F393764
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 297 | 181 | 294 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10047544|Ga0265327_100475442 |
| Length | 244 |
| Sequence | MMRFVPQRILTYATFPPHARRDVNSKKSMLGIYGGTFDPIHYGHLRTALEVKEALRLDELRLLPCRLPPHRGSPGATPGQRVAMLELALQNAEPGFAVDRRELEREGPSYMVDTLASLRGEFPGRPLCLIVGWDAFCGLPAWHRWRELFELAHLAVMRRPDATEPEWLDGLAEMVAERRTDELGDLRLTPAGRVVFLEVTQLAISATVIRHLVGEGKSPRYLLPEAVARMIRAEGLYRRDGGEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 2 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 3 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 108 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 111 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 112 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 113 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 114 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 115 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 116 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 118 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 119 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 120 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 124 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 125 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 126 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 127 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 128 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 129 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 131 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 133 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 136 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 137 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 138 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 139 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 140 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 141 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 144 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 145 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 146 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 153 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 154 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 155 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 170 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 178 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 179 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 180 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.99 |
| Metatranscriptomes | 0 |
| Isolates | 1.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.35 |
| Nodule | 0 |
| Rhizoplane | 1.68 |
| Rhizosphere | 91.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10182114 | 3300003316 | Unclassified | 1865 |
| 2 | rootL2_10213749 | 3300003322 | Unclassified | 1908 |
| 3 | Ga0065707_10014548 | 3300005295 | Bacteria | 1953 |
| 4 | Ga0070658_10125009 | 3300005327 | Bacteria | 2140 |
| 5 | Ga0070690_100196571 | 3300005330 | Bacteria | 1401 |
| 6 | Ga0070670_100076803 | 3300005331 | Bacteria | 2870 |
| 7 | Ga0070670_100147106 | 3300005331 | Bacteria | 2038 |
| 8 | Ga0070670_100344012 | 3300005331 | Bacteria | 1309 |
| 9 | Ga0070670_100354558 | 3300005331 | Bacteria | 1289 |
| 10 | Ga0068869_100021784 | 3300005334 | Bacteria | 4411 |
| 11 | Ga0068869_100052792 | 3300005334 | Bacteria | 2952 |
| 12 | Ga0070666_10011720 | 3300005335 | Bacteria | 5512 |
| 13 | Ga0070689_100060585 | 3300005340 | Bacteria | 2943 |
| 14 | Ga0070691_10071126 | 3300005341 | Bacteria | 1688 |
| 15 | Ga0070692_10057919 | 3300005345 | Bacteria | 2033 |
| 16 | Ga0070668_100095682 | 3300005347 | Bacteria | 2346 |
| 17 | Ga0070675_100217939 | 3300005354 | Bacteria | 1661 |
| 18 | Ga0070675_100740694 | 3300005354 | Unclassified | 896 |
| 19 | Ga0070671_100312525 | 3300005355 | Bacteria | 1338 |
| 20 | Ga0070674_100128947 | 3300005356 | Bacteria | 1883 |
| 21 | Ga0070673_100601953 | 3300005364 | Bacteria | 1003 |
| 22 | Ga0070667_100003920 | 3300005367 | Bacteria | 12640 |
| 23 | Ga0070667_100110005 | 3300005367 | Unclassified | 2388 |
| 24 | Ga0070667_100438869 | 3300005367 | Bacteria | 1192 |
| 25 | Ga0070713_100005301 | 3300005436 | Bacteria | 8795 |
| 26 | Ga0070710_10161752 | 3300005437 | Bacteria | 1389 |
| 27 | Ga0070701_10045163 | 3300005438 | Bacteria | 2260 |
| 28 | Ga0070711_100074055 | 3300005439 | Bacteria | 2408 |
| 29 | Ga0070705_100140459 | 3300005440 | Bacteria | 1589 |
| 30 | Ga0070700_100060221 | 3300005441 | Bacteria | 2392 |
| 31 | Ga0070700_100245507 | 3300005441 | Unclassified | 1281 |
| 32 | Ga0070694_100151382 | 3300005444 | Bacteria | 1695 |
| 33 | Ga0070708_100019388 | 3300005445 | Bacteria | 5715 |
| 34 | Ga0070708_100191923 | 3300005445 | Bacteria | 1910 |
| 35 | Ga0070678_100266833 | 3300005456 | Bacteria | 1442 |
| 36 | Ga0068867_100022466 | 3300005459 | Bacteria | 4511 |
| 37 | Ga0070672_100011537 | 3300005543 | Bacteria | 6164 |
| 38 | Ga0070672_100406587 | 3300005543 | Bacteria | 1167 |
| 39 | Ga0070686_100068095 | 3300005544 | Bacteria | 2321 |
| 40 | Ga0070693_100180395 | 3300005547 | Bacteria | 1359 |
| 41 | Ga0070665_100098844 | 3300005548 | Bacteria | 2923 |
| 42 | Ga0070665_100266564 | 3300005548 | Bacteria | 1714 |
| 43 | Ga0068855_100037286 | 3300005563 | Bacteria | 5783 |
| 44 | Ga0068857_100232106 | 3300005577 | Bacteria | 1688 |
| 45 | Ga0070702_100213386 | 3300005615 | Bacteria | 1286 |
| 46 | Ga0068852_100423184 | 3300005616 | Unclassified | 1314 |
| 47 | Ga0068852_101020558 | 3300005616 | Bacteria | 846 |
| 48 | Ga0068859_100333503 | 3300005617 | Bacteria | 1611 |
| 49 | Ga0068864_100000841 | 3300005618 | Bacteria | 25890 |
| 50 | Ga0068864_100017969 | 3300005618 | Bacteria | 5900 |
| 51 | Ga0068864_100125772 | 3300005618 | Bacteria | 2297 |
| 52 | Ga0068864_100169517 | 3300005618 | Unclassified | 1990 |
| 53 | Ga0068864_100260498 | 3300005618 | Bacteria | 1613 |
| 54 | Ga0068864_100430593 | 3300005618 | Bacteria | 1258 |
| 55 | Ga0068861_100397861 | 3300005719 | Bacteria | 1221 |
| 56 | Ga0068863_100054476 | 3300005841 | Bacteria | 3789 |
| 57 | Ga0068863_100234970 | 3300005841 | Bacteria | 1769 |
| 58 | Ga0068858_100013104 | 3300005842 | Bacteria | 7818 |
| 59 | Ga0068860_100053931 | 3300005843 | Bacteria | 3822 |
| 60 | Ga0068860_100158803 | 3300005843 | Bacteria | 2179 |
| 61 | Ga0068862_100010462 | 3300005844 | Bacteria | 7661 |
| 62 | Ga0068862_100015990 | 3300005844 | Bacteria | 6238 |
| 63 | Ga0068862_100546285 | 3300005844 | Bacteria | 1106 |
| 64 | Ga0081455_10267975 | 3300005937 | Unclassified | 1240 |
| 65 | Ga0070716_100080773 | 3300006173 | Bacteria | 1939 |
| 66 | Ga0097621_100082531 | 3300006237 | Bacteria | 2677 |
| 67 | Ga0068871_100454531 | 3300006358 | Bacteria | 1148 |
| 68 | Ga0075430_100023766 | 3300006846 | Bacteria | 5219 |
| 69 | Ga0075430_100284490 | 3300006846 | Bacteria | 1368 |
| 70 | Ga0075431_100063008 | 3300006847 | Bacteria | 3826 |
| 71 | Ga0075431_100245533 | 3300006847 | Bacteria | 1820 |
| 72 | Ga0075433_10013806 | 3300006852 | Bacteria | 6583 |
| 73 | Ga0075433_10055666 | 3300006852 | Bacteria | 3453 |
| 74 | Ga0075429_100015102 | 3300006880 | Bacteria | 6693 |
| 75 | Ga0097620_100333530 | 3300006931 | Bacteria | 1611 |
| 76 | Ga0111539_11005646 | 3300009094 | Bacteria | 969 |
| 77 | Ga0105245_10297455 | 3300009098 | Bacteria | 1583 |
| 78 | Ga0105247_10025695 | 3300009101 | Bacteria | 3554 |
| 79 | Ga0105243_10368378 | 3300009148 | Bacteria | 1325 |
| 80 | Ga0105242_10031959 | 3300009176 | Bacteria | 4208 |
| 81 | Ga0105242_11126271 | 3300009176 | Unclassified | 800 |
| 82 | Ga0105248_10602909 | 3300009177 | Bacteria | 1239 |
| 83 | Ga0105238_10000157 | 3300009551 | Bacteria | 74320 |
| 84 | Ga0105249_10017355 | 3300009553 | Bacteria | 6391 |
| 85 | Ga0157378_10293257 | 3300013297 | Bacteria | 1572 |
| 86 | Ga0157378_10341379 | 3300013297 | Bacteria | 1461 |
| 87 | Ga0163162_10089494 | 3300013306 | Bacteria | 3159 |
| 88 | Ga0163162_10464168 | 3300013306 | Unclassified | 1398 |
| 89 | Ga0163162_10830910 | 3300013306 | Bacteria | 1040 |
| 90 | Ga0157372_10516568 | 3300013307 | Bacteria | 1392 |
| 91 | Ga0157375_10027802 | 3300013308 | Bacteria | 5292 |
| 92 | Ga0157375_10454780 | 3300013308 | Bacteria | 1446 |
| 93 | Ga0163163_10648960 | 3300014325 | Bacteria | 1119 |
| 94 | Ga0157380_10006331 | 3300014326 | Bacteria | 8320 |
| 95 | Ga0157380_10058558 | 3300014326 | Bacteria | 3071 |
| 96 | Ga0157380_10928790 | 3300014326 | Bacteria | 898 |
| 97 | Ga0157376_10020169 | 3300014969 | Bacteria | 5151 |
| 98 | Ga0157376_10065872 | 3300014969 | Bacteria | 3061 |
| 99 | Ga0157376_10089912 | 3300014969 | Bacteria | 2656 |
| 100 | Ga0163161_10181009 | 3300017792 | Bacteria | 1616 |
| 101 | Ga0207697_10024531 | 3300025315 | Bacteria | 2468 |
| 102 | Ga0207710_10038772 | 3300025900 | Bacteria | 2107 |
| 103 | Ga0207680_10005288 | 3300025903 | Bacteria | 6163 |
| 104 | Ga0207699_10208786 | 3300025906 | Unclassified | 1327 |
| 105 | Ga0207645_10152450 | 3300025907 | Bacteria | 1509 |
| 106 | Ga0207643_10029368 | 3300025908 | Bacteria | 3057 |
| 107 | Ga0207693_10202758 | 3300025915 | Bacteria | 1560 |
| 108 | Ga0207694_10002734 | 3300025924 | Bacteria | 14268 |
| 109 | Ga0207650_10024261 | 3300025925 | Bacteria | 4310 |
| 110 | Ga0207650_10184254 | 3300025925 | Bacteria | 1665 |
| 111 | Ga0207650_10230826 | 3300025925 | Bacteria | 1492 |
| 112 | Ga0207659_10003570 | 3300025926 | Bacteria | 9367 |
| 113 | Ga0207659_10050484 | 3300025926 | Bacteria | 2955 |
| 114 | Ga0207659_10137501 | 3300025926 | Bacteria | 1893 |
| 115 | Ga0207687_10094668 | 3300025927 | Bacteria | 2186 |
| 116 | Ga0207644_10551618 | 3300025931 | Bacteria | 954 |
| 117 | Ga0207706_10008271 | 3300025933 | Bacteria | 9600 |
| 118 | Ga0207706_10245544 | 3300025933 | Bacteria | 1564 |
| 119 | Ga0207709_10095115 | 3300025935 | Bacteria | 1957 |
| 120 | Ga0207670_10151617 | 3300025936 | Bacteria | 1721 |
| 121 | Ga0207669_10186370 | 3300025937 | Bacteria | 1493 |
| 122 | Ga0207669_10514682 | 3300025937 | Bacteria | 960 |
| 123 | Ga0207665_10034647 | 3300025939 | Bacteria | 3349 |
| 124 | Ga0207691_10012770 | 3300025940 | Bacteria | 8040 |
| 125 | Ga0207691_10092944 | 3300025940 | Bacteria | 2701 |
| 126 | Ga0207691_10169181 | 3300025940 | Bacteria | 1914 |
| 127 | Ga0207711_10047502 | 3300025941 | Bacteria | 3670 |
| 128 | Ga0207689_10001809 | 3300025942 | Bacteria | 20177 |
| 129 | Ga0207689_10067957 | 3300025942 | Bacteria | 2928 |
| 130 | Ga0207667_10065604 | 3300025949 | Bacteria | 3786 |
| 131 | Ga0207668_10272492 | 3300025972 | Bacteria | 1384 |
| 132 | Ga0207668_10536315 | 3300025972 | Bacteria | 1012 |
| 133 | Ga0207658_10162406 | 3300025986 | Unclassified | 1832 |
| 134 | Ga0207658_10438856 | 3300025986 | Bacteria | 1154 |
| 135 | Ga0207658_10604162 | 3300025986 | Bacteria | 986 |
| 136 | Ga0207658_10719033 | 3300025986 | Unclassified | 903 |
| 137 | Ga0207703_10073732 | 3300026035 | Bacteria | 2824 |
| 138 | Ga0207708_10100858 | 3300026075 | Bacteria | 2234 |
| 139 | Ga0207702_10027749 | 3300026078 | Bacteria | 4704 |
| 140 | Ga0207641_10141292 | 3300026088 | Unclassified | 2172 |
| 141 | Ga0207641_10150075 | 3300026088 | Bacteria | 2110 |
| 142 | Ga0207641_10478688 | 3300026088 | Bacteria | 1206 |
| 143 | Ga0207648_10164521 | 3300026089 | Bacteria | 1960 |
| 144 | Ga0207648_10175839 | 3300026089 | Bacteria | 1893 |
| 145 | Ga0207676_10067463 | 3300026095 | Bacteria | 2857 |
| 146 | Ga0207676_10078084 | 3300026095 | Bacteria | 2680 |
| 147 | Ga0207676_10378849 | 3300026095 | Bacteria | 1316 |
| 148 | Ga0207676_10450610 | 3300026095 | Unclassified | 1213 |
| 149 | Ga0207676_10537117 | 3300026095 | Bacteria | 1115 |
| 150 | Ga0207675_100020752 | 3300026118 | Bacteria | 6125 |
| 151 | Ga0207675_100181343 | 3300026118 | Bacteria | 2016 |
| 152 | Ga0207675_100507107 | 3300026118 | Unclassified | 1201 |
| 153 | Ga0207683_10050174 | 3300026121 | Bacteria | 3654 |
| 154 | Ga0209969_1016106 | 3300027360 | Bacteria | 1095 |
| 155 | Ga0209995_1019749 | 3300027471 | Bacteria | 1113 |
| 156 | Ga0268266_10151407 | 3300028379 | Bacteria | 2091 |
| 157 | Ga0268265_10018818 | 3300028380 | Bacteria | 4791 |
| 158 | Ga0268265_10104190 | 3300028380 | Bacteria | 2299 |
| 159 | Ga0268264_10087182 | 3300028381 | Bacteria | 2683 |
| 160 | Ga0307515_10175436 | 3300028794 | Bacteria | 2116 |
| 161 | Ga0307515_10312150 | 3300028794 | Bacteria | 1246 |
| 162 | Ga0265327_10005077 | 3300031251 | Bacteria | 11224 |
| 163 | Ga0265327_10042661 | 3300031251 | Bacteria | 2433 |
| 164 | Ga0265327_10047544 | 3300031251 | Unclassified | 2262 |
| 165 | Ga0265327_10118551 | 3300031251 | Bacteria | 1257 |
| 166 | Ga0265316_10000062 | 3300031344 | Bacteria | 113912 |
| 167 | Ga0265316_10501666 | 3300031344 | Bacteria | 867 |
| 168 | Ga0307509_10000009 | 3300031507 | Bacteria | 350890 |
| 169 | Ga0307509_10159708 | 3300031507 | Bacteria | 2154 |
| 170 | Ga0307408_100041067 | 3300031548 | Bacteria | 3278 |
| 171 | Ga0307408_100605117 | 3300031548 | Bacteria | 974 |
| 172 | Ga0307508_10097079 | 3300031616 | Bacteria | 2538 |
| 173 | Ga0316575_10000370 | 3300031665 | Bacteria | 12802 |
| 174 | Ga0316575_10055495 | 3300031665 | Bacteria | 1578 |
| 175 | Ga0316576_10046125 | 3300031727 | Bacteria | 3153 |
| 176 | Ga0316576_10131890 | 3300031727 | Unclassified | 1880 |
| 177 | Ga0316576_10174670 | 3300031727 | Bacteria | 1621 |
| 178 | Ga0316576_10188912 | 3300031727 | Bacteria | 1553 |
| 179 | Ga0316576_10220267 | 3300031727 | Bacteria | 1428 |
| 180 | Ga0316576_10223480 | 3300031727 | Bacteria | 1416 |
| 181 | Ga0316578_10103542 | 3300031728 | Bacteria | 1707 |
| 182 | Ga0316578_10249905 | 3300031728 | Bacteria | 1064 |
| 183 | Ga0307405_10024144 | 3300031731 | Bacteria | 3468 |
| 184 | Ga0307405_10162843 | 3300031731 | Bacteria | 1582 |
| 185 | Ga0307405_10183955 | 3300031731 | Bacteria | 1503 |
| 186 | Ga0307410_10014000 | 3300031852 | Bacteria | 4702 |
| 187 | Ga0307406_10784776 | 3300031901 | Bacteria | 803 |
| 188 | Ga0307407_10008880 | 3300031903 | Bacteria | 4645 |
| 189 | Ga0307407_10071496 | 3300031903 | Bacteria | 2066 |
| 190 | Ga0307412_10332436 | 3300031911 | Bacteria | 1213 |
| 191 | Ga0307409_100019885 | 3300031995 | Bacteria | 4560 |
| 192 | Ga0307409_100021584 | 3300031995 | Bacteria | 4418 |
| 193 | Ga0307409_100075988 | 3300031995 | Bacteria | 2692 |
| 194 | Ga0307409_100396973 | 3300031995 | Bacteria | 1316 |
| 195 | Ga0307416_100003739 | 3300032002 | Bacteria | 9032 |
| 196 | Ga0307416_100778045 | 3300032002 | Bacteria | 1051 |
| 197 | Ga0307414_10596156 | 3300032004 | Bacteria | 990 |
| 198 | Ga0307411_10006672 | 3300032005 | Bacteria | 5798 |
| 199 | Ga0307411_10155883 | 3300032005 | Bacteria | 1703 |
| 200 | Ga0316583_10005590 | 3300032133 | Bacteria | 4514 |
| 201 | Ga0316583_10116566 | 3300032133 | Bacteria | 931 |
| 202 | Ga0316585_10072049 | 3300032137 | Bacteria | 1122 |
| 203 | Ga0373944_0024701 | 3300035089 | Bacteria | 1764 |
| 204 | Ga0373939_0159674 | 3300035114 | Bacteria | 827 |
| 205 | Ga0373956_0281243 | 3300035119 | Bacteria | 792 |
| 206 | Ga0373943_0041107 | 3300035170 | Unclassified | 2235 |
| 207 | Ga0373942_0342167 | 3300035207 | Unclassified | 527 |
| 208 | Ga0316574_0026363 | 3300035398 | Bacteria | 3494 |
| 209 | Ga0316574_0040830 | 3300035398 | Bacteria | 2857 |
| 210 | Ga0316574_0073681 | 3300035398 | Bacteria | 2160 |
| 211 | Ga0316574_0155395 | 3300035398 | Bacteria | 1474 |
| 212 | Ga0373935_0083020 | 3300035692 | Bacteria | 2085 |
| 213 | Ga0373937_0117796 | 3300036401 | Bacteria | 2474 |
| 214 | Ga0316582_0063204 | 3300036647 | Bacteria | 2378 |
| 215 | Ga0316582_0169352 | 3300036647 | Bacteria | 1482 |
| 216 | Ga0316584_0055160 | 3300036712 | Bacteria | 2976 |
| 217 | Ga0316584_0164000 | 3300036712 | Bacteria | 1650 |
| 218 | Ga0316584_0426066 | 3300036712 | Bacteria | 942 |
| 219 | Ga0400490_16260 | 3300038726 | Bacteria | 13490 |
| 220 | Ga0400490_51411 | 3300038726 | Bacteria | 1748 |
| 221 | Ga0400486_32189 | 3300038742 | Bacteria | 1658 |
| 222 | Ga0400483_276404 | 3300039062 | Bacteria | 1427 |
| 223 | Ga0439453_0045710 | 3300041408 | Unclassified | 872 |
| 224 | Ga0451795_0939415 | 3300041456 | Bacteria | 1713 |
| 225 | Ga0451800_0731181 | 3300041459 | Bacteria | 2257 |
| 226 | Ga0451853_2189050 | 3300041512 | Bacteria | 1156 |
| 227 | Ga0451577_0000105 | 3300042876 | Bacteria | 184360 |
| 228 | Ga0451577_0004900 | 3300042876 | Bacteria | 13952 |
| 229 | Ga0451577_0015034 | 3300042876 | Bacteria | 7201 |
| 230 | Ga0451577_0023405 | 3300042876 | Bacteria | 5634 |
| 231 | Ga0451577_0028012 | 3300042876 | Bacteria | 5097 |
| 232 | Ga0451577_0044598 | 3300042876 | Bacteria | 3970 |
| 233 | Ga0451577_0079845 | 3300042876 | Bacteria | 2916 |
| 234 | Ga0453683_0000009 | 3300044673 | Bacteria | 491115 |
| 235 | Ga0453684_0000123 | 3300044712 | Bacteria | 339304 |
| 236 | Ga0453684_0001182 | 3300044712 | Bacteria | 80877 |
| 237 | Ga0453684_0002182 | 3300044712 | Bacteria | 48823 |
| 238 | Ga0453684_0002840 | 3300044712 | Bacteria | 40778 |
| 239 | Ga0453684_0013318 | 3300044712 | Bacteria | 13383 |
| 240 | Ga0453684_0049832 | 3300044712 | Bacteria | 5515 |
| 241 | Ga0453684_0145811 | 3300044712 | Bacteria | 2820 |
| 242 | Ga0453684_0337891 | 3300044712 | Bacteria | 1701 |
| 243 | Ga0451576_0000358 | 3300045051 | Bacteria | 109586 |
| 244 | Ga0451576_0021898 | 3300045051 | Bacteria | 6939 |
| 245 | Ga0451576_0093478 | 3300045051 | Bacteria | 3127 |
| 246 | Ga0451576_0134404 | 3300045051 | Bacteria | 2579 |
| 247 | Ga0495580_0001225 | 3300046472 | Bacteria | 22641 |
| 248 | Ga0495581_0032108 | 3300047315 | Bacteria | 3041 |
| 249 | Ga0495680_0287734 | 3300047322 | Bacteria | 1157 |
| 250 | Ga0495602_0230913 | 3300048088 | Bacteria | 1390 |
| 251 | Ga0496105_0417717 | 3300048908 | Unclassified | 1062 |
| 252 | Ga0496112_0151984 | 3300048915 | Bacteria | 2282 |
| 253 | Ga0496112_0241339 | 3300048915 | Bacteria | 1759 |
| 254 | Ga0501300_004881 | 3300049523 | Bacteria | 1983 |
| 255 | Ga0501031_0550116 | 3300049568 | Bacteria | 743 |
| 256 | Ga0501032_0476214 | 3300049569 | Bacteria | 799 |
| 257 | Ga0501034_0020923 | 3300049571 | Bacteria | 6679 |
| 258 | Ga0501034_0037633 | 3300049571 | Bacteria | 4900 |
| 259 | Ga0501037_0357425 | 3300049573 | Bacteria | 1007 |
| 260 | Ga0501038_0415839 | 3300049574 | Bacteria | 1038 |
| 261 | Ga0501040_0269922 | 3300049576 | Bacteria | 1215 |
| 262 | Ga0501040_0797799 | 3300049576 | Bacteria | 683 |
| 263 | Ga0501043_0011233 | 3300049579 | Bacteria | 7015 |
| 264 | Ga0501046_0020632 | 3300049580 | Bacteria | 5447 |
| 265 | Ga0501046_0025890 | 3300049580 | Bacteria | 4795 |
| 266 | Ga0501047_0004771 | 3300049581 | Bacteria | 12752 |
| 267 | Ga0501047_0043907 | 3300049581 | Bacteria | 4317 |
| 268 | Ga0501047_0689190 | 3300049581 | Bacteria | 839 |
| 269 | Ga0501070_0000290 | 3300049586 | Bacteria | 47027 |
| 270 | Ga0501071_0122537 | 3300049587 | Bacteria | 1928 |
| 271 | Ga0501071_0402370 | 3300049587 | Bacteria | 1045 |
| 272 | Ga0501075_0267711 | 3300049591 | Bacteria | 1302 |
| 273 | Ga0501075_0284056 | 3300049591 | Bacteria | 1261 |
| 274 | Ga0501076_0213482 | 3300049592 | Bacteria | 1577 |
| 275 | Ga0501076_0263591 | 3300049592 | Bacteria | 1411 |
| 276 | Ga0501079_0213247 | 3300049741 | Bacteria | 1508 |
| 277 | Ga0501079_0355950 | 3300049741 | Bacteria | 1147 |
| 278 | Ga0501079_0577736 | 3300049741 | Bacteria | 884 |
| 279 | Ga0501280_000743 | 3300049776 | Bacteria | 7155 |
| 280 | Ga0501044_0016744 | 3300049823 | Bacteria | 7869 |
| 281 | Ga0501045_0276091 | 3300049824 | Bacteria | 1251 |
| 282 | nmdc:mga09592_75248_c1 | 3300050508 | Bacteria | 2357 |
| 283 | nmdc:mga0qj67_306604_c1 | 3300050509 | Unclassified | 1286 |
| 284 | nmdc:mga0qj67_52506_c1 | 3300050509 | Bacteria | 3226 |
| 285 | nmdc:mga06r32_474481_c1 | 3300050510 | Bacteria | 1229 |
| 286 | nmdc:mga0a205_28175_c1 | 3300050515 | Bacteria | 5369 |
| 287 | Ga0495619_0394489 | 3300053085 | Unclassified | 956 |
| 288 | Ga0500641_0013748 | 3300053096 | Bacteria | 2977 |
| 289 | Ga0500641_0064702 | 3300053096 | Unclassified | 1528 |
| 290 | Ga0500650_0000047 | 3300053098 | Bacteria | 40133 |
| 291 | Ga0500568_0104378 | 3300053139 | Bacteria | 1062 |
| 292 | Ga0501082_0364252 | 3300060353 | Bacteria | 1261 |
| 293 | Ga0501082_0833330 | 3300060353 | Unclassified | 807 |
| 294 | Ga0530510_0294392 | 3300061734 | Bacteria | 1214 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035207 | Ga0373942_0342167 | Ga0373942_0342167_10_513 | 157 |
| 2 | 3300039062 | Ga0400483_276404 | Ga0400483_276404_22_567 | 168 |
| 3 | 3300026118 | Ga0207675_100181343 | Ga0207675_1001813432 | 171 |
| 4 | 3300028794 | Ga0307515_10312150 | Ga0307515_103121502 | 174 |
| 5 | 3300041456 | Ga0451795_0939415 | Ga0451795_0939415_350_970 | 180 |
| 6 | 3300006237 | Ga0097621_100082531 | Ga0097621_1000825312 | 181 |
| 7 | 3300014969 | Ga0157376_10020169 | Ga0157376_100201695 | 181 |
| 8 | 3300026088 | Ga0207641_10141292 | Ga0207641_101412923 | 181 |
| 9 | 3300031728 | Ga0316578_10249905 | Ga0316578_102499052 | 183 |
| 10 | 3300005437 | Ga0070710_10161752 | Ga0070710_101617521 | 184 |
| 11 | 3300005445 | Ga0070708_100019388 | Ga0070708_1000193886 | 184 |
| 12 | 3300005445 | Ga0070708_100191923 | Ga0070708_1001919232 | 184 |
| 13 | 3300006173 | Ga0070716_100080773 | Ga0070716_1000807732 | 184 |
| 14 | 3300013307 | Ga0157372_10516568 | Ga0157372_105165682 | 184 |
| 15 | 3300025906 | Ga0207699_10208786 | Ga0207699_102087862 | 184 |
| 16 | 3300025915 | Ga0207693_10202758 | Ga0207693_102027583 | 184 |
| 17 | 3300025939 | Ga0207665_10034647 | Ga0207665_100346474 | 184 |
| 18 | 3300026078 | Ga0207702_10027749 | Ga0207702_100277494 | 184 |
| 19 | 3300035089 | Ga0373944_0024701 | Ga0373944_0024701_825_1430 | 184 |
| 20 | 3300035170 | Ga0373943_0041107 | Ga0373943_0041107_1106_1711 | 184 |
| 21 | 3300035398 | Ga0316574_0040830 | Ga0316574_0040830_2144_2752 | 184 |
| 22 | 3300035692 | Ga0373935_0083020 | Ga0373935_0083020_540_1145 | 184 |
| 23 | 3300048915 | Ga0496112_0241339 | Ga0496112_0241339_331_915 | 184 |
| 24 | iso_pu_bacteria | 2643221654 | 2644302381 | 184 |
| 25 | 3300005367 | Ga0070667_100003920 | Ga0070667_1000039209 | 185 |
| 26 | 3300005548 | Ga0070665_100098844 | Ga0070665_1000988442 | 185 |
| 27 | 3300005841 | Ga0068863_100234970 | Ga0068863_1002349703 | 185 |
| 28 | 3300013306 | Ga0163162_10464168 | Ga0163162_104641681 | 185 |
| 29 | 3300025941 | Ga0207711_10047502 | Ga0207711_100475022 | 185 |
| 30 | 3300025986 | Ga0207658_10719033 | Ga0207658_107190331 | 185 |
| 31 | 3300028794 | Ga0307515_10175436 | Ga0307515_101754362 | 185 |
| 32 | 3300031507 | Ga0307509_10159708 | Ga0307509_101597081 | 185 |
| 33 | 3300031616 | Ga0307508_10097079 | Ga0307508_100970792 | 185 |
| 34 | 3300031731 | Ga0307405_10162843 | Ga0307405_101628432 | 185 |
| 35 | 3300041459 | Ga0451800_0731181 | Ga0451800_0731181_1349_2023 | 186 |
| 36 | 3300042876 | Ga0451577_0028012 | Ga0451577_0028012_4403_5074 | 186 |
| 37 | 3300044712 | Ga0453684_0013318 | Ga0453684_0013318_4531_5202 | 186 |
| 38 | 3300045051 | Ga0451576_0021898 | Ga0451576_0021898_1111_1782 | 186 |
| 39 | iso_pu_bacteria | 2894510363 | 2894510982 | 188 |
| 40 | 3300049581 | Ga0501047_0689190 | Ga0501047_0689190_205_819 | 189 |
| 41 | 3300031995 | Ga0307409_100396973 | Ga0307409_1003969732 | 190 |
| 42 | 3300038726 | Ga0400490_51411 | Ga0400490_51411_720_1331 | 190 |
| 43 | 3300006852 | Ga0075433_10013806 | Ga0075433_100138068 | 191 |
| 44 | 3300031901 | Ga0307406_10784776 | Ga0307406_107847761 | 191 |
| 45 | 3300038726 | Ga0400490_16260 | Ga0400490_16260_1422_2042 | 191 |
| 46 | 3300038742 | Ga0400486_32189 | Ga0400486_32189_561_1175 | 191 |
| 47 | 3300046472 | Ga0495580_0001225 | Ga0495580_0001225_353_958 | 191 |
| 48 | 3300031344 | Ga0265316_10501666 | Ga0265316_105016662 | 192 |
| 49 | 3300042876 | Ga0451577_0000105 | Ga0451577_0000105_177179_177820 | 192 |
| 50 | 3300042876 | Ga0451577_0044598 | Ga0451577_0044598_1779_2402 | 192 |
| 51 | 3300044712 | Ga0453684_0002182 | Ga0453684_0002182_7770_8411 | 192 |
| 52 | 3300045051 | Ga0451576_0000358 | Ga0451576_0000358_51839_52480 | 192 |
| 53 | 3300053098 | Ga0500650_0000047 | Ga0500650_0000047_34404_35033 | 192 |
| 54 | 3300005295 | Ga0065707_10014548 | Ga0065707_100145482 | 193 |
| 55 | 3300006846 | Ga0075430_100284490 | Ga0075430_1002844902 | 193 |
| 56 | 3300006847 | Ga0075431_100063008 | Ga0075431_1000630083 | 193 |
| 57 | 3300031251 | Ga0265327_10042661 | Ga0265327_100426611 | 193 |
| 58 | 3300031251 | Ga0265327_10118551 | Ga0265327_101185512 | 193 |
| 59 | 3300031344 | Ga0265316_10000062 | Ga0265316_1000006252 | 193 |
| 60 | 3300031665 | Ga0316575_10055495 | Ga0316575_100554952 | 193 |
| 61 | 3300031727 | Ga0316576_10046125 | Ga0316576_100461254 | 193 |
| 62 | 3300031728 | Ga0316578_10103542 | Ga0316578_101035423 | 193 |
| 63 | 3300032137 | Ga0316585_10072049 | Ga0316585_100720492 | 193 |
| 64 | 3300036647 | Ga0316582_0169352 | Ga0316582_0169352_441_1070 | 193 |
| 65 | 3300036712 | Ga0316584_0164000 | Ga0316584_0164000_499_1128 | 193 |
| 66 | 3300041408 | Ga0439453_0045710 | Ga0439453_0045710_43_672 | 193 |
| 67 | 3300050509 | nmdc:mga0qj67_306604_c1 | nmdc:mga0qj67_306604_c1_285_914 | 193 |
| 68 | 3300005547 | Ga0070693_100180395 | Ga0070693_1001803952 | 194 |
| 69 | 3300005335 | Ga0070666_10011720 | Ga0070666_100117208 | 195 |
| 70 | 3300005367 | Ga0070667_100110005 | Ga0070667_1001100053 | 195 |
| 71 | 3300009101 | Ga0105247_10025695 | Ga0105247_100256952 | 195 |
| 72 | 3300025900 | Ga0207710_10038772 | Ga0207710_100387721 | 195 |
| 73 | 3300025903 | Ga0207680_10005288 | Ga0207680_100052884 | 195 |
| 74 | 3300025986 | Ga0207658_10162406 | Ga0207658_101624063 | 195 |
| 75 | 3300031251 | Ga0265327_10047544 | Ga0265327_100475442 | 195 |
| 76 | 3300031727 | Ga0316576_10131890 | Ga0316576_101318902 | 195 |
| 77 | 3300031727 | Ga0316576_10174670 | Ga0316576_101746703 | 195 |
| 78 | 3300045051 | Ga0451576_0093478 | Ga0451576_0093478_97_738 | 195 |
| 79 | 3300005331 | Ga0070670_100354558 | Ga0070670_1003545582 | 196 |
| 80 | 3300005334 | Ga0068869_100052792 | Ga0068869_1000527925 | 196 |
| 81 | 3300005341 | Ga0070691_10071126 | Ga0070691_100711262 | 196 |
| 82 | 3300005345 | Ga0070692_10057919 | Ga0070692_100579193 | 196 |
| 83 | 3300005354 | Ga0070675_100217939 | Ga0070675_1002179392 | 196 |
| 84 | 3300005356 | Ga0070674_100128947 | Ga0070674_1001289472 | 196 |
| 85 | 3300005438 | Ga0070701_10045163 | Ga0070701_100451633 | 196 |
| 86 | 3300005440 | Ga0070705_100140459 | Ga0070705_1001404592 | 196 |
| 87 | 3300005444 | Ga0070694_100151382 | Ga0070694_1001513822 | 196 |
| 88 | 3300005456 | Ga0070678_100266833 | Ga0070678_1002668331 | 196 |
| 89 | 3300005577 | Ga0068857_100232106 | Ga0068857_1002321062 | 196 |
| 90 | 3300005617 | Ga0068859_100333503 | Ga0068859_1003335032 | 196 |
| 91 | 3300005719 | Ga0068861_100397861 | Ga0068861_1003978612 | 196 |
| 92 | 3300005844 | Ga0068862_100015990 | Ga0068862_1000159907 | 196 |
| 93 | 3300006852 | Ga0075433_10055666 | Ga0075433_100556662 | 196 |
| 94 | 3300006880 | Ga0075429_100015102 | Ga0075429_1000151026 | 196 |
| 95 | 3300006931 | Ga0097620_100333530 | Ga0097620_1003335303 | 196 |
| 96 | 3300009094 | Ga0111539_11005646 | Ga0111539_110056461 | 196 |
| 97 | 3300009148 | Ga0105243_10368378 | Ga0105243_103683782 | 196 |
| 98 | 3300014326 | Ga0157380_10006331 | Ga0157380_100063316 | 196 |
| 99 | 3300025907 | Ga0207645_10152450 | Ga0207645_101524502 | 196 |
| 100 | 3300025926 | Ga0207659_10137501 | Ga0207659_101375012 | 196 |
| 101 | 3300025933 | Ga0207706_10245544 | Ga0207706_102455441 | 196 |
| 102 | 3300025935 | Ga0207709_10095115 | Ga0207709_100951152 | 196 |
| 103 | 3300025936 | Ga0207670_10151617 | Ga0207670_101516172 | 196 |
| 104 | 3300025937 | Ga0207669_10186370 | Ga0207669_101863702 | 196 |
| 105 | 3300025942 | Ga0207689_10067957 | Ga0207689_100679572 | 196 |
| 106 | 3300026089 | Ga0207648_10164521 | Ga0207648_101645212 | 196 |
| 107 | 3300026095 | Ga0207676_10537117 | Ga0207676_105371172 | 196 |
| 108 | 3300026118 | Ga0207675_100020752 | Ga0207675_1000207524 | 196 |
| 109 | 3300026118 | Ga0207675_100507107 | Ga0207675_1005071072 | 196 |
| 110 | 3300027360 | Ga0209969_1016106 | Ga0209969_10161062 | 196 |
| 111 | 3300027471 | Ga0209995_1019749 | Ga0209995_10197492 | 196 |
| 112 | 3300031727 | Ga0316576_10220267 | Ga0316576_102202672 | 196 |
| 113 | 3300035398 | Ga0316574_0073681 | Ga0316574_0073681_1139_1786 | 196 |
| 114 | 3300044712 | Ga0453684_0337891 | Ga0453684_0337891_803_1459 | 196 |
| 115 | 3300049523 | Ga0501300_004881 | Ga0501300_004881_221_871 | 196 |
| 116 | 3300049569 | Ga0501032_0476214 | Ga0501032_0476214_65_706 | 196 |
| 117 | 3300049573 | Ga0501037_0357425 | Ga0501037_0357425_249_890 | 196 |
| 118 | 3300049587 | Ga0501071_0122537 | Ga0501071_0122537_485_1126 | 196 |
| 119 | 3300049587 | Ga0501071_0402370 | Ga0501071_0402370_381_1022 | 196 |
| 120 | 3300049591 | Ga0501075_0267711 | Ga0501075_0267711_67_708 | 196 |
| 121 | 3300049592 | Ga0501076_0263591 | Ga0501076_0263591_23_664 | 196 |
| 122 | 3300049741 | Ga0501079_0355950 | Ga0501079_0355950_146_829 | 196 |
| 123 | 3300049776 | Ga0501280_000743 | Ga0501280_000743_1960_2610 | 196 |
| 124 | 3300050508 | nmdc:mga09592_75248_c1 | nmdc:mga09592_75248_c1_47_688 | 196 |
| 125 | 3300050515 | nmdc:mga0a205_28175_c1 | nmdc:mga0a205_28175_c1_4328_4969 | 196 |
| 126 | 3300053096 | Ga0500641_0013748 | Ga0500641_0013748_1520_2158 | 196 |
| 127 | 3300053139 | Ga0500568_0104378 | Ga0500568_0104378_129_770 | 196 |
| 128 | iso_pu_bacteria | 2738541276 | 2738716889 | 196 |
| 129 | 3300005331 | Ga0070670_100076803 | Ga0070670_1000768035 | 197 |
| 130 | 3300005844 | Ga0068862_100010462 | Ga0068862_1000104627 | 197 |
| 131 | 3300009177 | Ga0105248_10602909 | Ga0105248_106029092 | 197 |
| 132 | 3300025925 | Ga0207650_10024261 | Ga0207650_100242612 | 197 |
| 133 | 3300028380 | Ga0268265_10018818 | Ga0268265_100188183 | 197 |
| 134 | 3300032133 | Ga0316583_10116566 | Ga0316583_101165661 | 197 |
| 135 | 3300035398 | Ga0316574_0155395 | Ga0316574_0155395_713_1360 | 197 |
| 136 | 3300042876 | Ga0451577_0004900 | Ga0451577_0004900_6527_7174 | 197 |
| 137 | 3300042876 | Ga0451577_0023405 | Ga0451577_0023405_4798_5466 | 197 |
| 138 | 3300042876 | Ga0451577_0079845 | Ga0451577_0079845_1393_2055 | 197 |
| 139 | 3300044673 | Ga0453683_0000009 | Ga0453683_0000009_386669_387316 | 197 |
| 140 | 3300044712 | Ga0453684_0001182 | Ga0453684_0001182_49588_50235 | 197 |
| 141 | 3300044712 | Ga0453684_0145811 | Ga0453684_0145811_1223_1885 | 197 |
| 142 | 3300045051 | Ga0451576_0134404 | Ga0451576_0134404_1854_2555 | 197 |
| 143 | 3300049576 | Ga0501040_0797799 | Ga0501040_0797799_48_656 | 197 |
| 144 | 3300049591 | Ga0501075_0284056 | Ga0501075_0284056_307_915 | 197 |
| 145 | 3300049741 | Ga0501079_0213247 | Ga0501079_0213247_706_1314 | 197 |
| 146 | 3300049741 | Ga0501079_0577736 | Ga0501079_0577736_168_863 | 197 |
| 147 | 3300049824 | Ga0501045_0276091 | Ga0501045_0276091_488_1096 | 197 |
| 148 | 3300060353 | Ga0501082_0364252 | Ga0501082_0364252_90_698 | 197 |
| 149 | 3300061734 | Ga0530510_0294392 | Ga0530510_0294392_80_688 | 197 |
| 150 | 3300005548 | Ga0070665_100266564 | Ga0070665_1002665642 | 198 |
| 151 | 3300006847 | Ga0075431_100245533 | Ga0075431_1002455332 | 198 |
| 152 | 3300009176 | Ga0105242_10031959 | Ga0105242_100319592 | 198 |
| 153 | 3300028379 | Ga0268266_10151407 | Ga0268266_101514072 | 198 |
| 154 | 3300044712 | Ga0453684_0000123 | Ga0453684_0000123_86401_87081 | 198 |
| 155 | 3300050510 | nmdc:mga06r32_474481_c1 | nmdc:mga06r32_474481_c1_253_921 | 198 |
| 156 | 3300005367 | Ga0070667_100438869 | Ga0070667_1004388692 | 199 |
| 157 | 3300005436 | Ga0070713_100005301 | Ga0070713_1000053017 | 199 |
| 158 | 3300005439 | Ga0070711_100074055 | Ga0070711_1000740553 | 199 |
| 159 | 3300005616 | Ga0068852_100423184 | Ga0068852_1004231841 | 199 |
| 160 | 3300005618 | Ga0068864_100260498 | Ga0068864_1002604983 | 199 |
| 161 | 3300006846 | Ga0075430_100023766 | Ga0075430_1000237663 | 199 |
| 162 | 3300009098 | Ga0105245_10297455 | Ga0105245_102974552 | 199 |
| 163 | 3300009176 | Ga0105242_11126271 | Ga0105242_111262711 | 199 |
| 164 | 3300013297 | Ga0157378_10341379 | Ga0157378_103413792 | 199 |
| 165 | 3300025927 | Ga0207687_10094668 | Ga0207687_100946682 | 199 |
| 166 | 3300025986 | Ga0207658_10438856 | Ga0207658_104388562 | 199 |
| 167 | 3300026095 | Ga0207676_10078084 | Ga0207676_100780842 | 199 |
| 168 | 3300031665 | Ga0316575_10000370 | Ga0316575_100003709 | 199 |
| 169 | 3300031727 | Ga0316576_10223480 | Ga0316576_102234802 | 199 |
| 170 | 3300032133 | Ga0316583_10005590 | Ga0316583_100055902 | 199 |
| 171 | 3300036647 | Ga0316582_0063204 | Ga0316582_0063204_418_1065 | 199 |
| 172 | 3300036712 | Ga0316584_0055160 | Ga0316584_0055160_1907_2554 | 199 |
| 173 | 3300049571 | Ga0501034_0020923 | Ga0501034_0020923_2431_3051 | 199 |
| 174 | 3300049580 | Ga0501046_0020632 | Ga0501046_0020632_2281_2901 | 199 |
| 175 | 3300049581 | Ga0501047_0043907 | Ga0501047_0043907_1942_2562 | 199 |
| 176 | 3300049823 | Ga0501044_0016744 | Ga0501044_0016744_445_1065 | 199 |
| 177 | 3300050509 | nmdc:mga0qj67_52506_c1 | nmdc:mga0qj67_52506_c1_1211_1894 | 199 |
| 178 | 3300053096 | Ga0500641_0064702 | Ga0500641_0064702_120_725 | 199 |
| 179 | 3300005327 | Ga0070658_10125009 | Ga0070658_101250092 | 200 |
| 180 | 3300005331 | Ga0070670_100147106 | Ga0070670_1001471063 | 200 |
| 181 | 3300005331 | Ga0070670_100344012 | Ga0070670_1003440121 | 200 |
| 182 | 3300005334 | Ga0068869_100021784 | Ga0068869_1000217843 | 200 |
| 183 | 3300005340 | Ga0070689_100060585 | Ga0070689_1000605853 | 200 |
| 184 | 3300005347 | Ga0070668_100095682 | Ga0070668_1000956824 | 200 |
| 185 | 3300005354 | Ga0070675_100740694 | Ga0070675_1007406941 | 200 |
| 186 | 3300005355 | Ga0070671_100312525 | Ga0070671_1003125251 | 200 |
| 187 | 3300005364 | Ga0070673_100601953 | Ga0070673_1006019532 | 200 |
| 188 | 3300005441 | Ga0070700_100060221 | Ga0070700_1000602214 | 200 |
| 189 | 3300005459 | Ga0068867_100022466 | Ga0068867_1000224662 | 200 |
| 190 | 3300005543 | Ga0070672_100011537 | Ga0070672_1000115373 | 200 |
| 191 | 3300005543 | Ga0070672_100406587 | Ga0070672_1004065872 | 200 |
| 192 | 3300005544 | Ga0070686_100068095 | Ga0070686_1000680951 | 200 |
| 193 | 3300005615 | Ga0070702_100213386 | Ga0070702_1002133861 | 200 |
| 194 | 3300005616 | Ga0068852_101020558 | Ga0068852_1010205581 | 200 |
| 195 | 3300005618 | Ga0068864_100000841 | Ga0068864_1000008419 | 200 |
| 196 | 3300005618 | Ga0068864_100017969 | Ga0068864_1000179696 | 200 |
| 197 | 3300005618 | Ga0068864_100125772 | Ga0068864_1001257723 | 200 |
| 198 | 3300005618 | Ga0068864_100169517 | Ga0068864_1001695174 | 200 |
| 199 | 3300005618 | Ga0068864_100430593 | Ga0068864_1004305931 | 200 |
| 200 | 3300005841 | Ga0068863_100054476 | Ga0068863_1000544764 | 200 |
| 201 | 3300005842 | Ga0068858_100013104 | Ga0068858_1000131042 | 200 |
| 202 | 3300005843 | Ga0068860_100053931 | Ga0068860_1000539313 | 200 |
| 203 | 3300005843 | Ga0068860_100158803 | Ga0068860_1001588034 | 200 |
| 204 | 3300006358 | Ga0068871_100454531 | Ga0068871_1004545312 | 200 |
| 205 | 3300009553 | Ga0105249_10017355 | Ga0105249_100173558 | 200 |
| 206 | 3300013297 | Ga0157378_10293257 | Ga0157378_102932573 | 200 |
| 207 | 3300013306 | Ga0163162_10089494 | Ga0163162_100894945 | 200 |
| 208 | 3300013306 | Ga0163162_10830910 | Ga0163162_108309102 | 200 |
| 209 | 3300013308 | Ga0157375_10027802 | Ga0157375_100278026 | 200 |
| 210 | 3300013308 | Ga0157375_10454780 | Ga0157375_104547801 | 200 |
| 211 | 3300014325 | Ga0163163_10648960 | Ga0163163_106489602 | 200 |
| 212 | 3300014326 | Ga0157380_10058558 | Ga0157380_100585582 | 200 |
| 213 | 3300014326 | Ga0157380_10928790 | Ga0157380_109287902 | 200 |
| 214 | 3300014969 | Ga0157376_10065872 | Ga0157376_100658724 | 200 |
| 215 | 3300014969 | Ga0157376_10089912 | Ga0157376_100899123 | 200 |
| 216 | 3300017792 | Ga0163161_10181009 | Ga0163161_101810092 | 200 |
| 217 | 3300025315 | Ga0207697_10024531 | Ga0207697_100245312 | 200 |
| 218 | 3300025908 | Ga0207643_10029368 | Ga0207643_100293684 | 200 |
| 219 | 3300025925 | Ga0207650_10184254 | Ga0207650_101842542 | 200 |
| 220 | 3300025925 | Ga0207650_10230826 | Ga0207650_102308263 | 200 |
| 221 | 3300025926 | Ga0207659_10003570 | Ga0207659_1000357011 | 200 |
| 222 | 3300025926 | Ga0207659_10050484 | Ga0207659_100504844 | 200 |
| 223 | 3300025931 | Ga0207644_10551618 | Ga0207644_105516182 | 200 |
| 224 | 3300025933 | Ga0207706_10008271 | Ga0207706_100082713 | 200 |
| 225 | 3300025937 | Ga0207669_10514682 | Ga0207669_105146821 | 200 |
| 226 | 3300025940 | Ga0207691_10012770 | Ga0207691_100127706 | 200 |
| 227 | 3300025940 | Ga0207691_10092944 | Ga0207691_100929443 | 200 |
| 228 | 3300025940 | Ga0207691_10169181 | Ga0207691_101691814 | 200 |
| 229 | 3300025942 | Ga0207689_10001809 | Ga0207689_1000180917 | 200 |
| 230 | 3300025972 | Ga0207668_10272492 | Ga0207668_102724922 | 200 |
| 231 | 3300025972 | Ga0207668_10536315 | Ga0207668_105363151 | 200 |
| 232 | 3300025986 | Ga0207658_10604162 | Ga0207658_106041622 | 200 |
| 233 | 3300026035 | Ga0207703_10073732 | Ga0207703_100737322 | 200 |
| 234 | 3300026075 | Ga0207708_10100858 | Ga0207708_101008582 | 200 |
| 235 | 3300026088 | Ga0207641_10150075 | Ga0207641_101500752 | 200 |
| 236 | 3300026088 | Ga0207641_10478688 | Ga0207641_104786881 | 200 |
| 237 | 3300026095 | Ga0207676_10067463 | Ga0207676_100674632 | 200 |
| 238 | 3300026095 | Ga0207676_10378849 | Ga0207676_103788492 | 200 |
| 239 | 3300026121 | Ga0207683_10050174 | Ga0207683_100501744 | 200 |
| 240 | 3300028380 | Ga0268265_10104190 | Ga0268265_101041902 | 200 |
| 241 | 3300028381 | Ga0268264_10087182 | Ga0268264_100871824 | 200 |
| 242 | 3300031548 | Ga0307408_100041067 | Ga0307408_1000410675 | 200 |
| 243 | 3300031727 | Ga0316576_10188912 | Ga0316576_101889122 | 200 |
| 244 | 3300031731 | Ga0307405_10183955 | Ga0307405_101839553 | 200 |
| 245 | 3300031852 | Ga0307410_10014000 | Ga0307410_100140006 | 200 |
| 246 | 3300031903 | Ga0307407_10008880 | Ga0307407_100088806 | 200 |
| 247 | 3300031903 | Ga0307407_10071496 | Ga0307407_100714962 | 200 |
| 248 | 3300031995 | Ga0307409_100019885 | Ga0307409_1000198852 | 200 |
| 249 | 3300031995 | Ga0307409_100021584 | Ga0307409_1000215845 | 200 |
| 250 | 3300031995 | Ga0307409_100075988 | Ga0307409_1000759883 | 200 |
| 251 | 3300032002 | Ga0307416_100003739 | Ga0307416_1000037396 | 200 |
| 252 | 3300032004 | Ga0307414_10596156 | Ga0307414_105961562 | 200 |
| 253 | 3300032005 | Ga0307411_10006672 | Ga0307411_100066726 | 200 |
| 254 | 3300032005 | Ga0307411_10155883 | Ga0307411_101558832 | 200 |
| 255 | 3300035114 | Ga0373939_0159674 | Ga0373939_0159674_92_763 | 200 |
| 256 | 3300035119 | Ga0373956_0281243 | Ga0373956_0281243_88_759 | 200 |
| 257 | 3300035398 | Ga0316574_0026363 | Ga0316574_0026363_2782_3477 | 200 |
| 258 | 3300036401 | Ga0373937_0117796 | Ga0373937_0117796_1244_1915 | 200 |
| 259 | 3300048915 | Ga0496112_0151984 | Ga0496112_0151984_498_1172 | 200 |
| 260 | 3300049592 | Ga0501076_0213482 | Ga0501076_0213482_882_1529 | 200 |
| 261 | 3300005937 | Ga0081455_10267975 | Ga0081455_102679752 | 201 |
| 262 | 3300009551 | Ga0105238_10000157 | Ga0105238_1000015736 | 201 |
| 263 | 3300025924 | Ga0207694_10002734 | Ga0207694_100027345 | 201 |
| 264 | 3300031507 | Ga0307509_10000009 | Ga0307509_10000009294 | 201 |
| 265 | 3300047315 | Ga0495581_0032108 | Ga0495581_0032108_2067_2690 | 201 |
| 266 | 3300049568 | Ga0501031_0550116 | Ga0501031_0550116_11_646 | 201 |
| 267 | 3300031548 | Ga0307408_100605117 | Ga0307408_1006051172 | 202 |
| 268 | 3300031731 | Ga0307405_10024144 | Ga0307405_100241442 | 202 |
| 269 | 3300031911 | Ga0307412_10332436 | Ga0307412_103324362 | 202 |
| 270 | 3300032002 | Ga0307416_100778045 | Ga0307416_1007780452 | 202 |
| 271 | 3300036712 | Ga0316584_0426066 | Ga0316584_0426066_42_737 | 202 |
| 272 | 3300041512 | Ga0451853_2189050 | Ga0451853_2189050_456_1133 | 202 |
| 273 | 3300005844 | Ga0068862_100546285 | Ga0068862_1005462851 | 203 |
| 274 | 3300026089 | Ga0207648_10175839 | Ga0207648_101758392 | 203 |
| 275 | 3300047322 | Ga0495680_0287734 | Ga0495680_0287734_522_1133 | 203 |
| 276 | 3300048908 | Ga0496105_0417717 | Ga0496105_0417717_432_1049 | 203 |
| 277 | 3300049571 | Ga0501034_0037633 | Ga0501034_0037633_981_1616 | 203 |
| 278 | 3300049579 | Ga0501043_0011233 | Ga0501043_0011233_41_676 | 203 |
| 279 | 3300049580 | Ga0501046_0025890 | Ga0501046_0025890_2207_2842 | 203 |
| 280 | 3300049581 | Ga0501047_0004771 | Ga0501047_0004771_882_1517 | 203 |
| 281 | 3300049586 | Ga0501070_0000290 | Ga0501070_0000290_42753_43388 | 203 |
| 282 | 3300005330 | Ga0070690_100196571 | Ga0070690_1001965712 | 204 |
| 283 | 3300005441 | Ga0070700_100245507 | Ga0070700_1002455071 | 204 |
| 284 | 3300026095 | Ga0207676_10450610 | Ga0207676_104506102 | 204 |
| 285 | 3300042876 | Ga0451577_0015034 | Ga0451577_0015034_3915_4598 | 204 |
| 286 | 3300044712 | Ga0453684_0002840 | Ga0453684_0002840_13308_13991 | 204 |
| 287 | 3300044712 | Ga0453684_0049832 | Ga0453684_0049832_3557_4216 | 204 |
| 288 | 3300053085 | Ga0495619_0394489 | Ga0495619_0394489_108_728 | 204 |
| 289 | 3300005563 | Ga0068855_100037286 | Ga0068855_1000372864 | 205 |
| 290 | 3300025949 | Ga0207667_10065604 | Ga0207667_100656043 | 205 |
| 291 | 3300048088 | Ga0495602_0230913 | Ga0495602_0230913_42_665 | 205 |
| 292 | 3300049574 | Ga0501038_0415839 | Ga0501038_0415839_33_680 | 205 |
| 293 | 3300049576 | Ga0501040_0269922 | Ga0501040_0269922_440_1087 | 205 |
| 294 | 3300060353 | Ga0501082_0833330 | Ga0501082_0833330_130_777 | 205 |
| 295 | 3300031251 | Ga0265327_10005077 | Ga0265327_100050777 | 208 |
| 296 | 3300003316 | rootH1_10182114 | rootH1_101821142 | 210 |
| 297 | 3300003322 | rootL2_10213749 | rootL2_102137492 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vir-assembly1.cif.gz_A-2 | crystal structure of probable nicotinate-nucleotide adenylyltransferase from mycobacterium abscessus in complex with nadp and compound fol0091 | 0.9618 | 2 | 198 |
| 4s1o-assembly1.cif.gz_A | structure of mycobacterium tuberculosis nadd in complex with nadp | 0.95 | 1 | 199 |
| 4ymi-assembly1.cif.gz_A | crystal structure of probable nicotinate-nucleotide adenylyltransferase from mycobacterium abcessus in complex with nadp | 0.9467 | 2 | 200 |
| 5das-assembly3.cif.gz_C | structure of mycobacterium tuberculosis nadd in complex with nadp, p21212, form 2 | 0.9459 | 2 | 199 |
| 4s1o-assembly1.cif.gz_A | structure of mycobacterium tuberculosis nadd in complex with nadp | 0.9448 | 1 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5virA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9618 | 2 | 198 | 3.40.50.620 |
| 5virA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.941 | 2 | 198 | 3.40.50.620 |
| 2h2aB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9168 | 2 | 200 | 3.40.50.620 |
| 2h2aB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9029 | 2 | 200 | 3.40.50.620 |
| af_A0A0R0EKS6_1_167_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8875 | 49 | 200 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V0MAP3-F1-model_v4 | nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) | 0.9757 | 1 | 136 |
GO:0009435
GO:0070566 |
| AF-A0A3D4P8F4-F1-model_v4 | Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) | 0.9738 | 1 | 200 |
GO:0004515
GO:0005524 GO:0009435 |
| AF-A0A7C3I961-F1-model_v4 | Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) | 0.9727 | 1 | 198 |
GO:0004515
GO:0005524 GO:0009435 |
| AF-A0A3G6JAY5-F1-model_v4 | Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) | 0.9713 | 2 | 200 |
GO:0004515
GO:0005524 GO:0009435 |
| AF-A0A3M2AZ14-F1-model_v4 | Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) | 0.9712 | 1 | 200 |
GO:0004515
GO:0005524 GO:0009435 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar