F393737

General Info

Members Datasets Scaffolds Average Seq Length
297 233 594 163

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10094012|Ga0207665_100940121
Length 188
Sequence VRSLGVPRLNLGYQSIALPSPLSSRLFPMKPAEHPTALRTSQLLREAGIDTHVVEFEQPTRTSVEAAAAIGCSVAEIAKSIVFRGKTSGQAVVVVASGDNRVSETKVAAKLGEPLARADADFVRTATGYVIGGVAPIGHSQPVKLLLDEDLQRYETVWAAAGTPFSVFPLKPDQLRSLTGADWADVRV

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
103 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
106 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
107 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
108 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
109 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
110 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
111 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2547132512 Azospira oryzae 6a3 Isolate Unclassified
219 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
220 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
221 2808606448 Streptomyces sp. 193411 Isolate Unclassified
222 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
223 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
224 2867428634 Streptomyces sp. RP5T Isolate Unclassified
225 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
226 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
227 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
228 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
229 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
230 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
231 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
232 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
233 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 0.67
Isolates 5.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 6.06
Rhizosphere 87.21
Stem 0
Stem Tuber 0
Unclassified 4.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10094012 3300025939 Bacteria 2082
2 Ga0006562J51391_1072225 3300003578 Bacteria 9060
3 Ga0006562J51391_1072226 3300003578 Bacteria 10520
4 Ga0070690_100130309 3300005330 Bacteria 1698
5 Ga0070670_100671691 3300005331 Archaea 930
6 Ga0068869_100319834 3300005334 Bacteria 1258
7 Ga0068869_100791615 3300005334 Bacteria 814
8 Ga0070680_100002735 3300005336 Bacteria 13085
9 Ga0068868_101156540 3300005338 Unclassified 714
10 Ga0070689_100727704 3300005340 Bacteria 868
11 Ga0070691_10038448 3300005341 Bacteria 2259
12 Ga0070692_10444421 3300005345 Bacteria 828
13 Ga0070692_10784981 3300005345 Bacteria 649
14 Ga0070669_100502305 3300005353 Bacteria 1006
15 Ga0070671_100374027 3300005355 Bacteria 1217
16 Ga0070667_100625169 3300005367 Bacteria 993
17 Ga0070703_10000452 3300005406 Bacteria 16475
18 Ga0070711_100832322 3300005439 Unclassified 784
19 Ga0070705_100000183 3300005440 Bacteria 36567
20 Ga0070700_100007370 3300005441 Bacteria 5934
21 Ga0070700_100344346 3300005441 Bacteria 1103
22 Ga0070694_100005941 3300005444 Bacteria 7400
23 Ga0070708_100004234 3300005445 Bacteria 11270
24 Ga0070663_100007471 3300005455 Bacteria 6651
25 Ga0070663_101910703 3300005455 Unclassified 533
26 Ga0070681_10096059 3300005458 Bacteria 2912
27 Ga0070706_100083328 3300005467 Bacteria 2962
28 Ga0070706_100451252 3300005467 Bacteria 1196
29 Ga0070707_100287030 3300005468 Bacteria 1599
30 Ga0070707_100814003 3300005468 Archaea 898
31 Ga0070698_100053716 3300005471 Bacteria 4093
32 Ga0070699_100000211 3300005518 Bacteria 57596
33 Ga0070679_100121113 3300005530 Bacteria 2601
34 Ga0070697_100379876 3300005536 Bacteria 1224
35 Ga0068853_100575715 3300005539 Bacteria 1068
36 Ga0070695_100000503 3300005545 Bacteria 20421
37 Ga0070695_100321488 3300005545 Bacteria 1150
38 Ga0070696_100000025 3300005546 Bacteria 68455
39 Ga0070693_100257464 3300005547 Bacteria 1159
40 Ga0070665_101390213 3300005548 Bacteria 711
41 Ga0070704_100000088 3300005549 Bacteria 31829
42 Ga0070704_100052927 3300005549 Bacteria 2867
43 Ga0068857_100004432 3300005577 Bacteria 11873
44 Ga0068854_100941529 3300005578 Unclassified 761
45 Ga0070702_100434573 3300005615 Bacteria 948
46 Ga0068852_100955364 3300005616 Bacteria 875
47 Ga0068859_100002599 3300005617 Bacteria 18375
48 Ga0068864_100176314 3300005618 Bacteria 1952
49 Ga0068858_100046421 3300005842 Bacteria 4026
50 Ga0068858_100349132 3300005842 Bacteria 1417
51 Ga0068860_100017216 3300005843 Bacteria 7045
52 Ga0068860_100964630 3300005843 Bacteria 870
53 Ga0068862_100031841 3300005844 Bacteria 4454
54 Ga0075428_100074049 3300006844 Bacteria 3720
55 Ga0075431_100037216 3300006847 Bacteria 5015
56 Ga0075431_100218221 3300006847 Bacteria 1946
57 Ga0075433_10091654 3300006852 Unclassified 2687
58 Ga0075433_10290446 3300006852 Bacteria 1448
59 Ga0075433_11462897 3300006852 Bacteria 590
60 Ga0075434_100131375 3300006871 Bacteria 2523
61 Ga0075434_100176476 3300006871 Bacteria 2156
62 Ga0075434_100702758 3300006871 Bacteria 1028
63 Ga0075429_100242191 3300006880 Bacteria 1580
64 Ga0075436_100250322 3300006914 Unclassified 1262
65 Ga0097620_100002599 3300006931 Bacteria 18375
66 Ga0075435_100064254 3300007076 Bacteria 2982
67 Ga0111539_10011152 3300009094 Bacteria 11304
68 Ga0114129_10016856 3300009147 Bacteria 10403
69 Ga0114129_10980335 3300009147 Bacteria 1066
70 Ga0105243_10039381 3300009148 Bacteria 3684
71 Ga0105243_10901996 3300009148 Bacteria 879
72 Ga0105242_10055986 3300009176 Unclassified 3226
73 Ga0105248_10488396 3300009177 Bacteria 1388
74 Ga0105248_11134844 3300009177 Bacteria 884
75 Ga0105249_10001160 3300009553 Bacteria 23306
76 Ga0105246_10032293 3300011119 Bacteria 3471
77 Ga0157374_10796629 3300013296 Bacteria 961
78 Ga0157378_10124502 3300013297 Bacteria 2380
79 Ga0163163_10157606 3300014325 Bacteria 2315
80 Ga0157380_10843069 3300014326 Bacteria 938
81 Ga0157379_10108204 3300014968 Bacteria 2496
82 Ga0209758_1006026 3300025297 Bacteria 8952
83 Ga0207426_1032199 3300025302 Bacteria 1702
84 Ga0207653_10006599 3300025885 Bacteria 3623
85 Ga0207647_10380166 3300025904 Bacteria 797
86 Ga0207684_10576194 3300025910 Bacteria 962
87 Ga0207707_10116486 3300025912 Bacteria 2335
88 Ga0207660_10001376 3300025917 Bacteria 16304
89 Ga0207662_10227873 3300025918 Bacteria 1216
90 Ga0207662_10380333 3300025918 Bacteria 954
91 Ga0207652_10197203 3300025921 Bacteria 1812
92 Ga0207646_10037777 3300025922 Bacteria 4352
93 Ga0207646_10203039 3300025922 Bacteria 1791
94 Ga0207681_10619108 3300025923 Bacteria 896
95 Ga0207650_10558664 3300025925 Archaea 960
96 Ga0207687_11098209 3300025927 Bacteria 683
97 Ga0207644_10244616 3300025931 Bacteria 1429
98 Ga0207644_10850190 3300025931 Unclassified 764
99 Ga0207709_10411802 3300025935 Bacteria 1036
100 Ga0207711_10386535 3300025941 Bacteria 1299
101 Ga0207712_10001804 3300025961 Bacteria 14159
102 Ga0207678_10004247 3300026067 Bacteria 12853
103 Ga0207708_10001519 3300026075 Bacteria 17293
104 Ga0207676_10017145 3300026095 Bacteria 5247
105 Ga0207676_10223705 3300026095 Bacteria 1678
106 Ga0207674_10002144 3300026116 Bacteria 24948
107 Ga0207698_10923810 3300026142 Bacteria 881
108 Ga0268266_11757149 3300028379 Bacteria 595
109 Ga0268264_10010730 3300028381 Bacteria 7570
110 Ga0307515_10339575 3300028794 Bacteria 1155
111 Ga0268256_1035806 3300030500 Bacteria 1151
112 Ga0307512_10005063 3300030522 Bacteria 14015
113 Ga0265332_10000025 3300031238 Bacteria 197048
114 Ga0265327_10157500 3300031251 Bacteria 1051
115 Ga0307513_10431622 3300031456 Bacteria 1045
116 Ga0307408_100399618 3300031548 Bacteria 1180
117 Ga0307514_10101602 3300031649 Bacteria 2063
118 Ga0307514_10127437 3300031649 Bacteria 1760
119 Ga0307413_10299975 3300031824 Unclassified 1218
120 Ga0373939_0099722 3300035114 Bacteria 995
121 Ga0316574_0655585 3300035398 Unclassified 646
122 Ga0373927_0203900 3300035695 Bacteria 1299
123 Ga0373947_0408617 3300035725 Bacteria 916
124 Ga0439436_0003204 3300041404 Bacteria 4965
125 Ga0451837_1572557 3300041494 Bacteria 1317
126 Ga0439433_0023234 3300041999 Bacteria 1394
127 Ga0439442_009815 3300042002 Bacteria 1937
128 Ga0439449_0011971 3300042007 Bacteria 3261
129 Ga0439457_000787 3300042014 Bacteria 9465
130 Ga0439462_0001445 3300042015 Bacteria 5292
131 Ga0450900_018653 3300042136 Bacteria 953
132 Ga0450903_000247 3300042138 Bacteria 11999
133 Ga0439459_0135658 3300042438 Bacteria 632
134 Ga0439460_0047205 3300042461 Bacteria 1281
135 Ga0450901_001467 3300042533 Bacteria 2683
136 Ga0451577_0021908 3300042876 Bacteria 5840
137 Ga0451577_0126081 3300042876 Bacteria 2294
138 Ga0466972_0046559 3300044658 Bacteria 2099
139 Ga0466965_0271472 3300044683 Bacteria 914
140 Ga0466966_0866547 3300044684 Bacteria 545
141 Ga0466963_0056834 3300044694 Bacteria 2604
142 Ga0453684_0008774 3300044712 Bacteria 17947
143 Ga0451576_0003054 3300045051 Bacteria 23548
144 Ga0466967_0223077 3300045976 Bacteria 1792
145 Ga0466967_0575798 3300045976 Bacteria 1110
146 Ga0495627_025789 3300046453 Bacteria 1903
147 Ga0495590_0104639 3300046457 Bacteria 1007
148 Ga0495629_0039970 3300046459 Bacteria 3300
149 Ga0495580_0403098 3300046472 Bacteria 922
150 Ga0495605_0031176 3300046474 Bacteria 2725
151 Ga0495662_0030056 3300046476 Bacteria 2622
152 Ga0495664_0049632 3300046477 Bacteria 2491
153 Ga0495585_0131562 3300046492 Bacteria 1316
154 Ga0495594_0097793 3300046499 Bacteria 1649
155 Ga0495594_0190751 3300046499 Bacteria 1168
156 Ga0495607_0027838 3300046501 Bacteria 3490
157 Ga0495583_0008283 3300046506 Bacteria 6374
158 Ga0495583_0090006 3300046506 Bacteria 1322
159 Ga0495606_0027065 3300046507 Bacteria 4072
160 Ga0495606_0093902 3300046507 Bacteria 1839
161 Ga0495610_0075541 3300046512 Bacteria 1560
162 Ga0495616_0033057 3300046513 Bacteria 2698
163 Ga0495620_0008273 3300046515 Bacteria 5591
164 Ga0495628_0071452 3300046516 Bacteria 2705
165 Ga0495631_0008047 3300046518 Bacteria 5328
166 Ga0495632_0058922 3300046519 Bacteria 1870
167 Ga0495643_0166375 3300046522 Bacteria 1081
168 Ga0495648_0011340 3300046524 Bacteria 6721
169 Ga0495648_0057798 3300046524 Bacteria 2323
170 Ga0495666_0006983 3300046526 Bacteria 5670
171 Ga0495654_0013048 3300046530 Bacteria 4452
172 Ga0495609_0008530 3300046538 Bacteria 5015
173 Ga0495621_0004298 3300046539 Bacteria 3993
174 Ga0495621_0052033 3300046539 Bacteria 1467
175 Ga0495597_0090739 3300046542 Bacteria 1297
176 Ga0495622_0004532 3300046557 Bacteria 6430
177 Ga0495622_0146378 3300046557 Bacteria 1070
178 Ga0495633_0072853 3300046558 Bacteria 1601
179 Ga0495668_0050079 3300046616 Bacteria 2315
180 Ga0495611_0020366 3300046648 Bacteria 2854
181 Ga0495661_0066266 3300046665 Bacteria 2126
182 Ga0495657_0047310 3300046675 Bacteria 2908
183 Ga0495613_0059759 3300046689 Bacteria 2793
184 Ga0495624_0033469 3300046690 Bacteria 3328
185 Ga0495671_0096794 3300046692 Bacteria 1444
186 Ga0495649_0061349 3300046694 Bacteria 2021
187 Ga0495649_0083716 3300046694 Bacteria 1704
188 Ga0495589_0029211 3300046794 Bacteria 2779
189 Ga0495589_0066737 3300046794 Bacteria 1761
190 Ga0495589_0091575 3300046794 Bacteria 1476
191 Ga0495660_0035718 3300046810 Bacteria 2775
192 Ga0495581_0121535 3300047315 Bacteria 1520
193 Ga0495604_0319826 3300047317 Bacteria 1037
194 Ga0495636_0003413 3300047318 Bacteria 6162
195 Ga0495636_0091543 3300047318 Bacteria 1320
196 Ga0495636_0129240 3300047318 Bacteria 1123
197 Ga0495676_0008035 3300047321 Bacteria 9671
198 Ga0495676_0122990 3300047321 Bacteria 1884
199 Ga0495676_0709581 3300047321 Bacteria 650
200 Ga0495683_0189072 3300047323 Bacteria 935
201 Ga0495687_013517 3300047443 Bacteria 4255
202 Ga0495687_026731 3300047443 Bacteria 2711
203 Ga0495677_0050192 3300047445 Bacteria 1535
204 Ga0495685_001992 3300047447 Bacteria 6335
205 Ga0495685_005819 3300047447 Bacteria 4029
206 Ga0495685_009320 3300047447 Bacteria 3277
207 Ga0495681_0035711 3300047470 Bacteria 2466
208 Ga0495593_0070863 3300047673 Bacteria 1810
209 Ga0495626_0030270 3300048091 Bacteria 2611
210 Ga0496100_0087744 3300048903 Bacteria 2116
211 Ga0496100_0108503 3300048903 Bacteria 1925
212 Ga0496101_0082706 3300048904 Bacteria 2376
213 Ga0496102_0008750 3300048905 Bacteria 8684
214 Ga0496103_0066279 3300048906 Bacteria 2253
215 Ga0496104_0007191 3300048907 Bacteria 9814
216 Ga0496105_0554749 3300048908 Bacteria 896
217 Ga0496106_0003442 3300048909 Bacteria 11792
218 Ga0496106_0103079 3300048909 Bacteria 2214
219 Ga0496107_0027527 3300048910 Bacteria 4037
220 Ga0496109_0082329 3300048912 Bacteria 2966
221 Ga0496109_0270746 3300048912 Bacteria 1600
222 Ga0496109_0325666 3300048912 Bacteria 1450
223 Ga0496110_0082896 3300048913 Bacteria 2860
224 Ga0496111_0156511 3300048914 Bacteria 1691
225 Ga0496113_0154078 3300048916 Bacteria 1814
226 Ga0496114_0391750 3300048917 Bacteria 1230
227 Ga0496115_0022427 3300048918 Bacteria 4892
228 Ga0495678_107540 3300049459 Bacteria 956
229 Ga0501031_0004140 3300049568 Bacteria 9368
230 Ga0501032_0020880 3300049569 Bacteria 4556
231 Ga0501033_0020298 3300049570 Bacteria 5019
232 Ga0501036_0195333 3300049572 Bacteria 1702
233 Ga0501037_0321299 3300049573 Bacteria 1072
234 Ga0501037_0663020 3300049573 Bacteria 696
235 Ga0501038_0136482 3300049574 Bacteria 2009
236 Ga0501039_0075860 3300049575 Bacteria 2614
237 Ga0501039_0150694 3300049575 Bacteria 1827
238 Ga0501039_0858176 3300049575 Bacteria 707
239 Ga0501040_0967969 3300049576 Bacteria 617
240 Ga0501041_0770173 3300049577 Bacteria 617
241 Ga0501042_0050967 3300049578 Bacteria 2953
242 Ga0501043_0221772 3300049579 Bacteria 1462
243 Ga0501046_0081979 3300049580 Bacteria 2491
244 Ga0501046_0267092 3300049580 Bacteria 1256
245 Ga0501046_0799107 3300049580 Bacteria 661
246 Ga0501048_0011680 3300049582 Bacteria 6550
247 Ga0501048_0545162 3300049582 Bacteria 832
248 Ga0501068_0186109 3300049584 Bacteria 1314
249 Ga0501071_0305608 3300049587 Bacteria 1206
250 Ga0501073_0176455 3300049589 Bacteria 1479
251 Ga0501076_0038751 3300049592 Bacteria 3742
252 Ga0501076_0200273 3300049592 Bacteria 1630
253 Ga0501076_0371469 3300049592 Bacteria 1175
254 Ga0501077_0112662 3300049593 Bacteria 1724
255 Ga0501079_0002831 3300049741 Bacteria 12645
256 Ga0501079_0417532 3300049741 Bacteria 1053
257 Ga0501080_0696481 3300049742 Bacteria 896
258 Ga0501080_1227234 3300049742 Bacteria 644
259 Ga0501081_0691021 3300049743 Bacteria 766
260 Ga0501081_0722689 3300049743 Bacteria 748
261 Ga0501083_0472600 3300049744 Bacteria 816
262 Ga0501044_0414304 3300049823 Bacteria 1258
263 Ga0501044_0751178 3300049823 Bacteria 857
264 nmdc:mga05p37_21143_c1 3300050507 Bacteria 7877
265 nmdc:mga05p37_946363_c1 3300050507 Unclassified 922
266 nmdc:mga09592_66488_c2 3300050508 Bacteria 2445
267 nmdc:mga06r32_23875_c1 3300050510 Bacteria 5667
268 nmdc:mga06r32_60423_c1 3300050510 Bacteria 3647
269 nmdc:mga08y16_34072_c1 3300050511 Bacteria 5349
270 nmdc:mga0n895_1244776_c1 3300050512 Bacteria 717
271 nmdc:mga0n895_152533_c1 3300050512 Bacteria 2341
272 nmdc:mga0n895_948870_c1 3300050512 Bacteria 844
273 nmdc:mga0rr50_309467_c1 3300050513 Unclassified 1323
274 nmdc:mga08x19_94250_c1 3300050514 Bacteria 1979
275 nmdc:mga0a205_330217_c1 3300050515 Bacteria 1395
276 nmdc:mga0a205_78834_c1 3300050515 Bacteria 3182
277 Ga0500555_161876 3300053103 Unclassified 546
278 Ga0501082_0098278 3300060353 Bacteria 2531
279 Ga0501082_0472459 3300060353 Bacteria 1096
280 Ga0466962_0024586 3300061719 Bacteria 2893
281 Ga0530510_0086308 3300061734 Bacteria 2287
282 2548846939 2547132512 Bacteria 3416496
283 2644436988 2643221678 Bacteria 9540101
284 2784588452 2784132148 Bacteria 8627943
285 2809232048 2808606448 Bacteria 8656184
286 2812358372 2811994879 Bacteria 9313447
287 2812480724 2811994917 Bacteria 7761064
288 2867430396 2867428634 Bacteria 9590268
289 2873155927 2873151551 Bacteria 8625867
290 2891633657 2891633521 Bacteria 4602265
291 2912720219 2912715099 Bacteria 9460473
292 2912724481 2912723979 Bacteria 8557534
293 2946067506 2946064051 Bacteria 8957905
294 2947229492 2947224130 Bacteria 9938529
295 8008578995 8008574985 Bacteria 7815457
296 8023628867 8023623736 Bacteria 8593882
297 8048410227 8048406513 Bacteria 8936924
298 Ga0207665_10094012
299 Ga0006562J51391_1072225
300 Ga0006562J51391_1072226
301 Ga0070690_100130309
302 Ga0070670_100671691
303 Ga0068869_100319834
304 Ga0068869_100791615
305 Ga0070680_100002735
306 Ga0068868_101156540
307 Ga0070689_100727704
308 Ga0070691_10038448
309 Ga0070692_10444421
310 Ga0070692_10784981
311 Ga0070669_100502305
312 Ga0070671_100374027
313 Ga0070667_100625169
314 Ga0070703_10000452
315 Ga0070711_100832322
316 Ga0070705_100000183
317 Ga0070700_100007370
318 Ga0070700_100344346
319 Ga0070694_100005941
320 Ga0070708_100004234
321 Ga0070663_100007471
322 Ga0070663_101910703
323 Ga0070681_10096059
324 Ga0070706_100083328
325 Ga0070706_100451252
326 Ga0070707_100287030
327 Ga0070707_100814003
328 Ga0070698_100053716
329 Ga0070699_100000211
330 Ga0070679_100121113
331 Ga0070697_100379876
332 Ga0068853_100575715
333 Ga0070695_100000503
334 Ga0070695_100321488
335 Ga0070696_100000025
336 Ga0070693_100257464
337 Ga0070665_101390213
338 Ga0070704_100000088
339 Ga0070704_100052927
340 Ga0068857_100004432
341 Ga0068854_100941529
342 Ga0070702_100434573
343 Ga0068852_100955364
344 Ga0068859_100002599
345 Ga0068864_100176314
346 Ga0068858_100046421
347 Ga0068858_100349132
348 Ga0068860_100017216
349 Ga0068860_100964630
350 Ga0068862_100031841
351 Ga0075428_100074049
352 Ga0075431_100037216
353 Ga0075431_100218221
354 Ga0075433_10091654
355 Ga0075433_10290446
356 Ga0075433_11462897
357 Ga0075434_100131375
358 Ga0075434_100176476
359 Ga0075434_100702758
360 Ga0075429_100242191
361 Ga0075436_100250322
362 Ga0097620_100002599
363 Ga0075435_100064254
364 Ga0111539_10011152
365 Ga0114129_10016856
366 Ga0114129_10980335
367 Ga0105243_10039381
368 Ga0105243_10901996
369 Ga0105242_10055986
370 Ga0105248_10488396
371 Ga0105248_11134844
372 Ga0105249_10001160
373 Ga0105246_10032293
374 Ga0157374_10796629
375 Ga0157378_10124502
376 Ga0163163_10157606
377 Ga0157380_10843069
378 Ga0157379_10108204
379 Ga0209758_1006026
380 Ga0207426_1032199
381 Ga0207653_10006599
382 Ga0207647_10380166
383 Ga0207684_10576194
384 Ga0207707_10116486
385 Ga0207660_10001376
386 Ga0207662_10227873
387 Ga0207662_10380333
388 Ga0207652_10197203
389 Ga0207646_10037777
390 Ga0207646_10203039
391 Ga0207681_10619108
392 Ga0207650_10558664
393 Ga0207687_11098209
394 Ga0207644_10244616
395 Ga0207644_10850190
396 Ga0207709_10411802
397 Ga0207711_10386535
398 Ga0207712_10001804
399 Ga0207678_10004247
400 Ga0207708_10001519
401 Ga0207676_10017145
402 Ga0207676_10223705
403 Ga0207674_10002144
404 Ga0207698_10923810
405 Ga0268266_11757149
406 Ga0268264_10010730
407 Ga0307515_10339575
408 Ga0268256_1035806
409 Ga0307512_10005063
410 Ga0265332_10000025
411 Ga0265327_10157500
412 Ga0307513_10431622
413 Ga0307408_100399618
414 Ga0307514_10101602
415 Ga0307514_10127437
416 Ga0307413_10299975
417 Ga0373939_0099722
418 Ga0316574_0655585
419 Ga0373927_0203900
420 Ga0373947_0408617
421 Ga0439436_0003204
422 Ga0451837_1572557
423 Ga0439433_0023234
424 Ga0439442_009815
425 Ga0439449_0011971
426 Ga0439457_000787
427 Ga0439462_0001445
428 Ga0450900_018653
429 Ga0450903_000247
430 Ga0439459_0135658
431 Ga0439460_0047205
432 Ga0450901_001467
433 Ga0451577_0021908
434 Ga0451577_0126081
435 Ga0466972_0046559
436 Ga0466965_0271472
437 Ga0466966_0866547
438 Ga0466963_0056834
439 Ga0453684_0008774
440 Ga0451576_0003054
441 Ga0466967_0223077
442 Ga0466967_0575798
443 Ga0495627_025789
444 Ga0495590_0104639
445 Ga0495629_0039970
446 Ga0495580_0403098
447 Ga0495605_0031176
448 Ga0495662_0030056
449 Ga0495664_0049632
450 Ga0495585_0131562
451 Ga0495594_0097793
452 Ga0495594_0190751
453 Ga0495607_0027838
454 Ga0495583_0008283
455 Ga0495583_0090006
456 Ga0495606_0027065
457 Ga0495606_0093902
458 Ga0495610_0075541
459 Ga0495616_0033057
460 Ga0495620_0008273
461 Ga0495628_0071452
462 Ga0495631_0008047
463 Ga0495632_0058922
464 Ga0495643_0166375
465 Ga0495648_0011340
466 Ga0495648_0057798
467 Ga0495666_0006983
468 Ga0495654_0013048
469 Ga0495609_0008530
470 Ga0495621_0004298
471 Ga0495621_0052033
472 Ga0495597_0090739
473 Ga0495622_0004532
474 Ga0495622_0146378
475 Ga0495633_0072853
476 Ga0495668_0050079
477 Ga0495611_0020366
478 Ga0495661_0066266
479 Ga0495657_0047310
480 Ga0495613_0059759
481 Ga0495624_0033469
482 Ga0495671_0096794
483 Ga0495649_0061349
484 Ga0495649_0083716
485 Ga0495589_0029211
486 Ga0495589_0066737
487 Ga0495589_0091575
488 Ga0495660_0035718
489 Ga0495581_0121535
490 Ga0495604_0319826
491 Ga0495636_0003413
492 Ga0495636_0091543
493 Ga0495636_0129240
494 Ga0495676_0008035
495 Ga0495676_0122990
496 Ga0495676_0709581
497 Ga0495683_0189072
498 Ga0495687_013517
499 Ga0495687_026731
500 Ga0495677_0050192
501 Ga0495685_001992
502 Ga0495685_005819
503 Ga0495685_009320
504 Ga0495681_0035711
505 Ga0495593_0070863
506 Ga0495626_0030270
507 Ga0496100_0087744
508 Ga0496100_0108503
509 Ga0496101_0082706
510 Ga0496102_0008750
511 Ga0496103_0066279
512 Ga0496104_0007191
513 Ga0496105_0554749
514 Ga0496106_0003442
515 Ga0496106_0103079
516 Ga0496107_0027527
517 Ga0496109_0082329
518 Ga0496109_0270746
519 Ga0496109_0325666
520 Ga0496110_0082896
521 Ga0496111_0156511
522 Ga0496113_0154078
523 Ga0496114_0391750
524 Ga0496115_0022427
525 Ga0495678_107540
526 Ga0501031_0004140
527 Ga0501032_0020880
528 Ga0501033_0020298
529 Ga0501036_0195333
530 Ga0501037_0321299
531 Ga0501037_0663020
532 Ga0501038_0136482
533 Ga0501039_0075860
534 Ga0501039_0150694
535 Ga0501039_0858176
536 Ga0501040_0967969
537 Ga0501041_0770173
538 Ga0501042_0050967
539 Ga0501043_0221772
540 Ga0501046_0081979
541 Ga0501046_0267092
542 Ga0501046_0799107
543 Ga0501048_0011680
544 Ga0501048_0545162
545 Ga0501068_0186109
546 Ga0501071_0305608
547 Ga0501073_0176455
548 Ga0501076_0038751
549 Ga0501076_0200273
550 Ga0501076_0371469
551 Ga0501077_0112662
552 Ga0501079_0002831
553 Ga0501079_0417532
554 Ga0501080_0696481
555 Ga0501080_1227234
556 Ga0501081_0691021
557 Ga0501081_0722689
558 Ga0501083_0472600
559 Ga0501044_0414304
560 Ga0501044_0751178
561 nmdc:mga05p37_21143_c1
562 nmdc:mga05p37_946363_c1
563 nmdc:mga09592_66488_c2
564 nmdc:mga06r32_23875_c1
565 nmdc:mga06r32_60423_c1
566 nmdc:mga08y16_34072_c1
567 nmdc:mga0n895_1244776_c1
568 nmdc:mga0n895_152533_c1
569 nmdc:mga0n895_948870_c1
570 nmdc:mga0rr50_309467_c1
571 nmdc:mga08x19_94250_c1
572 nmdc:mga0a205_330217_c1
573 nmdc:mga0a205_78834_c1
574 Ga0500555_161876
575 Ga0501082_0098278
576 Ga0501082_0472459
577 Ga0466962_0024586
578 Ga0530510_0086308
579 2548846939
580 2644436988
581 2784588452
582 2809232048
583 2812358372
584 2812480724
585 2867430396
586 2873155927
587 2891633657
588 2912720219
589 2912724481
590 2946067506
591 2947229492
592 8008578995
593 8023628867
594 8048410227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

57

178

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9407 1 161
2cx5-assembly3.cif.gz_C crystal structure of a putative trans-editing enzyme for prolyl trna synthetase 0.9365 1 161
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9349 1 161
3ri0-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9295 1 162
3ri0-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9278 1 161
ID Description Score Start End Superfamily
af_Q4D973_68_232_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.91 9 161 3.90.960.10
af_A4HRV9_8_202_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9017 21 158 3.90.960.10
3rijC00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9002 1 161 3.90.960.10
3rijC00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8888 1 161 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8853 9 160 3.90.960.10
ID Description Score Start End GO Terms
AF-L1L2N0-F1-model_v4 YbaK/prolyl-tRNA synthetase-associated domain protein 0.9999 42 160 GO:0002161
GO:0004812
AF-A0A0N0N6S1-F1-model_v4 YbaK/prolyl-tRNA synthetase associated region 0.9966 2 163 GO:0002161
GO:0004812
AF-A0A286CHL8-F1-model_v4 Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC 0.9952 3 163 GO:0002161
AF-A0A4R7ILE1-F1-model_v4 deleted 0.9917 4 163
AF-A0A6M9XMT1-F1-model_v4 deleted 0.9902 4 163

Map