F393604

General Info

Members Datasets Scaffolds Average Seq Length
297 176 594 463

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100101356|Ga0070684_1001013561
Length 491
Sequence MFDPKAAYRGTWAEYRRQGLVGAQVSVCEDGGVSHVVVVGGGPGGYEAALVAAQLGADVTVVDTDGIGGSAVLTDCVPSKTLIATAELMADMEEAKELGITFEGSLTTDLAQVNARVMRLAQAQSADIERRLTREGVRVVSGRGTLEGPEKVVVTPVDGGTEQTLEADAVLVATGAAPRTLESAQPDGERILTWEQVYDLDEVPSKLIVVGSGVTGAEFASAYNALGVDVTLVSSRDRVLPGEDADAAEVLEGVFTRRGMTVLSKSRMQSVTRSGDAVTVTLTDGRTVEGSHCLLALGSVPNTSGMGLEEAGVTLNGGGFVGVDRVSRTSARSVYAAGDCTGVLMLASVAAMQGRIAMWHFLGDAVAPLDLRSVSSNVFTAPEIATVGWSQKAVDAGEIEAECVTLPLSGNARAKMQGVRDGFVKLFARPGTGIVVGGVVVGPRASELIHPVAIAVSQNLTADQLAHAFTVYPSMSGSVAEAARRLHVFRT

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
169 2643221641 Nocardioides sp. Root122 Isolate Unclassified
170 2739367898 Nocardioides sp. CF479 Isolate Unclassified
171 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
172 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
173 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
174 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
175 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
176 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 0.67
Isolates 3.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.13
Nodule 0.34
Rhizoplane 8.42
Rhizosphere 75.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100101356 3300005535 Bacteria 2573
2 LJQas_1002424 3300000549 Bacteria 2596
3 JGI24738J21930_10008115 3300002075 Bacteria 2397
4 JGI24744J21845_10003006 3300002077 Bacteria 3457
5 Ga0070658_10062934 3300005327 Bacteria 3024
6 Ga0070658_10076162 3300005327 Bacteria 2752
7 Ga0070683_100004659 3300005329 Bacteria 11331
8 Ga0070683_100049192 3300005329 Bacteria 3899
9 Ga0070682_100017280 3300005337 Bacteria 4204
10 Ga0070682_100071003 3300005337 Bacteria 2227
11 Ga0070660_100044908 3300005339 Bacteria 3381
12 Ga0070660_100173172 3300005339 Bacteria 1744
13 Ga0070692_10006618 3300005345 Bacteria 5042
14 Ga0070674_100022506 3300005356 Bacteria 4066
15 Ga0070659_100056957 3300005366 Bacteria 3081
16 Ga0070714_100014955 3300005435 Bacteria 6239
17 Ga0070714_100073976 3300005435 Bacteria 2953
18 Ga0068867_100031851 3300005459 Bacteria 3810
19 Ga0070679_100002852 3300005530 Bacteria 15697
20 Ga0070684_100107036 3300005535 Bacteria 2504
21 Ga0070693_100025246 3300005547 Bacteria 3196
22 Ga0070665_100000523 3300005548 Bacteria 54648
23 Ga0068855_100058085 3300005563 Bacteria 4532
24 Ga0070664_100042621 3300005564 Bacteria 3831
25 Ga0068857_100004178 3300005577 Bacteria 12158
26 Ga0068852_100022107 3300005616 Bacteria 5093
27 Ga0068870_10003248 3300005840 Bacteria 6864
28 Ga0068860_100000286 3300005843 Bacteria 71981
29 Ga0081455_10000683 3300005937 Bacteria 44068
30 Ga0081538_10000079 3300005981 Bacteria 92419
31 Ga0081539_10087206 3300005985 Bacteria 1622
32 Ga0075365_10001832 3300006038 Bacteria 9954
33 Ga0075365_10005279 3300006038 Bacteria 6951
34 Ga0075368_10002400 3300006042 Bacteria 6104
35 Ga0075368_10003590 3300006042 Bacteria 5203
36 Ga0075368_10026152 3300006042 Bacteria 2244
37 Ga0075363_100000232 3300006048 Bacteria 15544
38 Ga0075363_100001920 3300006048 Bacteria 8237
39 Ga0075363_100002189 3300006048 Bacteria 7875
40 Ga0075363_100002335 3300006048 Bacteria 7712
41 Ga0075364_10003485 3300006051 Bacteria 8959
42 Ga0075364_10005693 3300006051 Bacteria 7265
43 Ga0075364_10006487 3300006051 Bacteria 6877
44 Ga0075364_10061071 3300006051 Bacteria 2471
45 Ga0075362_10005809 3300006177 Bacteria 4549
46 Ga0075367_10005910 3300006178 Bacteria 6138
47 Ga0075370_10000857 3300006353 Bacteria 12348
48 Ga0075370_10006480 3300006353 Bacteria 5892
49 Ga0075370_10023594 3300006353 Bacteria 3389
50 Ga0075428_100000616 3300006844 Bacteria 36391
51 Ga0075428_100008365 3300006844 Bacteria 11472
52 Ga0075430_100001867 3300006846 Bacteria 17230
53 Ga0075430_100022994 3300006846 Bacteria 5302
54 Ga0075431_100006821 3300006847 Bacteria 11342
55 Ga0075429_100030273 3300006880 Bacteria 4702
56 Ga0068865_100006555 3300006881 Bacteria 7114
57 Ga0068865_100106317 3300006881 Bacteria 2063
58 Ga0111539_10064098 3300009094 Bacteria 4349
59 Ga0105245_10009661 3300009098 Bacteria 8412
60 Ga0105245_10011262 3300009098 Bacteria 7787
61 Ga0114129_10033042 3300009147 Bacteria 7311
62 Ga0105243_10005950 3300009148 Bacteria 9448
63 Ga0105243_10112674 3300009148 Bacteria 2279
64 Ga0105243_10119303 3300009148 Bacteria 2221
65 Ga0105243_10192767 3300009148 Bacteria 1781
66 Ga0105248_10031212 3300009177 Bacteria 5955
67 Ga0105248_10087070 3300009177 Bacteria 3515
68 Ga0105237_10119260 3300009545 Bacteria 2632
69 Ga0105249_10062268 3300009553 Bacteria 3425
70 Ga0105249_10088316 3300009553 Bacteria 2895
71 Ga0105239_10035368 3300010375 Bacteria 5485
72 Ga0105246_10002002 3300011119 Bacteria 12302
73 Ga0157369_10268818 3300013105 Bacteria 1777
74 Ga0157372_10037039 3300013307 Bacteria 5378
75 Ga0157375_10087243 3300013308 Bacteria 3172
76 Ga0157375_10118308 3300013308 Bacteria 2756
77 Ga0157380_10002869 3300014326 Bacteria 11702
78 Ga0157380_10067381 3300014326 Bacteria 2882
79 Ga0206354_11171817 3300020081 Bacteria 2679
80 Ga0213876_10024714 3300021384 Bacteria 3171
81 Ga0207642_10065602 3300025899 Bacteria 1706
82 Ga0207688_10024975 3300025901 Bacteria 3279
83 Ga0207643_10001251 3300025908 Bacteria 14931
84 Ga0207705_10050789 3300025909 Bacteria 2986
85 Ga0207671_10095404 3300025914 Bacteria 2246
86 Ga0207660_10057196 3300025917 Bacteria 2793
87 Ga0207657_10016912 3300025919 Bacteria 7018
88 Ga0207657_10190551 3300025919 Bacteria 1654
89 Ga0207652_10028715 3300025921 Bacteria 4644
90 Ga0207664_10060460 3300025929 Bacteria 3019
91 Ga0207690_10098740 3300025932 Bacteria 2080
92 Ga0207706_10041514 3300025933 Bacteria 4078
93 Ga0207704_10041475 3300025938 Bacteria 2700
94 Ga0207661_10010333 3300025944 Bacteria 6716
95 Ga0207661_10085762 3300025944 Bacteria 2611
96 Ga0207679_10067619 3300025945 Bacteria 2681
97 Ga0207667_10070713 3300025949 Bacteria 3632
98 Ga0207651_10130162 3300025960 Bacteria 1925
99 Ga0207668_10197918 3300025972 Bacteria 1598
100 Ga0207640_10035392 3300025981 Bacteria 3125
101 Ga0207677_10142979 3300026023 Bacteria 1834
102 Ga0207639_10199641 3300026041 Bacteria 1714
103 Ga0207678_10025211 3300026067 Bacteria 5191
104 Ga0207678_10145235 3300026067 Bacteria 2025
105 Ga0207708_10000897 3300026075 Bacteria 22343
106 Ga0207648_10001889 3300026089 Bacteria 22892
107 Ga0207674_10004262 3300026116 Bacteria 17251
108 Ga0207675_100035843 3300026118 Bacteria 4628
109 Ga0207675_100098289 3300026118 Bacteria 2756
110 Ga0209813_10001140 3300027866 Bacteria 5927
111 Ga0209813_10002187 3300027866 Bacteria 4461
112 Ga0209974_10003552 3300027876 Bacteria 5610
113 Ga0207428_10015836 3300027907 Bacteria 6507
114 Ga0268266_10067459 3300028379 Bacteria 3096
115 Ga0268264_10000246 3300028381 Bacteria 102361
116 Ga0265338_10082960 3300028800 Bacteria 2682
117 Ga0265340_10007101 3300031247 Bacteria 6105
118 Ga0316575_10026189 3300031665 Bacteria 2265
119 Ga0316576_10006501 3300031727 Bacteria 7284
120 Ga0316576_10013319 3300031727 Bacteria 5460
121 Ga0316576_10040842 3300031727 Bacteria 3336
122 Ga0316578_10032433 3300031728 Bacteria 2985
123 Ga0316578_10100737 3300031728 Bacteria 1732
124 Ga0316578_10109997 3300031728 Bacteria 1654
125 Ga0307407_10016322 3300031903 Bacteria 3695
126 Ga0307409_100043930 3300031995 Bacteria 3361
127 Ga0307409_100167283 3300031995 Bacteria 1931
128 Ga0307409_100242947 3300031995 Bacteria 1640
129 Ga0307416_100171621 3300032002 Bacteria 2020
130 Ga0307411_10032073 3300032005 Bacteria 3242
131 Ga0307415_100024263 3300032126 Bacteria 3783
132 Ga0307415_100045432 3300032126 Bacteria 2944
133 Ga0316580_10009528 3300032139 Bacteria 2920
134 Ga0316574_0039859 3300035398 Bacteria 2891
135 Ga0316584_0026738 3300036712 Bacteria 4243
136 Ga0395900_0199755 3300037418 Bacteria 2024
137 Ga0395898_0036082 3300037466 Bacteria 4911
138 Ga0436365_0360095 3300039437 Bacteria 22496
139 Ga0436365_0790634 3300039437 Bacteria 1639
140 Ga0466969_0032610 3300044656 Bacteria 2648
141 Ga0466972_0030784 3300044658 Bacteria 2641
142 Ga0466965_0010268 3300044683 Bacteria 4362
143 Ga0466965_0018437 3300044683 Bacteria 3345
144 Ga0466966_0007512 3300044684 Bacteria 7219
145 Ga0466966_0030353 3300044684 Bacteria 3510
146 Ga0466961_0003882 3300044693 Bacteria 9340
147 Ga0466961_0013378 3300044693 Bacteria 5252
148 Ga0466961_0039477 3300044693 Bacteria 3026
149 Ga0466961_0048311 3300044693 Bacteria 2720
150 Ga0466961_0100816 3300044693 Bacteria 1819
151 Ga0466963_0011067 3300044694 Bacteria 5486
152 Ga0466963_0056981 3300044694 Bacteria 2601
153 Ga0466964_0008537 3300044706 Bacteria 3850
154 Ga0466964_0008808 3300044706 Bacteria 3794
155 Ga0466971_0011960 3300044719 Bacteria 3803
156 Ga0466971_0018111 3300044719 Bacteria 3119
157 Ga0466970_0026360 3300044765 Bacteria 3046
158 Ga0466970_0035628 3300044765 Bacteria 2636
159 Ga0466970_0076656 3300044765 Bacteria 1802
160 Ga0466970_0098981 3300044765 Bacteria 1587
161 Ga0466957_0032265 3300044842 Bacteria 3135
162 Ga0466960_0004794 3300044901 Bacteria 5315
163 Ga0466960_0013960 3300044901 Bacteria 3424
164 Ga0466960_0014266 3300044901 Bacteria 3397
165 Ga0466960_0015616 3300044901 Bacteria 3277
166 Ga0466960_0034615 3300044901 Bacteria 2355
167 Ga0466960_0060294 3300044901 Bacteria 1859
168 Ga0466958_0101276 3300045836 Bacteria 1791
169 Ga0466967_0012765 3300045976 Bacteria 6452
170 Ga0466967_0021610 3300045976 Bacteria 5231
171 Ga0466967_0062842 3300045976 Bacteria 3297
172 Ga0466967_0065365 3300045976 Bacteria 3237
173 Ga0466967_0105260 3300045976 Bacteria 2584
174 Ga0466967_0206631 3300045976 Bacteria 1861
175 Ga0495603_0043547 3300046455 Bacteria 2680
176 Ga0496102_0022686 3300048905 Bacteria 5562
177 Ga0496102_0028334 3300048905 Bacteria 5001
178 Ga0496104_0013420 3300048907 Bacteria 7381
179 Ga0496104_0235531 3300048907 Bacteria 1743
180 Ga0496105_0001578 3300048908 Bacteria 16154
181 Ga0496108_0037949 3300048911 Bacteria 4014
182 Ga0496108_0041464 3300048911 Bacteria 3843
183 Ga0496108_0141809 3300048911 Bacteria 2070
184 Ga0496109_0011598 3300048912 Bacteria 7580
185 Ga0496109_0017180 3300048912 Bacteria 6336
186 Ga0496109_0036078 3300048912 Bacteria 4463
187 Ga0496109_0174204 3300048912 Bacteria 2019
188 Ga0496109_0284779 3300048912 Bacteria 1558
189 Ga0496110_0021203 3300048913 Bacteria 5496
190 Ga0496110_0034953 3300048913 Bacteria 4357
191 Ga0496110_0048299 3300048913 Bacteria 3731
192 Ga0496110_0134615 3300048913 Bacteria 2233
193 Ga0496111_0018342 3300048914 Bacteria 4847
194 Ga0496111_0102019 3300048914 Bacteria 2109
195 Ga0496114_0006217 3300048917 Bacteria 9403
196 Ga0496114_0008370 3300048917 Bacteria 8191
197 Ga0496114_0015123 3300048917 Bacteria 6205
198 Ga0496114_0021216 3300048917 Bacteria 5283
199 Ga0496114_0062114 3300048917 Bacteria 3126
200 Ga0496115_0150253 3300048918 Bacteria 1923
201 Ga0501310_000673 3300049130 Bacteria 3013
202 Ga0501031_0011287 3300049568 Bacteria 5820
203 Ga0501031_0151255 3300049568 Bacteria 1517
204 Ga0501034_0014964 3300049571 Bacteria 7980
205 Ga0501034_0016907 3300049571 Bacteria 7479
206 Ga0501036_0032791 3300049572 Bacteria 4391
207 Ga0501036_0086432 3300049572 Bacteria 2651
208 Ga0501036_0091617 3300049572 Bacteria 2568
209 Ga0501036_0094729 3300049572 Bacteria 2524
210 Ga0501040_0044514 3300049576 Bacteria 3025
211 Ga0501040_0087298 3300049576 Bacteria 2166
212 Ga0501042_0009615 3300049578 Bacteria 6454
213 Ga0501046_0081112 3300049580 Bacteria 2506
214 Ga0501047_0133085 3300049581 Bacteria 2367
215 Ga0501047_0206828 3300049581 Bacteria 1822
216 Ga0501048_0004329 3300049582 Bacteria 10814
217 Ga0501048_0055559 3300049582 Bacteria 2810
218 Ga0501067_0000245 3300049583 Bacteria 29979
219 Ga0501067_0002435 3300049583 Bacteria 10285
220 Ga0501067_0003519 3300049583 Bacteria 8616
221 Ga0501068_0008583 3300049584 Bacteria 5692
222 Ga0501068_0049951 3300049584 Bacteria 2527
223 Ga0501068_0095467 3300049584 Bacteria 1839
224 Ga0501068_0115360 3300049584 Bacteria 1672
225 Ga0501069_0004825 3300049585 Bacteria 6983
226 Ga0501069_0067169 3300049585 Bacteria 2005
227 Ga0501069_0127717 3300049585 Bacteria 1455
228 Ga0501070_0003872 3300049586 Bacteria 12908
229 Ga0501070_0024797 3300049586 Bacteria 5030
230 Ga0501070_0095166 3300049586 Bacteria 2464
231 Ga0501071_0043563 3300049587 Bacteria 3218
232 Ga0501071_0064554 3300049587 Bacteria 2656
233 Ga0501071_0066280 3300049587 Bacteria 2624
234 Ga0501072_0047146 3300049588 Bacteria 3393
235 Ga0501072_0070483 3300049588 Bacteria 2761
236 Ga0501073_0002270 3300049589 Bacteria 14380
237 Ga0501073_0015446 3300049589 Bacteria 5538
238 Ga0501074_0001662 3300049590 Bacteria 15116
239 Ga0501074_0009264 3300049590 Bacteria 7152
240 Ga0501074_0090194 3300049590 Bacteria 2195
241 Ga0501075_0019594 3300049591 Bacteria 4911
242 Ga0501076_0042032 3300049592 Bacteria 3599
243 Ga0501077_0125148 3300049593 Bacteria 1629
244 Ga0501079_0016256 3300049741 Bacteria 5687
245 Ga0501080_0021635 3300049742 Bacteria 5954
246 Ga0501080_0150361 3300049742 Bacteria 2152
247 Ga0501081_0245020 3300049743 Bacteria 1307
248 Ga0501035_0139575 3300049822 Bacteria 2108
249 Ga0501044_0089541 3300049823 Bacteria 3106
250 Ga0501045_0054119 3300049824 Bacteria 2934
251 Ga0501045_0159554 3300049824 Bacteria 1678
252 nmdc:mga03683_24283_c1 3300050489 Bacteria 2370
253 nmdc:mga03n38_1417_c1 3300050490 Bacteria 6847
254 nmdc:mga03n38_40108_c1 3300050490 Bacteria 2034
255 nmdc:mga03n38_6958_c1 3300050490 Bacteria 3972
256 nmdc:mga00v17_1959_c2 3300050491 Bacteria 9674
257 nmdc:mga00v17_30815_c1 3300050491 Bacteria 3158
258 nmdc:mga00v17_51972_c1 3300050491 Bacteria 2492
259 nmdc:mga0yw44_3511_c1 3300050492 Bacteria 6981
260 nmdc:mga0yw44_35209_c1 3300050492 Bacteria 2940
261 nmdc:mga0yw44_36598_c1 3300050492 Bacteria 2893
262 nmdc:mga0yw44_73668_c1 3300050492 Bacteria 2125
263 nmdc:mga0yw44_92265_c1 3300050492 Bacteria 1916
264 nmdc:mga06z11_6854_c1 3300050494 Bacteria 4658
265 nmdc:mga04h51_4526_c1 3300050495 Bacteria 3469
266 nmdc:mga04h51_858_c1 3300050495 Bacteria 7017
267 nmdc:mga07m45_2764_c1 3300050496 Bacteria 8281
268 nmdc:mga07m45_4020_c1 3300050496 Bacteria 6300
269 nmdc:mga05p37_182187_c1 3300050507 Bacteria 2555
270 nmdc:mga05p37_2661_c1 3300050507 Bacteria 20811
271 nmdc:mga09592_22375_c1 3300050508 Bacteria 5216
272 nmdc:mga09592_3903_c1 3300050508 Bacteria 5135
273 nmdc:mga0qj67_61246_c1 3300050509 Bacteria 2988
274 nmdc:mga06r32_288_c1 3300050510 Bacteria 41844
275 nmdc:mga06r32_29669_c1 3300050510 Bacteria 5129
276 nmdc:mga08y16_177824_c1 3300050511 Bacteria 2210
277 nmdc:mga0a205_213176_c1 3300050515 Bacteria 1819
278 Ga0500644_0000400 3300053088 Bacteria 20643
279 Ga0500556_0001648 3300053104 Bacteria 8695
280 Ga0501084_0005674 3300054114 Bacteria 10246
281 Ga0501084_0052257 3300054114 Bacteria 3420
282 Ga0501084_0161319 3300054114 Bacteria 1891
283 Ga0590075_004161 3300059424 Bacteria 3423
284 Ga0501082_0001727 3300060353 Bacteria 19282
285 Ga0501082_0084254 3300060353 Bacteria 2742
286 Ga0466962_0012824 3300061719 Bacteria 4032
287 Ga0530510_0040156 3300061734 Bacteria 3377
288 Ga0530510_0040363 3300061734 Bacteria 3368
289 2515856673 2515154155 Bacteria 7985436
290 2644231586 2643221641 Bacteria 4490190
291 2740167305 2739367898 Bacteria 4367674
292 2812334137 2811994874 Bacteria 5367947
293 2816423714 2816332119 Bacteria 8120218
294 2837269201 2837268691 Bacteria 7850704
295 2855390802 2855386786 Bacteria 4752232
296 2868092764 2868088558 Bacteria 7609351
297 8054613983 8054609563 Bacteria 5170090
298 Ga0070684_100101356
299 LJQas_1002424
300 JGI24738J21930_10008115
301 JGI24744J21845_10003006
302 Ga0070658_10062934
303 Ga0070658_10076162
304 Ga0070683_100004659
305 Ga0070683_100049192
306 Ga0070682_100017280
307 Ga0070682_100071003
308 Ga0070660_100044908
309 Ga0070660_100173172
310 Ga0070692_10006618
311 Ga0070674_100022506
312 Ga0070659_100056957
313 Ga0070714_100014955
314 Ga0070714_100073976
315 Ga0068867_100031851
316 Ga0070679_100002852
317 Ga0070684_100107036
318 Ga0070693_100025246
319 Ga0070665_100000523
320 Ga0068855_100058085
321 Ga0070664_100042621
322 Ga0068857_100004178
323 Ga0068852_100022107
324 Ga0068870_10003248
325 Ga0068860_100000286
326 Ga0081455_10000683
327 Ga0081538_10000079
328 Ga0081539_10087206
329 Ga0075365_10001832
330 Ga0075365_10005279
331 Ga0075368_10002400
332 Ga0075368_10003590
333 Ga0075368_10026152
334 Ga0075363_100000232
335 Ga0075363_100001920
336 Ga0075363_100002189
337 Ga0075363_100002335
338 Ga0075364_10003485
339 Ga0075364_10005693
340 Ga0075364_10006487
341 Ga0075364_10061071
342 Ga0075362_10005809
343 Ga0075367_10005910
344 Ga0075370_10000857
345 Ga0075370_10006480
346 Ga0075370_10023594
347 Ga0075428_100000616
348 Ga0075428_100008365
349 Ga0075430_100001867
350 Ga0075430_100022994
351 Ga0075431_100006821
352 Ga0075429_100030273
353 Ga0068865_100006555
354 Ga0068865_100106317
355 Ga0111539_10064098
356 Ga0105245_10009661
357 Ga0105245_10011262
358 Ga0114129_10033042
359 Ga0105243_10005950
360 Ga0105243_10112674
361 Ga0105243_10119303
362 Ga0105243_10192767
363 Ga0105248_10031212
364 Ga0105248_10087070
365 Ga0105237_10119260
366 Ga0105249_10062268
367 Ga0105249_10088316
368 Ga0105239_10035368
369 Ga0105246_10002002
370 Ga0157369_10268818
371 Ga0157372_10037039
372 Ga0157375_10087243
373 Ga0157375_10118308
374 Ga0157380_10002869
375 Ga0157380_10067381
376 Ga0206354_11171817
377 Ga0213876_10024714
378 Ga0207642_10065602
379 Ga0207688_10024975
380 Ga0207643_10001251
381 Ga0207705_10050789
382 Ga0207671_10095404
383 Ga0207660_10057196
384 Ga0207657_10016912
385 Ga0207657_10190551
386 Ga0207652_10028715
387 Ga0207664_10060460
388 Ga0207690_10098740
389 Ga0207706_10041514
390 Ga0207704_10041475
391 Ga0207661_10010333
392 Ga0207661_10085762
393 Ga0207679_10067619
394 Ga0207667_10070713
395 Ga0207651_10130162
396 Ga0207668_10197918
397 Ga0207640_10035392
398 Ga0207677_10142979
399 Ga0207639_10199641
400 Ga0207678_10025211
401 Ga0207678_10145235
402 Ga0207708_10000897
403 Ga0207648_10001889
404 Ga0207674_10004262
405 Ga0207675_100035843
406 Ga0207675_100098289
407 Ga0209813_10001140
408 Ga0209813_10002187
409 Ga0209974_10003552
410 Ga0207428_10015836
411 Ga0268266_10067459
412 Ga0268264_10000246
413 Ga0265338_10082960
414 Ga0265340_10007101
415 Ga0316575_10026189
416 Ga0316576_10006501
417 Ga0316576_10013319
418 Ga0316576_10040842
419 Ga0316578_10032433
420 Ga0316578_10100737
421 Ga0316578_10109997
422 Ga0307407_10016322
423 Ga0307409_100043930
424 Ga0307409_100167283
425 Ga0307409_100242947
426 Ga0307416_100171621
427 Ga0307411_10032073
428 Ga0307415_100024263
429 Ga0307415_100045432
430 Ga0316580_10009528
431 Ga0316574_0039859
432 Ga0316584_0026738
433 Ga0395900_0199755
434 Ga0395898_0036082
435 Ga0436365_0360095
436 Ga0436365_0790634
437 Ga0466969_0032610
438 Ga0466972_0030784
439 Ga0466965_0010268
440 Ga0466965_0018437
441 Ga0466966_0007512
442 Ga0466966_0030353
443 Ga0466961_0003882
444 Ga0466961_0013378
445 Ga0466961_0039477
446 Ga0466961_0048311
447 Ga0466961_0100816
448 Ga0466963_0011067
449 Ga0466963_0056981
450 Ga0466964_0008537
451 Ga0466964_0008808
452 Ga0466971_0011960
453 Ga0466971_0018111
454 Ga0466970_0026360
455 Ga0466970_0035628
456 Ga0466970_0076656
457 Ga0466970_0098981
458 Ga0466957_0032265
459 Ga0466960_0004794
460 Ga0466960_0013960
461 Ga0466960_0014266
462 Ga0466960_0015616
463 Ga0466960_0034615
464 Ga0466960_0060294
465 Ga0466958_0101276
466 Ga0466967_0012765
467 Ga0466967_0021610
468 Ga0466967_0062842
469 Ga0466967_0065365
470 Ga0466967_0105260
471 Ga0466967_0206631
472 Ga0495603_0043547
473 Ga0496102_0022686
474 Ga0496102_0028334
475 Ga0496104_0013420
476 Ga0496104_0235531
477 Ga0496105_0001578
478 Ga0496108_0037949
479 Ga0496108_0041464
480 Ga0496108_0141809
481 Ga0496109_0011598
482 Ga0496109_0017180
483 Ga0496109_0036078
484 Ga0496109_0174204
485 Ga0496109_0284779
486 Ga0496110_0021203
487 Ga0496110_0034953
488 Ga0496110_0048299
489 Ga0496110_0134615
490 Ga0496111_0018342
491 Ga0496111_0102019
492 Ga0496114_0006217
493 Ga0496114_0008370
494 Ga0496114_0015123
495 Ga0496114_0021216
496 Ga0496114_0062114
497 Ga0496115_0150253
498 Ga0501310_000673
499 Ga0501031_0011287
500 Ga0501031_0151255
501 Ga0501034_0014964
502 Ga0501034_0016907
503 Ga0501036_0032791
504 Ga0501036_0086432
505 Ga0501036_0091617
506 Ga0501036_0094729
507 Ga0501040_0044514
508 Ga0501040_0087298
509 Ga0501042_0009615
510 Ga0501046_0081112
511 Ga0501047_0133085
512 Ga0501047_0206828
513 Ga0501048_0004329
514 Ga0501048_0055559
515 Ga0501067_0000245
516 Ga0501067_0002435
517 Ga0501067_0003519
518 Ga0501068_0008583
519 Ga0501068_0049951
520 Ga0501068_0095467
521 Ga0501068_0115360
522 Ga0501069_0004825
523 Ga0501069_0067169
524 Ga0501069_0127717
525 Ga0501070_0003872
526 Ga0501070_0024797
527 Ga0501070_0095166
528 Ga0501071_0043563
529 Ga0501071_0064554
530 Ga0501071_0066280
531 Ga0501072_0047146
532 Ga0501072_0070483
533 Ga0501073_0002270
534 Ga0501073_0015446
535 Ga0501074_0001662
536 Ga0501074_0009264
537 Ga0501074_0090194
538 Ga0501075_0019594
539 Ga0501076_0042032
540 Ga0501077_0125148
541 Ga0501079_0016256
542 Ga0501080_0021635
543 Ga0501080_0150361
544 Ga0501081_0245020
545 Ga0501035_0139575
546 Ga0501044_0089541
547 Ga0501045_0054119
548 Ga0501045_0159554
549 nmdc:mga03683_24283_c1
550 nmdc:mga03n38_1417_c1
551 nmdc:mga03n38_40108_c1
552 nmdc:mga03n38_6958_c1
553 nmdc:mga00v17_1959_c2
554 nmdc:mga00v17_30815_c1
555 nmdc:mga00v17_51972_c1
556 nmdc:mga0yw44_3511_c1
557 nmdc:mga0yw44_35209_c1
558 nmdc:mga0yw44_36598_c1
559 nmdc:mga0yw44_73668_c1
560 nmdc:mga0yw44_92265_c1
561 nmdc:mga06z11_6854_c1
562 nmdc:mga04h51_4526_c1
563 nmdc:mga04h51_858_c1
564 nmdc:mga07m45_2764_c1
565 nmdc:mga07m45_4020_c1
566 nmdc:mga05p37_182187_c1
567 nmdc:mga05p37_2661_c1
568 nmdc:mga09592_22375_c1
569 nmdc:mga09592_3903_c1
570 nmdc:mga0qj67_61246_c1
571 nmdc:mga06r32_288_c1
572 nmdc:mga06r32_29669_c1
573 nmdc:mga08y16_177824_c1
574 nmdc:mga0a205_213176_c1
575 Ga0500644_0000400
576 Ga0500556_0001648
577 Ga0501084_0005674
578 Ga0501084_0052257
579 Ga0501084_0161319
580 Ga0590075_004161
581 Ga0501082_0001727
582 Ga0501082_0084254
583 Ga0466962_0012824
584 Ga0530510_0040156
585 Ga0530510_0040363
586 2515856673
587 2644231586
588 2740167305
589 2812334137
590 2816423714
591 2837269201
592 2855390802
593 2868092764
594 8054613983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02852

Pyr_redox_dim

Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain

374

483

0.97

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

206

285

0.96

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

35

66

0.95

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

34

354

0.95

PF01134

GIDA

Glucose inhibited division protein A

35

191

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e21-assembly1.cif.gz_B-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9439 3 31
1xdi-assembly1.cif.gz_A crystal structure of lpda (rv3303c) from mycobacterium tuberculosis 0.9231 1 460
3ax6-assembly2.cif.gz_D crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima 0.9183 1 31
1xdi-assembly1.cif.gz_A crystal structure of lpda (rv3303c) from mycobacterium tuberculosis 0.9173 1 460
3ax6-assembly2.cif.gz_C crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima 0.9149 1 31
ID Description Score Start End Superfamily
1xdiB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9678 153 271 3.50.50.60
af_P27306_158_276_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9661 164 277 3.50.50.60
2vq3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9651 3 29 3.40.50.720
1xdiB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.96 153 271 3.50.50.60
af_Q2FZH1_2_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9593 179 211 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6B3HP13-F1-model_v4 FAD-dependent oxidoreductase 0.9697 114 275 GO:0003955
GO:0050660
AF-A0A0K8Q969-F1-model_v4 NAD(P)H dehydrogenase (Quinone) 0.9592 123 461 GO:0003955
GO:0050660
AF-A0A6J4KCA3-F1-model_v4 Dihydrolipoamide dehydrogenase (EC 1.8.1.4) 0.9592 121 457 GO:0003955
GO:0004148
GO:0050660
AF-A0A535E2J9-F1-model_v4 Dihydrolipoyl dehydrogenase (EC 1.8.1.4) 0.9559 107 461 GO:0004148
GO:0006090
GO:0006103
GO:0050660
AF-A0A7Y2BHX9-F1-model_v4 Dihydrolipoyl dehydrogenase (EC 1.8.1.4) 0.9502 83 461 GO:0004148
GO:0006090
GO:0006103
GO:0050660

Map