F393650

General Info

Members Datasets Scaffolds Average Seq Length
297 167 594 491

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100010504|Ga0075429_1000105042
Length 587
Sequence MLLRGDGLGNRAQVGCAGTKGRDAMTTRTSPEYRGDDRLLFGIIFGVLAFWLFAQTTLNIAPTMAADLDVATNVMNIAVSITALFSGIFIVVIGGLADRVGRVKMVMWGFAFGIAGSLLVGAAPPGTLAGPFLMLGRICQGLSGAFVMPASLALLKAYWDGAARQRAVSLWSMGSWGGSGFAALFGGLMAESVGWRYIFFASALVSLLGLLMVRGTPESKAAADGEFKFDTMGVLTFMVTMVALLIVATQGSRMGWTSPITLGLAAAALTFGILFLRTESRAPNAFVNFKLFRNSTYTGATLSNLLLNGVAGMQLVSMTLVQLGGDLSAQQAGMLTLGYAIAIVAFIRVGERLLQKFGARAPMIWGSLIVGLSIALLMPTHLLLGEYKVLAVIAYTLFGLGLAFYATPSTDAALSSLPDDQAGSGSGIYKMASSLGASFGVAISAALFTALSAGDEPFHWLSGAITFAGRQDNLALREAAVVALGFNLLLVAAAIASIVLTVPKGPPAGRMLNPAPAVTGSPKLHFPSDSSQPISRREGRTRDPEDRVVAPNDRDGVREKMFDKTVADSFPASDPPSSIPDPEEDPF

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
133 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
134 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
167 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.45
Nodule 0
Rhizoplane 3.03
Rhizosphere 84.51
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100010504 3300006880 Bacteria 8007
2 JGI25151J46595_10002073 3300003187 Bacteria 12493
3 JGI25165J46597_1000129 3300003214 Bacteria 127064
4 rootL2_10201016 3300003322 Bacteria 2739
5 Ga0055526_1003495 3300003771 Bacteria 9957
6 Ga0055526_1003508 3300003771 Bacteria 9913
7 Ga0055526_1012341 3300003771 Bacteria 3741
8 Ga0055537_1001852 3300003773 Bacteria 7633
9 Ga0055524_1003258 3300003775 Bacteria 7947
10 Ga0055536_1000211 3300003781 Bacteria 47611
11 Ga0055534_1001050 3300003784 Bacteria 11984
12 Ga0055534_1005548 3300003784 Bacteria 3349
13 Ga0065712_10005366 3300005290 Bacteria 3720
14 Ga0065707_10087393 3300005295 Bacteria 5041
15 Ga0070658_10002092 3300005327 Bacteria 16732
16 Ga0070658_10002744 3300005327 Bacteria 14656
17 Ga0070658_10088408 3300005327 Bacteria 2551
18 Ga0070676_10108156 3300005328 Bacteria 1728
19 Ga0070683_100005644 3300005329 Bacteria 10456
20 Ga0070683_100008430 3300005329 Bacteria 8755
21 Ga0070683_100031359 3300005329 Bacteria 4832
22 Ga0070683_100040410 3300005329 Bacteria 4289
23 Ga0070670_100017759 3300005331 Bacteria 6104
24 Ga0070670_100023621 3300005331 Bacteria 5292
25 Ga0070670_100064651 3300005331 Bacteria 3139
26 Ga0070670_100074210 3300005331 Bacteria 2921
27 Ga0068868_100013155 3300005338 Bacteria 6062
28 Ga0070661_100001254 3300005344 Bacteria 17808
29 Ga0070661_100027379 3300005344 Bacteria 4104
30 Ga0070668_100097411 3300005347 Bacteria 2326
31 Ga0070669_100027871 3300005353 Bacteria 4066
32 Ga0070675_100000946 3300005354 Bacteria 20697
33 Ga0070675_100013373 3300005354 Bacteria 6450
34 Ga0070675_100021394 3300005354 Bacteria 5169
35 Ga0070675_100045268 3300005354 Bacteria 3600
36 Ga0070671_100016982 3300005355 Bacteria 5885
37 Ga0070671_100104173 3300005355 Bacteria 2381
38 Ga0070674_100006397 3300005356 Bacteria 6870
39 Ga0070674_100007756 3300005356 Bacteria 6342
40 Ga0070674_100104700 3300005356 Bacteria 2068
41 Ga0070673_100020489 3300005364 Bacteria 4771
42 Ga0070659_100005241 3300005366 Bacteria 9300
43 Ga0070659_100025530 3300005366 Bacteria 4540
44 Ga0070694_100062450 3300005444 Bacteria 2545
45 Ga0070663_100021027 3300005455 Bacteria 4332
46 Ga0070663_100040267 3300005455 Bacteria 3270
47 Ga0070662_100039194 3300005457 Bacteria 3370
48 Ga0070662_100055753 3300005457 Bacteria 2868
49 Ga0070681_10000580 3300005458 Bacteria 30243
50 Ga0070681_10001144 3300005458 Bacteria 22852
51 Ga0070681_10003916 3300005458 Bacteria 14035
52 Ga0070681_10012782 3300005458 Bacteria 8331
53 Ga0070681_10066675 3300005458 Bacteria 3568
54 Ga0070679_100003258 3300005530 Bacteria 14849
55 Ga0070679_100018879 3300005530 Bacteria 6695
56 Ga0070679_100020668 3300005530 Bacteria 6421
57 Ga0070679_100030057 3300005530 Bacteria 5362
58 Ga0070679_100199245 3300005530 Bacteria 1969
59 Ga0070684_100003779 3300005535 Bacteria 11429
60 Ga0070684_100053495 3300005535 Bacteria 3515
61 Ga0070684_100185463 3300005535 Bacteria 1892
62 Ga0068853_100023659 3300005539 Bacteria 5146
63 Ga0070695_100000355 3300005545 Bacteria 23470
64 Ga0070695_100021830 3300005545 Bacteria 3922
65 Ga0070696_100034164 3300005546 Bacteria 3497
66 Ga0070696_100095790 3300005546 Bacteria 2120
67 Ga0070693_100002145 3300005547 Bacteria 9043
68 Ga0070693_100002886 3300005547 Bacteria 7927
69 Ga0070693_100003546 3300005547 Bacteria 7277
70 Ga0070693_100126137 3300005547 Bacteria 1594
71 Ga0070665_100006180 3300005548 Bacteria 12250
72 Ga0070704_100019617 3300005549 Bacteria 4347
73 Ga0068855_100008443 3300005563 Bacteria 12454
74 Ga0070664_100009250 3300005564 Bacteria 8000
75 Ga0070664_100034281 3300005564 Bacteria 4258
76 Ga0070664_100052922 3300005564 Bacteria 3440
77 Ga0068857_100002212 3300005577 Bacteria 15833
78 Ga0068857_100003715 3300005577 Bacteria 12807
79 Ga0068857_100017145 3300005577 Bacteria 6344
80 Ga0068856_100002047 3300005614 Bacteria 20923
81 Ga0068856_100021338 3300005614 Bacteria 6294
82 Ga0068852_100065605 3300005616 Bacteria 3168
83 Ga0068852_100122929 3300005616 Bacteria 2379
84 Ga0068859_100316316 3300005617 Bacteria 1655
85 Ga0068861_100041537 3300005719 Bacteria 3445
86 Ga0068851_10003829 3300005834 Bacteria 6733
87 Ga0068870_10007907 3300005840 Bacteria 4758
88 Ga0068863_100084344 3300005841 Bacteria 3011
89 Ga0068862_100020661 3300005844 Bacteria 5501
90 Ga0075365_10077053 3300006038 Bacteria 2252
91 Ga0075364_10006681 3300006051 Bacteria 6801
92 Ga0075367_10004571 3300006178 Bacteria 6773
93 Ga0075366_10001293 3300006195 Bacteria 12476
94 Ga0068871_100001936 3300006358 Bacteria 14019
95 Ga0075428_100000346 3300006844 Bacteria 46086
96 Ga0075428_100107230 3300006844 Bacteria 3045
97 Ga0075428_100151997 3300006844 Bacteria 2515
98 Ga0075431_100010427 3300006847 Bacteria 9340
99 Ga0075429_100044142 3300006880 Bacteria 3877
100 Ga0097620_100316306 3300006931 Bacteria 1655
101 Ga0105240_10008955 3300009093 Bacteria 14231
102 Ga0111539_10000176 3300009094 Bacteria 74203
103 Ga0111539_10000435 3300009094 Bacteria 52742
104 Ga0111539_10000733 3300009094 Bacteria 42654
105 Ga0111539_10026860 3300009094 Bacteria 7033
106 Ga0111539_10118884 3300009094 Bacteria 3097
107 Ga0111539_10153568 3300009094 Bacteria 2694
108 Ga0105247_10077956 3300009101 Bacteria 2083
109 Ga0105241_10034530 3300009174 Bacteria 3800
110 Ga0105248_10002354 3300009177 Bacteria 20984
111 Ga0105248_10024756 3300009177 Bacteria 6675
112 Ga0105248_10103546 3300009177 Bacteria 3208
113 Ga0105237_10022598 3300009545 Bacteria 6451
114 Ga0105238_10001041 3300009551 Bacteria 28144
115 Ga0105238_10015556 3300009551 Bacteria 7703
116 Ga0105239_10007403 3300010375 Bacteria 12593
117 Ga0105239_10011081 3300010375 Bacteria 10064
118 Ga0157373_10008238 3300013100 Bacteria 7749
119 Ga0157373_10015587 3300013100 Bacteria 5554
120 Ga0157371_10048532 3300013102 Bacteria 3017
121 Ga0157370_10011626 3300013104 Bacteria 9192
122 Ga0157369_10000134 3300013105 Bacteria 105562
123 Ga0157369_10010458 3300013105 Bacteria 10569
124 Ga0157369_10012949 3300013105 Bacteria 9450
125 Ga0157374_10000661 3300013296 Bacteria 30295
126 Ga0157374_10025780 3300013296 Bacteria 5284
127 Ga0157374_10026678 3300013296 Bacteria 5201
128 Ga0157374_10090124 3300013296 Bacteria 2923
129 Ga0157378_10001601 3300013297 Bacteria 20469
130 Ga0163162_10027234 3300013306 Bacteria 5652
131 Ga0157372_10013818 3300013307 Bacteria 8623
132 Ga0157372_10035571 3300013307 Bacteria 5484
133 Ga0163163_10031346 3300014325 Bacteria 5130
134 Ga0157380_10011630 3300014326 Bacteria 6362
135 Ga0157380_10118087 3300014326 Bacteria 2241
136 Ga0157379_10003318 3300014968 Bacteria 13633
137 Ga0163161_10032163 3300017792 Bacteria 3744
138 Ga0209233_1000155 3300025261 Bacteria 167981
139 Ga0209565_1000021 3300025263 Bacteria 406281
140 Ga0209675_1000149 3300025291 Bacteria 93109
141 Ga0209675_1003019 3300025291 Bacteria 8257
142 Ga0209676_1000014 3300025292 Bacteria 793514
143 Ga0209025_1000781 3300025294 Bacteria 52410
144 Ga0209025_1001089 3300025294 Bacteria 39299
145 Ga0209025_1002125 3300025294 Bacteria 22289
146 Ga0209564_1001039 3300025295 Bacteria 34008
147 Ga0209564_1001370 3300025295 Bacteria 25525
148 Ga0209564_1001428 3300025295 Bacteria 24530
149 Ga0209758_1005893 3300025297 Bacteria 9134
150 Ga0209256_1000345 3300025299 Bacteria 75475
151 Ga0209256_1000502 3300025299 Bacteria 57469
152 Ga0209051_1010726 3300025303 Bacteria 4589
153 Ga0207697_10005055 3300025315 Bacteria 6178
154 Ga0207656_10022291 3300025321 Bacteria 2539
155 Ga0207682_10009941 3300025893 Bacteria 3737
156 Ga0207682_10025293 3300025893 Bacteria 2354
157 Ga0207688_10007947 3300025901 Bacteria 5770
158 Ga0207645_10061598 3300025907 Bacteria 2397
159 Ga0207645_10091581 3300025907 Bacteria 1955
160 Ga0207705_10000990 3300025909 Bacteria 23181
161 Ga0207705_10022784 3300025909 Bacteria 4466
162 Ga0207654_10028447 3300025911 Unclassified 3047
163 Ga0207654_10078420 3300025911 Bacteria 1982
164 Ga0207707_10000926 3300025912 Bacteria 28482
165 Ga0207707_10006139 3300025912 Bacteria 10499
166 Ga0207707_10017371 3300025912 Bacteria 6272
167 Ga0207707_10030898 3300025912 Bacteria 4685
168 Ga0207707_10095600 3300025912 Bacteria 2597
169 Ga0207707_10174454 3300025912 Bacteria 1878
170 Ga0207707_10201784 3300025912 Bacteria 1734
171 Ga0207695_10089290 3300025913 Bacteria 3099
172 Ga0207695_10208838 3300025913 Bacteria 1864
173 Ga0207671_10036098 3300025914 Bacteria 3665
174 Ga0207660_10142436 3300025917 Bacteria 1834
175 Ga0207649_10009413 3300025920 Bacteria 5344
176 Ga0207649_10018639 3300025920 Bacteria 3952
177 Ga0207649_10128697 3300025920 Bacteria 1717
178 Ga0207652_10001698 3300025921 Bacteria 19278
179 Ga0207652_10013098 3300025921 Bacteria 6713
180 Ga0207652_10020730 3300025921 Bacteria 5417
181 Ga0207652_10030388 3300025921 Bacteria 4524
182 Ga0207652_10064680 3300025921 Bacteria 3165
183 Ga0207652_10069297 3300025921 Bacteria 3062
184 Ga0207652_10176124 3300025921 Bacteria 1921
185 Ga0207681_10017910 3300025923 Bacteria 4454
186 Ga0207681_10148123 3300025923 Bacteria 1756
187 Ga0207694_10001081 3300025924 Bacteria 23667
188 Ga0207694_10051773 3300025924 Bacteria 3182
189 Ga0207694_10091311 3300025924 Bacteria 2403
190 Ga0207650_10013778 3300025925 Bacteria 5606
191 Ga0207650_10027238 3300025925 Bacteria 4089
192 Ga0207650_10096347 3300025925 Bacteria 2269
193 Ga0207659_10001139 3300025926 Bacteria 15793
194 Ga0207659_10001157 3300025926 Bacteria 15717
195 Ga0207659_10007702 3300025926 Bacteria 6645
196 Ga0207690_10009280 3300025932 Bacteria 5845
197 Ga0207690_10010276 3300025932 Bacteria 5559
198 Ga0207706_10021319 3300025933 Bacteria 5821
199 Ga0207706_10061600 3300025933 Bacteria 3304
200 Ga0207706_10080845 3300025933 Bacteria 2857
201 Ga0207706_10085769 3300025933 Bacteria 2768
202 Ga0207669_10064398 3300025937 Bacteria 2268
203 Ga0207691_10008839 3300025940 Bacteria 9665
204 Ga0207691_10018787 3300025940 Bacteria 6547
205 Ga0207711_10036989 3300025941 Bacteria 4143
206 Ga0207689_10027053 3300025942 Bacteria 4801
207 Ga0207661_10000763 3300025944 Bacteria 20961
208 Ga0207661_10004525 3300025944 Bacteria 9746
209 Ga0207661_10033516 3300025944 Bacteria 3987
210 Ga0207679_10001978 3300025945 Bacteria 12711
211 Ga0207667_10000163 3300025949 Bacteria 98321
212 Ga0207667_10000245 3300025949 Bacteria 76423
213 Ga0207667_10007952 3300025949 Bacteria 12657
214 Ga0207667_10028476 3300025949 Bacteria 6068
215 Ga0207651_10021260 3300025960 Bacteria 3939
216 Ga0207658_10031985 3300025986 Bacteria 3741
217 Ga0207703_10008498 3300026035 Bacteria 8112
218 Ga0207639_10020578 3300026041 Bacteria 4725
219 Ga0207678_10026279 3300026067 Bacteria 5079
220 Ga0207678_10096569 3300026067 Bacteria 2525
221 Ga0207678_10099342 3300026067 Bacteria 2486
222 Ga0207678_10180825 3300026067 Bacteria 1801
223 Ga0207708_10032679 3300026075 Bacteria 3951
224 Ga0207702_10000454 3300026078 Bacteria 46222
225 Ga0207674_10004918 3300026116 Bacteria 15976
226 Ga0207674_10006847 3300026116 Bacteria 13367
227 Ga0207674_10006999 3300026116 Bacteria 13190
228 Ga0207674_10019025 3300026116 Bacteria 7442
229 Ga0207675_100006553 3300026118 Bacteria 11015
230 Ga0207675_100049322 3300026118 Bacteria 3930
231 Ga0207683_10065980 3300026121 Bacteria 3191
232 Ga0207683_10179936 3300026121 Bacteria 1917
233 Ga0207428_10000298 3300027907 Bacteria 65387
234 Ga0207428_10004196 3300027907 Bacteria 13805
235 Ga0207428_10019492 3300027907 Bacteria 5782
236 Ga0207428_10024500 3300027907 Bacteria 5066
237 Ga0268266_10010562 3300028379 Bacteria 8057
238 Ga0268265_10022370 3300028380 Bacteria 4441
239 Ga0307416_100026660 3300032002 Bacteria 4262
240 Ga0373931_0010039 3300035691 Bacteria 4539
241 Ga0395899_0001672 3300037312 Bacteria 18484
242 Ga0395899_0002770 3300037312 Bacteria 14145
243 Ga0395900_0004190 3300037418 Bacteria 15313
244 Ga0395900_0024274 3300037418 Bacteria 6208
245 Ga0395898_0004952 3300037466 Bacteria 14456
246 Ga0395898_0166683 3300037466 Bacteria 2107
247 Ga0395905_0004260 3300037471 Bacteria 14939
248 Ga0395901_0003814 3300038443 Bacteria 15189
249 Ga0395901_0035257 3300038443 Bacteria 5169
250 Ga0395901_0071042 3300038443 Bacteria 3627
251 Ga0395901_0093311 3300038443 Bacteria 3152
252 Ga0451807_0810730 3300041486 Bacteria 3980
253 Ga0451837_0256205 3300041494 Bacteria 7105
254 Ga0451837_0365065 3300041494 Bacteria 3403
255 Ga0439433_0006232 3300041999 Bacteria 2567
256 Ga0450898_004958 3300042134 Bacteria 1991
257 Ga0451577_0008632 3300042876 Bacteria 9899
258 Ga0453684_0213490 3300044712 Bacteria 2241
259 Ga0495613_0007700 3300046689 Bacteria 8011
260 Ga0496100_0039102 3300048903 Bacteria 3011
261 Ga0496102_0020567 3300048905 Bacteria 5833
262 Ga0496105_0018510 3300048908 Bacteria 5602
263 Ga0496108_0010957 3300048911 Bacteria 7363
264 Ga0496109_0032291 3300048912 Bacteria 4706
265 Ga0496110_0050749 3300048913 Bacteria 3643
266 Ga0496112_0005913 3300048915 Bacteria 10672
267 Ga0496114_0030883 3300048917 Bacteria 4407
268 Ga0501034_0054789 3300049571 Bacteria 4014
269 Ga0501047_0006367 3300049581 Bacteria 11103
270 Ga0501071_0071379 3300049587 Bacteria 2531
271 Ga0501074_0105584 3300049590 Bacteria 2017
272 Ga0501077_0072134 3300049593 Bacteria 2188
273 Ga0501079_0081410 3300049741 Bacteria 2503
274 Ga0501081_0109016 3300049743 Bacteria 1964
275 Ga0501044_0012938 3300049823 Bacteria 9032
276 Ga0501045_0052654 3300049824 Bacteria 2973
277 nmdc:mga03683_5369_c1 3300050489 Bacteria 4326
278 nmdc:mga0yw44_3677_c1 3300050492 Bacteria 6859
279 nmdc:mga0k408_24267_c1 3300050493 Bacteria 3427
280 nmdc:mga0k408_8877_c1 3300050493 Bacteria 5407
281 nmdc:mga06z11_4230_c1 3300050494 Bacteria 5627
282 nmdc:mga09592_128143_c1 3300050508 Bacteria 2182
283 nmdc:mga09592_28599_c1 3300050508 Bacteria 4631
284 nmdc:mga09592_31753_c1 3300050508 Bacteria 4401
285 nmdc:mga09592_63770_c1 3300050508 Bacteria 3119
286 nmdc:mga0qj67_1854_c1 3300050509 Bacteria 14979
287 nmdc:mga06r32_8269_c1 3300050510 Bacteria 9366
288 nmdc:mga08y16_178_c1 3300050511 Bacteria 56109
289 nmdc:mga08y16_195_c1 3300050511 Bacteria 54659
290 nmdc:mga08y16_20689_c1 3300050511 Bacteria 6945
291 nmdc:mga08y16_209_c1 3300050511 Bacteria 52522
292 nmdc:mga08y16_4564_c1 3300050511 Bacteria 14433
293 nmdc:mga0a205_102180_c1 3300050515 Bacteria 2766
294 Ga0501084_0152291 3300054114 Bacteria 1949
295 Ga0501082_0112982 3300060353 Bacteria 2352
296 2881928044 2881927736 Bacteria 3993927
297 2919051726 2919051321 Bacteria 4210889
298 Ga0075429_100010504
299 JGI25151J46595_10002073
300 JGI25165J46597_1000129
301 rootL2_10201016
302 Ga0055526_1003495
303 Ga0055526_1003508
304 Ga0055526_1012341
305 Ga0055537_1001852
306 Ga0055524_1003258
307 Ga0055536_1000211
308 Ga0055534_1001050
309 Ga0055534_1005548
310 Ga0065712_10005366
311 Ga0065707_10087393
312 Ga0070658_10002092
313 Ga0070658_10002744
314 Ga0070658_10088408
315 Ga0070676_10108156
316 Ga0070683_100005644
317 Ga0070683_100008430
318 Ga0070683_100031359
319 Ga0070683_100040410
320 Ga0070670_100017759
321 Ga0070670_100023621
322 Ga0070670_100064651
323 Ga0070670_100074210
324 Ga0068868_100013155
325 Ga0070661_100001254
326 Ga0070661_100027379
327 Ga0070668_100097411
328 Ga0070669_100027871
329 Ga0070675_100000946
330 Ga0070675_100013373
331 Ga0070675_100021394
332 Ga0070675_100045268
333 Ga0070671_100016982
334 Ga0070671_100104173
335 Ga0070674_100006397
336 Ga0070674_100007756
337 Ga0070674_100104700
338 Ga0070673_100020489
339 Ga0070659_100005241
340 Ga0070659_100025530
341 Ga0070694_100062450
342 Ga0070663_100021027
343 Ga0070663_100040267
344 Ga0070662_100039194
345 Ga0070662_100055753
346 Ga0070681_10000580
347 Ga0070681_10001144
348 Ga0070681_10003916
349 Ga0070681_10012782
350 Ga0070681_10066675
351 Ga0070679_100003258
352 Ga0070679_100018879
353 Ga0070679_100020668
354 Ga0070679_100030057
355 Ga0070679_100199245
356 Ga0070684_100003779
357 Ga0070684_100053495
358 Ga0070684_100185463
359 Ga0068853_100023659
360 Ga0070695_100000355
361 Ga0070695_100021830
362 Ga0070696_100034164
363 Ga0070696_100095790
364 Ga0070693_100002145
365 Ga0070693_100002886
366 Ga0070693_100003546
367 Ga0070693_100126137
368 Ga0070665_100006180
369 Ga0070704_100019617
370 Ga0068855_100008443
371 Ga0070664_100009250
372 Ga0070664_100034281
373 Ga0070664_100052922
374 Ga0068857_100002212
375 Ga0068857_100003715
376 Ga0068857_100017145
377 Ga0068856_100002047
378 Ga0068856_100021338
379 Ga0068852_100065605
380 Ga0068852_100122929
381 Ga0068859_100316316
382 Ga0068861_100041537
383 Ga0068851_10003829
384 Ga0068870_10007907
385 Ga0068863_100084344
386 Ga0068862_100020661
387 Ga0075365_10077053
388 Ga0075364_10006681
389 Ga0075367_10004571
390 Ga0075366_10001293
391 Ga0068871_100001936
392 Ga0075428_100000346
393 Ga0075428_100107230
394 Ga0075428_100151997
395 Ga0075431_100010427
396 Ga0075429_100044142
397 Ga0097620_100316306
398 Ga0105240_10008955
399 Ga0111539_10000176
400 Ga0111539_10000435
401 Ga0111539_10000733
402 Ga0111539_10026860
403 Ga0111539_10118884
404 Ga0111539_10153568
405 Ga0105247_10077956
406 Ga0105241_10034530
407 Ga0105248_10002354
408 Ga0105248_10024756
409 Ga0105248_10103546
410 Ga0105237_10022598
411 Ga0105238_10001041
412 Ga0105238_10015556
413 Ga0105239_10007403
414 Ga0105239_10011081
415 Ga0157373_10008238
416 Ga0157373_10015587
417 Ga0157371_10048532
418 Ga0157370_10011626
419 Ga0157369_10000134
420 Ga0157369_10010458
421 Ga0157369_10012949
422 Ga0157374_10000661
423 Ga0157374_10025780
424 Ga0157374_10026678
425 Ga0157374_10090124
426 Ga0157378_10001601
427 Ga0163162_10027234
428 Ga0157372_10013818
429 Ga0157372_10035571
430 Ga0163163_10031346
431 Ga0157380_10011630
432 Ga0157380_10118087
433 Ga0157379_10003318
434 Ga0163161_10032163
435 Ga0209233_1000155
436 Ga0209565_1000021
437 Ga0209675_1000149
438 Ga0209675_1003019
439 Ga0209676_1000014
440 Ga0209025_1000781
441 Ga0209025_1001089
442 Ga0209025_1002125
443 Ga0209564_1001039
444 Ga0209564_1001370
445 Ga0209564_1001428
446 Ga0209758_1005893
447 Ga0209256_1000345
448 Ga0209256_1000502
449 Ga0209051_1010726
450 Ga0207697_10005055
451 Ga0207656_10022291
452 Ga0207682_10009941
453 Ga0207682_10025293
454 Ga0207688_10007947
455 Ga0207645_10061598
456 Ga0207645_10091581
457 Ga0207705_10000990
458 Ga0207705_10022784
459 Ga0207654_10028447
460 Ga0207654_10078420
461 Ga0207707_10000926
462 Ga0207707_10006139
463 Ga0207707_10017371
464 Ga0207707_10030898
465 Ga0207707_10095600
466 Ga0207707_10174454
467 Ga0207707_10201784
468 Ga0207695_10089290
469 Ga0207695_10208838
470 Ga0207671_10036098
471 Ga0207660_10142436
472 Ga0207649_10009413
473 Ga0207649_10018639
474 Ga0207649_10128697
475 Ga0207652_10001698
476 Ga0207652_10013098
477 Ga0207652_10020730
478 Ga0207652_10030388
479 Ga0207652_10064680
480 Ga0207652_10069297
481 Ga0207652_10176124
482 Ga0207681_10017910
483 Ga0207681_10148123
484 Ga0207694_10001081
485 Ga0207694_10051773
486 Ga0207694_10091311
487 Ga0207650_10013778
488 Ga0207650_10027238
489 Ga0207650_10096347
490 Ga0207659_10001139
491 Ga0207659_10001157
492 Ga0207659_10007702
493 Ga0207690_10009280
494 Ga0207690_10010276
495 Ga0207706_10021319
496 Ga0207706_10061600
497 Ga0207706_10080845
498 Ga0207706_10085769
499 Ga0207669_10064398
500 Ga0207691_10008839
501 Ga0207691_10018787
502 Ga0207711_10036989
503 Ga0207689_10027053
504 Ga0207661_10000763
505 Ga0207661_10004525
506 Ga0207661_10033516
507 Ga0207679_10001978
508 Ga0207667_10000163
509 Ga0207667_10000245
510 Ga0207667_10007952
511 Ga0207667_10028476
512 Ga0207651_10021260
513 Ga0207658_10031985
514 Ga0207703_10008498
515 Ga0207639_10020578
516 Ga0207678_10026279
517 Ga0207678_10096569
518 Ga0207678_10099342
519 Ga0207678_10180825
520 Ga0207708_10032679
521 Ga0207702_10000454
522 Ga0207674_10004918
523 Ga0207674_10006847
524 Ga0207674_10006999
525 Ga0207674_10019025
526 Ga0207675_100006553
527 Ga0207675_100049322
528 Ga0207683_10065980
529 Ga0207683_10179936
530 Ga0207428_10000298
531 Ga0207428_10004196
532 Ga0207428_10019492
533 Ga0207428_10024500
534 Ga0268266_10010562
535 Ga0268265_10022370
536 Ga0307416_100026660
537 Ga0373931_0010039
538 Ga0395899_0001672
539 Ga0395899_0002770
540 Ga0395900_0004190
541 Ga0395900_0024274
542 Ga0395898_0004952
543 Ga0395898_0166683
544 Ga0395905_0004260
545 Ga0395901_0003814
546 Ga0395901_0035257
547 Ga0395901_0071042
548 Ga0395901_0093311
549 Ga0451807_0810730
550 Ga0451837_0256205
551 Ga0451837_0365065
552 Ga0439433_0006232
553 Ga0450898_004958
554 Ga0451577_0008632
555 Ga0453684_0213490
556 Ga0495613_0007700
557 Ga0496100_0039102
558 Ga0496102_0020567
559 Ga0496105_0018510
560 Ga0496108_0010957
561 Ga0496109_0032291
562 Ga0496110_0050749
563 Ga0496112_0005913
564 Ga0496114_0030883
565 Ga0501034_0054789
566 Ga0501047_0006367
567 Ga0501071_0071379
568 Ga0501074_0105584
569 Ga0501077_0072134
570 Ga0501079_0081410
571 Ga0501081_0109016
572 Ga0501044_0012938
573 Ga0501045_0052654
574 nmdc:mga03683_5369_c1
575 nmdc:mga0yw44_3677_c1
576 nmdc:mga0k408_24267_c1
577 nmdc:mga0k408_8877_c1
578 nmdc:mga06z11_4230_c1
579 nmdc:mga09592_128143_c1
580 nmdc:mga09592_28599_c1
581 nmdc:mga09592_31753_c1
582 nmdc:mga09592_63770_c1
583 nmdc:mga0qj67_1854_c1
584 nmdc:mga06r32_8269_c1
585 nmdc:mga08y16_178_c1
586 nmdc:mga08y16_195_c1
587 nmdc:mga08y16_20689_c1
588 nmdc:mga08y16_209_c1
589 nmdc:mga08y16_4564_c1
590 nmdc:mga0a205_102180_c1
591 Ga0501084_0152291
592 Ga0501082_0112982
593 2881928044
594 2919051726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

40

441

0.86

PF07690

MFS_1

Major Facilitator Superfamily

297

522

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.9138 36 494
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.9132 36 494
7d5p-assembly1.cif.gz_A structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.9113 35 494
7d5q-assembly2.cif.gz_B structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.9106 36 494
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.9095 36 494
ID Description Score Start End Superfamily
af_Q2FYJ5_15_251_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9629 36 273 1.20.1250.20
af_Q2G199_12_244_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9613 36 269 1.20.1250.20
af_Q2FYJ5_15_251_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9549 36 273 1.20.1250.20
af_Q2G199_12_244_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9533 36 269 1.20.1250.20
af_Q2G1P5_258_460_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9498 285 501 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A538CW67-F1-model_v4 MFS transporter 0.9127 34 217 GO:0016020
GO:0022857
AF-A0A502BLK1-F1-model_v4 Multidrug effflux MFS transporter 0.9041 31 207 GO:0005886
GO:0022857
GO:1990961
AF-F8L4R2-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8928 35 206 GO:0016020
GO:0022857
AF-A0A542W1V5-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8722 284 493 GO:0016020
GO:0022857
AF-A0A2T0UDC5-F1-model_v4 Putative MFS family arabinose efflux permease 0.8666 37 499 GO:0005886
GO:0022857

Map