013806 Ga0075433_100138068 191
44 3300031901 Ga0307406_10784776 Ga0307406_107847761 191
45 3300038726 Ga0400490_16260 Ga0400490_16260_1422_2042 191
46 3300038742 Ga0400486_32189 Ga0400486_32189_561_1175 191
47 3300046472 Ga0495580_0001225 Ga0495580_0001225_353_958 191
48 3300031344 Ga0265316_10501666 Ga0265316_105016662 192
49 3300042876 Ga0451577_0000105 Ga0451577_0000105_177179_177820 192
50 3300042876 Ga0451577_0044598 Ga0451577_0044598_1779_2402 192
51 3300044712 Ga0453684_0002182 Ga0453684_0002182_7770_8411 192
52 3300045051 Ga0451576_0000358 Ga0451576_0000358_51839_52480 192
53 3300053098 Ga0500650_0000047 Ga0500650_0000047_34404_35033 192
54 3300005295 Ga0065707_10014548 Ga0065707_100145482 193
55 3300006846 Ga0075430_100284490 Ga0075430_1002844902 193
56 3300006847 Ga0075431_100063008 Ga0075431_1000630083 193
57 3300031251 Ga0265327_10042661 Ga0265327_100426611 193
58 3300031251 Ga0265327_10118551 Ga0265327_101185512 193
59 3300031344 Ga0265316_10000062 Ga0265316_1000006252 193
60 3300031665 Ga0316575_10055495 Ga0316575_100554952 193
61 3300031727 Ga0316576_10046125 Ga0316576_100461254 193
62 3300031728 Ga0316578_10103542 Ga0316578_101035423 193
63 3300032137 Ga0316585_10072049 Ga0316585_100720492 193
64 3300036647 Ga0316582_0169352 Ga0316582_0169352_441_1070 193
65 3300036712 Ga0316584_0164000 Ga0316584_0164000_499_1128 193
66 3300041408 Ga0439453_0045710 Ga0439453_0045710_43_672 193
67 3300050509 nmdc:mga0qj67_306604_c1 nmdc:mga0qj67_306604_c1_285_914 193
68 3300005547 Ga0070693_100180395 Ga0070693_1001803952 194
69 3300005335 Ga0070666_10011720 Ga0070666_100117208 195
70 3300005367 Ga0070667_100110005 Ga0070667_1001100053 195
71 3300009101 Ga0105247_10025695 Ga0105247_100256952 195
72 3300025900 Ga0207710_10038772 Ga0207710_100387721 195
73 3300025903 Ga0207680_10005288 Ga0207680_100052884 195
74 3300025986 Ga0207658_10162406 Ga0207658_101624063 195
75 3300031251 Ga0265327_10047544 Ga0265327_100475442 195
76 3300031727 Ga0316576_10131890 Ga0316576_101318902 195
77 3300031727 Ga0316576_10174670 Ga0316576_101746703 195
78 3300045051 Ga0451576_0093478 Ga0451576_0093478_97_738 195
79 3300005331 Ga0070670_100354558 Ga0070670_1003545582 196
80 3300005334 Ga0068869_100052792 Ga0068869_1000527925 196
81 3300005341 Ga0070691_10071126 Ga0070691_100711262 196
82 3300005345 Ga0070692_10057919 Ga0070692_100579193 196
83 3300005354 Ga0070675_100217939 Ga0070675_1002179392 196
84 3300005356 Ga0070674_100128947 Ga0070674_1001289472 196
85 3300005438 Ga0070701_10045163 Ga0070701_100451633 196
86 3300005440 Ga0070705_100140459 Ga0070705_1001404592 196
87 3300005444 Ga0070694_100151382 Ga0070694_1001513822 196
88 3300005456 Ga0070678_100266833 Ga0070678_1002668331 196
89 3300005577 Ga0068857_100232106 Ga0068857_1002321062 196
90 3300005617 Ga0068859_100333503 Ga0068859_1003335032 196
91 3300005719 Ga0068861_100397861 Ga0068861_1003978612 196
92 3300005844 Ga0068862_100015990 Ga0068862_1000159907 196
93 3300006852 Ga0075433_10055666 Ga0075433_100556662 196
94 3300006880 Ga0075429_100015102 Ga0075429_1000151026 196
95 3300006931 Ga0097620_100333530 Ga0097620_1003335303 196
96 3300009094 Ga0111539_11005646 Ga0111539_110056461 196
97 3300009148 Ga0105243_10368378 Ga0105243_103683782 196
98 3300014326 Ga0157380_10006331 Ga0157380_100063316 196
99 3300025907 Ga0207645_10152450 Ga0207645_101524502 196
100 3300025926 Ga0207659_10137501 Ga0207659_101375012 196
101 3300025933 Ga0207706_10245544 Ga0207706_102455441 196
102 3300025935 Ga0207709_10095115 Ga0207709_100951152 196
103 3300025936 Ga0207670_10151617 Ga0207670_101516172 196
104 3300025937 Ga0207669_10186370 Ga0207669_101863702 196
105 3300025942 Ga0207689_10067957 Ga0207689_100679572 196
106 3300026089 Ga0207648_10164521 Ga0207648_101645212 196
107 3300026095 Ga0207676_10537117 Ga0207676_105371172 196
108 3300026118 Ga0207675_100020752 Ga0207675_1000207524 196
109 3300026118 Ga0207675_100507107 Ga0207675_1005071072 196
110 3300027360 Ga0209969_1016106 Ga0209969_10161062 196
111 3300027471 Ga0209995_1019749 Ga0209995_10197492 196
112 3300031727 Ga0316576_10220267 Ga0316576_102202672 196
113 3300035398 Ga0316574_0073681 Ga0316574_0073681_1139_1786 196
114 3300044712 Ga0453684_0337891 Ga0453684_0337891_803_1459 196
115 3300049523 Ga0501300_004881 Ga0501300_004881_221_871 196
116 3300049569 Ga0501032_0476214 Ga0501032_0476214_65_706 196
117 3300049573 Ga0501037_0357425 Ga0501037_0357425_249_890 196
118 3300049587 Ga0501071_0122537 Ga0501071_0122537_485_1126 196
119 3300049587 Ga0501071_0402370 Ga0501071_0402370_381_1022 196
120 3300049591 Ga0501075_0267711 Ga0501075_0267711_67_708 196
121 3300049592 Ga0501076_0263591 Ga0501076_0263591_23_664 196
122 3300049741 Ga0501079_0355950 Ga0501079_0355950_146_829 196
123 3300049776 Ga0501280_000743 Ga0501280_000743_1960_2610 196
124 3300050508 nmdc:mga09592_75248_c1 nmdc:mga09592_75248_c1_47_688 196
125 3300050515 nmdc:mga0a205_28175_c1 nmdc:mga0a205_28175_c1_4328_4969 196
126 3300053096 Ga0500641_0013748 Ga0500641_0013748_1520_2158 196
127 3300053139 Ga0500568_0104378 Ga0500568_0104378_129_770 196
128 iso_pu_bacteria 2738541276 2738716889 196
129 3300005331 Ga0070670_100076803 Ga0070670_1000768035 197
130 3300005844 Ga0068862_100010462 Ga0068862_1000104627 197
131 3300009177 Ga0105248_10602909 Ga0105248_106029092 197
132 3300025925 Ga0207650_10024261 Ga0207650_100242612 197
133 3300028380 Ga0268265_10018818 Ga0268265_100188183 197
134 3300032133 Ga0316583_10116566 Ga0316583_101165661 197
135 3300035398 Ga0316574_0155395 Ga0316574_0155395_713_1360 197
136 3300042876 Ga0451577_0004900 Ga0451577_0004900_6527_7174 197
137 3300042876 Ga0451577_0023405 Ga0451577_0023405_4798_5466 197
138 3300042876 Ga0451577_0079845 Ga0451577_0079845_1393_2055 197
139 3300044673 Ga0453683_0000009 Ga0453683_0000009_386669_387316 197
140 3300044712 Ga0453684_0001182 Ga0453684_0001182_49588_50235 197
141 3300044712 Ga0453684_0145811 Ga0453684_0145811_1223_1885 197
142 3300045051 Ga0451576_0134404 Ga0451576_0134404_1854_2555 197
143 3300049576 Ga0501040_0797799 Ga0501040_0797799_48_656 197
144 3300049591 Ga0501075_0284056 Ga0501075_0284056_307_915 197
145 3300049741 Ga0501079_0213247 Ga0501079_0213247_706_1314 197
146 3300049741 Ga0501079_0577736 Ga0501079_0577736_168_863 197
147 3300049824 Ga0501045_0276091 Ga0501045_0276091_488_1096 197
148 3300060353 Ga0501082_0364252 Ga0501082_0364252_90_698 197
149 3300061734 Ga0530510_0294392 Ga0530510_0294392_80_688 197
150 3300005548 Ga0070665_100266564 Ga0070665_1002665642 198
151 3300006847 Ga0075431_100245533 Ga0075431_1002455332 198
152 3300009176 Ga0105242_10031959 Ga0105242_100319592 198
153 3300028379 Ga0268266_10151407 Ga0268266_101514072 198
154 3300044712 Ga0453684_0000123 Ga0453684_0000123_86401_87081 198
155 3300050510 nmdc:mga06r32_474481_c1 nmdc:mga06r32_474481_c1_253_921 198
156 3300005367 Ga0070667_100438869 Ga0070667_1004388692 199
157 3300005436 Ga0070713_100005301 Ga0070713_1000053017 199
158 3300005439 Ga0070711_100074055 Ga0070711_1000740553 199
159 3300005616 Ga0068852_100423184 Ga0068852_1004231841 199
160 3300005618 Ga0068864_100260498 Ga0068864_1002604983 199
161 3300006846 Ga0075430_100023766 Ga0075430_1000237663 199
162 3300009098 Ga0105245_10297455 Ga0105245_102974552 199
163 3300009176 Ga0105242_11126271 Ga0105242_111262711 199
164 3300013297 Ga0157378_10341379 Ga0157378_103413792 199
165 3300025927 Ga0207687_10094668 Ga0207687_100946682 199
166 3300025986 Ga0207658_10438856 Ga0207658_104388562 199
167 3300026095 Ga0207676_10078084 Ga0207676_100780842 199
168 3300031665 Ga0316575_10000370 Ga0316575_100003709 199
169 3300031727 Ga0316576_10223480 Ga0316576_102234802 199
170 3300032133 Ga0316583_10005590 Ga0316583_100055902 199
171 3300036647 Ga0316582_0063204 Ga0316582_0063204_418_1065 199
172 3300036712 Ga0316584_0055160 Ga0316584_0055160_1907_2554 199
173 3300049571 Ga0501034_0020923 Ga0501034_0020923_2431_3051 199
174 3300049580 Ga0501046_0020632 Ga0501046_0020632_2281_2901 199
175 3300049581 Ga0501047_0043907 Ga0501047_0043907_1942_2562 199
176 3300049823 Ga0501044_0016744 Ga0501044_0016744_445_1065 199
177 3300050509 nmdc:mga0qj67_52506_c1 nmdc:mga0qj67_52506_c1_1211_1894 199
178 3300053096 Ga0500641_0064702 Ga0500641_0064702_120_725 199
179 3300005327 Ga0070658_10125009 Ga0070658_101250092 200
180 3300005331 Ga0070670_100147106 Ga0070670_1001471063 200
181 3300005331 Ga0070670_100344012 Ga0070670_1003440121 200
182 3300005334 Ga0068869_100021784 Ga0068869_1000217843 200
183 3300005340 Ga0070689_100060585 Ga0070689_1000605853 200
184 3300005347 Ga0070668_100095682 Ga0070668_1000956824 200
185 3300005354 Ga0070675_100740694 Ga0070675_1007406941 200
186 3300005355 Ga0070671_100312525 Ga0070671_1003125251 200
187 3300005364 Ga0070673_100601953 Ga0070673_1006019532 200
188 3300005441 Ga0070700_100060221 Ga0070700_1000602214 200
189 3300005459 Ga0068867_100022466 Ga0068867_1000224662 200
190 3300005543 Ga0070672_100011537 Ga0070672_1000115373 200
191 3300005543 Ga0070672_100406587 Ga0070672_1004065872 200
192 3300005544 Ga0070686_100068095 Ga0070686_1000680951 200
193 3300005615 Ga0070702_100213386 Ga0070702_1002133861 200
194 3300005616 Ga0068852_101020558 Ga0068852_1010205581 200
195 3300005618 Ga0068864_100000841 Ga0068864_1000008419 200
196 3300005618 Ga0068864_100017969 Ga0068864_1000179696 200
197 3300005618 Ga0068864_100125772 Ga0068864_1001257723 200
198 3300005618 Ga0068864_100169517 Ga0068864_1001695174 200
199 3300005618 Ga0068864_100430593 Ga0068864_1004305931 200
200 3300005841 Ga0068863_100054476 Ga0068863_1000544764 200
201 3300005842 Ga0068858_100013104 Ga0068858_1000131042 200
202 3300005843 Ga0068860_100053931 Ga0068860_1000539313 200
203 3300005843 Ga0068860_100158803 Ga0068860_1001588034 200
204 3300006358 Ga0068871_100454531 Ga0068871_1004545312 200
205 3300009553 Ga0105249_10017355 Ga0105249_100173558 200
206 3300013297 Ga0157378_10293257 Ga0157378_102932573 200
207 3300013306 Ga0163162_10089494 Ga0163162_100894945 200
208 3300013306 Ga0163162_10830910 Ga0163162_108309102 200
209 3300013308 Ga0157375_10027802 Ga0157375_100278026 200
210 3300013308 Ga0157375_10454780 Ga0157375_104547801 200
211 3300014325 Ga0163163_10648960 Ga0163163_106489602 200
212 3300014326 Ga0157380_10058558 Ga0157380_100585582 200
213 3300014326 Ga0157380_10928790 Ga0157380_109287902 200
214 3300014969 Ga0157376_10065872 Ga0157376_100658724 200
215 3300014969 Ga0157376_10089912 Ga0157376_100899123 200
216 3300017792 Ga0163161_10181009 Ga0163161_101810092 200
217 3300025315 Ga0207697_10024531 Ga0207697_100245312 200
218 3300025908 Ga0207643_10029368 Ga0207643_100293684 200
219 3300025925 Ga0207650_10184254 Ga0207650_101842542 200
220 3300025925 Ga0207650_10230826 Ga0207650_102308263 200
221 3300025926 Ga0207659_10003570 Ga0207659_1000357011 200
222 3300025926 Ga0207659_10050484 Ga0207659_100504844 200
223 3300025931 Ga0207644_10551618 Ga0207644_105516182 200
224 3300025933 Ga0207706_10008271 Ga0207706_100082713 200
225 3300025937 Ga0207669_10514682 Ga0207669_105146821 200
226 3300025940 Ga0207691_10012770 Ga0207691_100127706 200
227 3300025940 Ga0207691_10092944 Ga0207691_100929443 200
228 3300025940 Ga0207691_10169181 Ga0207691_101691814 200
229 3300025942 Ga0207689_10001809 Ga0207689_1000180917 200
230 3300025972 Ga0207668_10272492 Ga0207668_102724922 200
231 3300025972 Ga0207668_10536315 Ga0207668_105363151 200
232 3300025986 Ga0207658_10604162 Ga0207658_106041622 200
233 3300026035 Ga0207703_10073732 Ga0207703_100737322 200
234 3300026075 Ga0207708_10100858 Ga0207708_101008582 200
235 3300026088 Ga0207641_10150075 Ga0207641_101500752 200
236 3300026088 Ga0207641_10478688 Ga0207641_104786881 200
237 3300026095 Ga0207676_10067463 Ga0207676_100674632 200
238 3300026095 Ga0207676_10378849 Ga0207676_103788492 200
239 3300026121 Ga0207683_10050174 Ga0207683_100501744 200
240 3300028380 Ga0268265_10104190 Ga0268265_101041902 200
241 3300028381 Ga0268264_10087182 Ga0268264_100871824 200
242 3300031548 Ga0307408_100041067 Ga0307408_1000410675 200
243 3300031727 Ga0316576_10188912 Ga0316576_101889122 200
244 3300031731 Ga0307405_10183955 Ga0307405_101839553 200
245 3300031852 Ga0307410_10014000 Ga0307410_100140006 200
246 3300031903 Ga0307407_10008880 Ga0307407_100088806 200
247 3300031903 Ga0307407_10071496 Ga0307407_100714962 200
248 3300031995 Ga0307409_100019885 Ga0307409_1000198852 200
249 3300031995 Ga0307409_100021584 Ga0307409_1000215845 200
250 3300031995 Ga0307409_100075988 Ga0307409_1000759883 200
251 3300032002 Ga0307416_100003739 Ga0307416_1000037396 200
252 3300032004 Ga0307414_10596156 Ga0307414_105961562 200
253 3300032005 Ga0307411_10006672 Ga0307411_100066726 200
254 3300032005 Ga0307411_10155883 Ga0307411_101558832 200
255 3300035114 Ga0373939_0159674 Ga0373939_0159674_92_763 200
256 3300035119 Ga0373956_0281243 Ga0373956_0281243_88_759 200
257 3300035398 Ga0316574_0026363 Ga0316574_0026363_2782_3477 200
258 3300036401 Ga0373937_0117796 Ga0373937_0117796_1244_1915 200
259 3300048915 Ga0496112_0151984 Ga0496112_0151984_498_1172 200
260 3300049592 Ga0501076_0213482 Ga0501076_0213482_882_1529 200
261 3300005937 Ga0081455_10267975 Ga0081455_102679752 201
262 3300009551 Ga0105238_10000157 Ga0105238_1000015736 201
263 3300025924 Ga0207694_10002734 Ga0207694_100027345 201
264 3300031507 Ga0307509_10000009 Ga0307509_10000009294 201
265 3300047315 Ga0495581_0032108 Ga0495581_0032108_2067_2690 201
266 3300049568 Ga0501031_0550116 Ga0501031_0550116_11_646 201
267 3300031548 Ga0307408_100605117 Ga0307408_1006051172 202
268 3300031731 Ga0307405_10024144 Ga0307405_100241442 202
269 3300031911 Ga0307412_10332436 Ga0307412_103324362 202
270 3300032002 Ga0307416_100778045 Ga0307416_1007780452 202
271 3300036712 Ga0316584_0426066 Ga0316584_0426066_42_737 202
272 3300041512 Ga0451853_2189050 Ga0451853_2189050_456_1133 202
273 3300005844 Ga0068862_100546285 Ga0068862_1005462851 203
274 3300026089 Ga0207648_10175839 Ga0207648_101758392 203
275 3300047322 Ga0495680_0287734 Ga0495680_0287734_522_1133 203
276 3300048908 Ga0496105_0417717 Ga0496105_0417717_432_1049 203
277 3300049571 Ga0501034_0037633 Ga0501034_0037633_981_1616 203
278 3300049579 Ga0501043_0011233 Ga0501043_0011233_41_676 203
279 3300049580 Ga0501046_0025890 Ga0501046_0025890_2207_2842 203
280 3300049581 Ga0501047_0004771 Ga0501047_0004771_882_1517 203
281 3300049586 Ga0501070_0000290 Ga0501070_0000290_42753_43388 203
282 3300005330 Ga0070690_100196571 Ga0070690_1001965712 204
283 3300005441 Ga0070700_100245507 Ga0070700_1002455071 204
284 3300026095 Ga0207676_10450610 Ga0207676_104506102 204
285 3300042876 Ga0451577_0015034 Ga0451577_0015034_3915_4598 204
286 3300044712 Ga0453684_0002840 Ga0453684_0002840_13308_13991 204
287 3300044712 Ga0453684_0049832 Ga0453684_0049832_3557_4216 204
288 3300053085 Ga0495619_0394489 Ga0495619_0394489_108_728 204
289 3300005563 Ga0068855_100037286 Ga0068855_1000372864 205
290 3300025949 Ga0207667_10065604 Ga0207667_100656043 205
291 3300048088 Ga0495602_0230913 Ga0495602_0230913_42_665 205
292 3300049574 Ga0501038_0415839 Ga0501038_0415839_33_680 205
293 3300049576 Ga0501040_0269922 Ga0501040_0269922_440_1087 205
294 3300060353 Ga0501082_0833330 Ga0501082_0833330_130_777 205
295 3300031251 Ga0265327_10005077 Ga0265327_100050777 208
296 3300003316 rootH1_10182114 rootH1_101821142 210
297 3300003322 rootL2_10213749 rootL2_102137492 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

32

212

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vir-assembly1.cif.gz_A-2 crystal structure of probable nicotinate-nucleotide adenylyltransferase from mycobacterium abscessus in complex with nadp and compound fol0091 0.9618 2 198
4s1o-assembly1.cif.gz_A structure of mycobacterium tuberculosis nadd in complex with nadp 0.95 1 199
4ymi-assembly1.cif.gz_A crystal structure of probable nicotinate-nucleotide adenylyltransferase from mycobacterium abcessus in complex with nadp 0.9467 2 200
5das-assembly3.cif.gz_C structure of mycobacterium tuberculosis nadd in complex with nadp, p21212, form 2 0.9459 2 199
4s1o-assembly1.cif.gz_A structure of mycobacterium tuberculosis nadd in complex with nadp 0.9448 1 199
ID Description Score Start End Superfamily
5virA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9618 2 198 3.40.50.620
5virA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.941 2 198 3.40.50.620
2h2aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9168 2 200 3.40.50.620
2h2aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9029 2 200 3.40.50.620
af_A0A0R0EKS6_1_167_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8875 49 200 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7V0MAP3-F1-model_v4 nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) 0.9757 1 136 GO:0009435
GO:0070566
AF-A0A3D4P8F4-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9738 1 200 GO:0004515
GO:0005524
GO:0009435
AF-A0A7C3I961-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9727 1 198 GO:0004515
GO:0005524
GO:0009435
AF-A0A3G6JAY5-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9713 2 200 GO:0004515
GO:0005524
GO:0009435
AF-A0A3M2AZ14-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9712 1 200 GO:0004515
GO:0005524
GO:0009435

Feature Viewer

pLDDT pTM Quality
88.61 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map