F393481

General Info

Members Datasets Scaffolds Average Seq Length
296 177 592 110

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2984576629|2984577585
Length 136
Sequence CFQLQVRPDRLEEYAERHAAVWPAMLEALRDAGWRNYSLFLRPDGLLIGYVEVDGTLAEAQAAMAATEVNARWQAEMGAFFVDLEGAAPDTGFVRLDEVFHLEDQLAAADLPVSTPADTPAAPTDPTTRRTEGEPA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
131 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
165 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
166 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
167 2739367898 Nocardioides sp. CF479 Isolate Unclassified
168 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
169 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
170 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
171 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
172 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
173 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
174 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
175 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
176 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
177 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.89
Metatranscriptomes 3.38
Isolates 4.73

Biome Distribution

Category Percentage (%)
Aerial Root 1.01
Bulb 0
Endosphere 0
Nodule 0.34
Rhizoplane 6.76
Rhizosphere 81.42
Stem 0
Stem Tuber 0
Unclassified 9.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10010997 3300005327 Bacteria 7254
2 Ga0070658_10362269 3300005327 Bacteria 1242
3 Ga0070683_100036404 3300005329 Bacteria 4503
4 Ga0070683_100324646 3300005329 Bacteria 1465
5 Ga0070690_101287171 3300005330 Bacteria 585
6 Ga0070670_100645989 3300005331 Bacteria 949
7 Ga0070680_100076833 3300005336 Bacteria 2749
8 Ga0070682_100080440 3300005337 Bacteria 2107
9 Ga0070682_100239210 3300005337 Unclassified 1302
10 Ga0068868_100178906 3300005338 Bacteria 1759
11 Ga0070660_100137959 3300005339 Bacteria 1955
12 Ga0070691_10396402 3300005341 Bacteria 777
13 Ga0070661_100147230 3300005344 Bacteria 1778
14 Ga0070661_100822238 3300005344 Unclassified 763
15 Ga0070692_10053646 3300005345 Bacteria 2103
16 Ga0070692_10097979 3300005345 Bacteria 1603
17 Ga0070671_100125576 3300005355 Bacteria 2160
18 Ga0070671_100813462 3300005355 Bacteria 814
19 Ga0070659_100163246 3300005366 Unclassified 1822
20 Ga0070659_100581145 3300005366 Bacteria 961
21 Ga0070659_100736908 3300005366 Bacteria 854
22 Ga0070667_100178907 3300005367 Bacteria 1875
23 Ga0070667_100319543 3300005367 Bacteria 1401
24 Ga0070709_10499168 3300005434 Bacteria 924
25 Ga0070714_100593526 3300005435 Bacteria 1063
26 Ga0070714_101392704 3300005435 Bacteria 685
27 Ga0070713_100045679 3300005436 Bacteria 3591
28 Ga0070713_100305765 3300005436 Unclassified 1465
29 Ga0070713_101642227 3300005436 Bacteria 624
30 Ga0070713_102433849 3300005436 Unclassified 506
31 Ga0070710_10865026 3300005437 Bacteria 650
32 Ga0070705_100794384 3300005440 Bacteria 752
33 Ga0070663_100316047 3300005455 Bacteria 1254
34 Ga0070678_100178822 3300005456 Bacteria 1734
35 Ga0070678_100252513 3300005456 Unclassified 1479
36 Ga0070678_100759934 3300005456 Bacteria 877
37 Ga0070662_100301491 3300005457 Bacteria 1302
38 Ga0070662_100594350 3300005457 Bacteria 930
39 Ga0070681_10172522 3300005458 Bacteria 2084
40 Ga0068867_100764180 3300005459 Bacteria 859
41 Ga0070685_10167499 3300005466 Bacteria 1406
42 Ga0070679_100018020 3300005530 Bacteria 6844
43 Ga0070679_100166977 3300005530 Bacteria 2174
44 Ga0070684_100008335 3300005535 Bacteria 8095
45 Ga0070684_100693091 3300005535 Bacteria 949
46 Ga0068853_100006810 3300005539 Bacteria 9111
47 Ga0068853_102207433 3300005539 Unclassified 534
48 Ga0070672_100923469 3300005543 Bacteria 772
49 Ga0070665_100278137 3300005548 Bacteria 1675
50 Ga0070665_101952594 3300005548 Unclassified 592
51 Ga0068855_100040228 3300005563 Bacteria 5549
52 Ga0068855_100213406 3300005563 Bacteria 2168
53 Ga0068855_100473812 3300005563 Bacteria 1363
54 Ga0068855_102273614 3300005563 Bacteria 543
55 Ga0070664_100082218 3300005564 Bacteria 2777
56 Ga0070664_100118036 3300005564 Bacteria 2321
57 Ga0070664_100259042 3300005564 Bacteria 1565
58 Ga0070664_101150669 3300005564 Bacteria 731
59 Ga0068857_100201462 3300005577 Bacteria 1814
60 Ga0068857_100363055 3300005577 Bacteria 1342
61 Ga0068857_100512780 3300005577 Bacteria 1126
62 Ga0068854_101616148 3300005578 Bacteria 591
63 Ga0068856_100039950 3300005614 Bacteria 4607
64 Ga0068856_100074993 3300005614 Bacteria 3350
65 Ga0068856_101299665 3300005614 Bacteria 743
66 Ga0068856_101539453 3300005614 Bacteria 678
67 Ga0068856_101893413 3300005614 Bacteria 607
68 Ga0068852_100129470 3300005616 Bacteria 2322
69 Ga0068859_100435422 3300005617 Bacteria 1407
70 Ga0068864_100364949 3300005618 Bacteria 1365
71 Ga0068870_10127176 3300005840 Bacteria 1476
72 Ga0068863_101702863 3300005841 Bacteria 640
73 Ga0068860_101736675 3300005843 Bacteria 646
74 Ga0081455_10006940 3300005937 Bacteria 12041
75 Ga0070717_10049880 3300006028 Bacteria 3438
76 Ga0097621_100854363 3300006237 Bacteria 845
77 Ga0068871_100096232 3300006358 Unclassified 2473
78 Ga0068871_100851380 3300006358 Bacteria 843
79 Ga0075428_100589317 3300006844 Bacteria 1188
80 Ga0075428_100973710 3300006844 Bacteria 898
81 Ga0075430_100631508 3300006846 Bacteria 883
82 Ga0075431_100639631 3300006847 Bacteria 1045
83 Ga0075431_100850695 3300006847 Bacteria 883
84 Ga0075429_100067619 3300006880 Bacteria 3109
85 Ga0075429_100684660 3300006880 Bacteria 898
86 Ga0097620_100435446 3300006931 Bacteria 1407
87 Ga0075435_101897293 3300007076 Bacteria 523
88 Ga0105251_10201709 3300009011 Bacteria 896
89 Ga0111539_10690162 3300009094 Bacteria 1188
90 Ga0105245_10369221 3300009098 Bacteria 1426
91 Ga0114129_10004167 3300009147 Bacteria 20426
92 Ga0114129_10006376 3300009147 Bacteria 16728
93 Ga0105243_10545897 3300009148 Bacteria 1106
94 Ga0105241_10091996 3300009174 Unclassified 2394
95 Ga0105241_10496998 3300009174 Bacteria 1087
96 Ga0105241_11149047 3300009174 Bacteria 733
97 Ga0105237_10541532 3300009545 Bacteria 1171
98 Ga0105237_10638216 3300009545 Bacteria 1072
99 Ga0105238_10501117 3300009551 Bacteria 1215
100 Ga0105238_11443708 3300009551 Bacteria 716
101 Ga0105028_116240 3300009993 Bacteria 796
102 Ga0105239_10108512 3300010375 Bacteria 3075
103 Ga0105239_10292181 3300010375 Bacteria 1835
104 Ga0105239_10428778 3300010375 Bacteria 1499
105 Ga0105239_10639469 3300010375 Unclassified 1215
106 Ga0157373_10173160 3300013100 Unclassified 1519
107 Ga0157373_10240099 3300013100 Bacteria 1281
108 Ga0157373_10630521 3300013100 Unclassified 782
109 Ga0157371_10590961 3300013102 Bacteria 825
110 Ga0157371_10722146 3300013102 Bacteria 747
111 Ga0157371_11094445 3300013102 Bacteria 611
112 Ga0157370_10220182 3300013104 Bacteria 1758
113 Ga0157370_10446390 3300013104 Unclassified 1189
114 Ga0157370_11015539 3300013104 Unclassified 751
115 Ga0157370_11046308 3300013104 Bacteria 738
116 Ga0157370_11495017 3300013104 Bacteria 607
117 Ga0157369_10001792 3300013105 Bacteria 25986
118 Ga0157369_10009812 3300013105 Bacteria 10953
119 Ga0157369_10048333 3300013105 Bacteria 4617
120 Ga0157369_10512660 3300013105 Bacteria 1241
121 Ga0157374_10011500 3300013296 Bacteria 7668
122 Ga0157374_10014173 3300013296 Bacteria 6970
123 Ga0157374_10603234 3300013296 Bacteria 1108
124 Ga0163162_11613094 3300013306 Bacteria 740
125 Ga0157372_10126127 3300013307 Bacteria 2943
126 Ga0157372_10253679 3300013307 Bacteria 2042
127 Ga0157372_10260739 3300013307 Unclassified 2013
128 Ga0157372_10317499 3300013307 Unclassified 1814
129 Ga0157372_10428565 3300013307 Bacteria 1542
130 Ga0157372_10469557 3300013307 Bacteria 1467
131 Ga0157375_10638481 3300013308 Bacteria 1222
132 Ga0163163_10400370 3300014325 Bacteria 1431
133 Ga0163163_11691021 3300014325 Bacteria 693
134 Ga0157379_10382333 3300014968 Bacteria 1292
135 Ga0157376_10948478 3300014969 Bacteria 881
136 Ga0157376_11246364 3300014969 Bacteria 773
137 Ga0206356_10789141 3300020070 Bacteria 2252
138 Ga0206349_1066511 3300020075 Bacteria 850
139 Ga0206352_10091538 3300020078 Bacteria 1458
140 Ga0206350_11092091 3300020080 Bacteria 680
141 Ga0206354_10423410 3300020081 Bacteria 1918
142 Ga0206353_10220224 3300020082 Bacteria 991
143 Ga0206353_11341907 3300020082 Bacteria 2105
144 Ga0213872_10211229 3300021361 Unclassified 829
145 Ga0213876_10061126 3300021384 Bacteria 1988
146 Ga0213875_10083018 3300021388 Bacteria 1495
147 Ga0213875_10203117 3300021388 Unclassified 932
148 Ga0224712_10158454 3300022467 Bacteria 1008
149 Ga0224712_10642878 3300022467 Bacteria 520
150 Ga0224712_10658327 3300022467 Bacteria 514
151 Ga0207713_1116488 3300025735 Bacteria 901
152 Ga0207710_10588035 3300025900 Bacteria 581
153 Ga0207680_10519694 3300025903 Bacteria 849
154 Ga0207647_10225487 3300025904 Bacteria 1079
155 Ga0207643_10090417 3300025908 Bacteria 1784
156 Ga0207705_10021504 3300025909 Bacteria 4604
157 Ga0207707_10089761 3300025912 Bacteria 2686
158 Ga0207707_10170310 3300025912 Bacteria 1903
159 Ga0207671_10312994 3300025914 Bacteria 1241
160 Ga0207660_11735947 3300025917 Bacteria 502
161 Ga0207657_10164988 3300025919 Bacteria 1797
162 Ga0207649_10171003 3300025920 Bacteria 1514
163 Ga0207649_10428183 3300025920 Bacteria 995
164 Ga0207649_10693154 3300025920 Unclassified 789
165 Ga0207652_10012066 3300025921 Bacteria 6975
166 Ga0207652_10320166 3300025921 Bacteria 1400
167 Ga0207694_10254462 3300025924 Bacteria 1438
168 Ga0207650_10128820 3300025925 Bacteria 1978
169 Ga0207700_10363368 3300025928 Bacteria 1262
170 Ga0207664_10127950 3300025929 Bacteria 2134
171 Ga0207664_11074777 3300025929 Bacteria 720
172 Ga0207644_10298269 3300025931 Bacteria 1298
173 Ga0207690_10270966 3300025932 Bacteria 1319
174 Ga0207706_10519320 3300025933 Bacteria 1027
175 Ga0207670_10557234 3300025936 Bacteria 937
176 Ga0207669_10622390 3300025937 Bacteria 880
177 Ga0207711_10545949 3300025941 Bacteria 1081
178 Ga0207689_10280536 3300025942 Bacteria 1380
179 Ga0207689_10800838 3300025942 Bacteria 795
180 Ga0207661_10000887 3300025944 Bacteria 19645
181 Ga0207661_10400794 3300025944 Bacteria 1244
182 Ga0207661_10616651 3300025944 Bacteria 996
183 Ga0207679_10035455 3300025945 Bacteria 3530
184 Ga0207679_10091818 3300025945 Bacteria 2351
185 Ga0207679_10159505 3300025945 Bacteria 1845
186 Ga0207679_10247320 3300025945 Bacteria 1514
187 Ga0207679_10655626 3300025945 Bacteria 950
188 Ga0207667_10028555 3300025949 Bacteria 6058
189 Ga0207667_10872650 3300025949 Bacteria 893
190 Ga0207667_11713048 3300025949 Bacteria 595
191 Ga0207658_10198917 3300025986 Bacteria 1671
192 Ga0207678_10056979 3300026067 Bacteria 3363
193 Ga0207702_10056680 3300026078 Bacteria 3327
194 Ga0207702_10100897 3300026078 Unclassified 2547
195 Ga0207702_11137206 3300026078 Bacteria 775
196 Ga0207702_11384868 3300026078 Bacteria 697
197 Ga0207641_10056358 3300026088 Bacteria 3340
198 Ga0207641_10767210 3300026088 Bacteria 953
199 Ga0207676_10130787 3300026095 Bacteria 2134
200 Ga0207676_10831421 3300026095 Bacteria 902
201 Ga0207676_11800456 3300026095 Unclassified 611
202 Ga0207674_10033872 3300026116 Bacteria 5344
203 Ga0207674_10170467 3300026116 Bacteria 2130
204 Ga0207674_11395699 3300026116 Bacteria 670
205 Ga0207683_10215839 3300026121 Bacteria 1747
206 Ga0207683_10267852 3300026121 Unclassified 1560
207 Ga0207698_11431071 3300026142 Bacteria 706
208 Ga0207698_11636298 3300026142 Bacteria 659
209 Ga0268265_12139269 3300028380 Bacteria 567
210 Ga0307408_100523430 3300031548 Bacteria 1042
211 Ga0307408_102122657 3300031548 Bacteria 542
212 Ga0307410_10336921 3300031852 Bacteria 1201
213 Ga0307406_10153386 3300031901 Bacteria 1646
214 Ga0307407_10079334 3300031903 Bacteria 1980
215 Ga0307409_100204785 3300031995 Bacteria 1768
216 Ga0307409_101795524 3300031995 Bacteria 642
217 Ga0307416_100275603 3300032002 Bacteria 1655
218 Ga0316212_1041254 3300033547 Unclassified 653
219 Ga0436364_0027573 3300037853 Unclassified 1514
220 Ga0436364_0642410 3300037853 Bacteria 16331
221 Ga0436364_1221587 3300037853 Bacteria 6948
222 Ga0436365_0060487 3300039437 Bacteria 934
223 Ga0436365_0159835 3300039437 Bacteria 931
224 Ga0436365_0169824 3300039437 Bacteria 1746
225 Ga0436361_0277728 3300039447 Bacteria 2880
226 Ga0436363_0127371 3300039450 Unclassified 1620
227 Ga0436363_0258080 3300039450 Bacteria 4977
228 Ga0436362_0332686 3300039453 Bacteria 1197
229 Ga0451791_0189525 3300041451 Bacteria 716
230 Ga0451802_0678122 3300041460 Bacteria 562
231 Ga0451807_1122170 3300041486 Bacteria 745
232 Ga0466970_0868177 3300044765 Unclassified 530
233 Ga0466960_0090838 3300044901 Bacteria 1556
234 Ga0451576_1230274 3300045051 Bacteria 782
235 Ga0466967_0228300 3300045976 Bacteria 1771
236 Ga0466967_0569602 3300045976 Bacteria 1116
237 Ga0466967_1445146 3300045976 Bacteria 685
238 Ga0495580_0511190 3300046472 Bacteria 801
239 Ga0495654_0143895 3300046530 Bacteria 1060
240 Ga0495626_0015800 3300048091 Bacteria 3853
241 Ga0496100_1356554 3300048903 Bacteria 561
242 Ga0496101_1047586 3300048904 Bacteria 641
243 Ga0496105_0538194 3300048908 Unclassified 913
244 Ga0496107_0950889 3300048910 Bacteria 625
245 Ga0496108_0386219 3300048911 Bacteria 1222
246 Ga0496109_0283037 3300048912 Bacteria 1563
247 Ga0496109_0717405 3300048912 Bacteria 937
248 Ga0496109_1941232 3300048912 Bacteria 521
249 Ga0496111_0055950 3300048914 Bacteria 2853
250 Ga0496111_0247415 3300048914 Bacteria 1324
251 Ga0496112_0016279 3300048915 Bacteria 6961
252 Ga0496112_0133216 3300048915 Bacteria 2456
253 Ga0496112_0460328 3300048915 Bacteria 1209
254 Ga0496114_0086435 3300048917 Bacteria 2658
255 Ga0496114_0454882 3300048917 Bacteria 1134
256 Ga0496115_0010443 3300048918 Bacteria 6938
257 Ga0496115_0399286 3300048918 Bacteria 1116
258 Ga0496117_0003826 3300048920 Bacteria 17111
259 Ga0496117_0212407 3300048920 Bacteria 1084
260 Ga0496118_0000290 3300048921 Bacteria 87438
261 Ga0496118_0562927 3300048921 Bacteria 553
262 Ga0496119_0006128 3300048922 Bacteria 11253
263 Ga0496120_0060267 3300048923 Bacteria 2123
264 Ga0496122_0088830 3300048925 Bacteria 2116
265 Ga0496122_0129118 3300048925 Bacteria 1611
266 Ga0496122_0267838 3300048925 Bacteria 943
267 Ga0496123_0053988 3300048926 Bacteria 2650
268 Ga0496123_0186425 3300048926 Bacteria 1078
269 Ga0496124_0000040 3300048927 Bacteria 307061
270 Ga0496124_0004897 3300048927 Bacteria 15395
271 Ga0496124_0082223 3300048927 Bacteria 2644
272 Ga0496124_0228915 3300048927 Bacteria 1391
273 Ga0501034_0007029 3300049571 Bacteria 12008
274 Ga0501034_0163825 3300049571 Bacteria 2193
275 nmdc:mga05p37_42653_c1 3300050507 Bacteria 5576
276 nmdc:mga05p37_744_c1 3300050507 Bacteria 36096
277 nmdc:mga09592_1372_c1 3300050508 Bacteria 11760
278 nmdc:mga09592_519860_c1 3300050508 Bacteria 1024
279 nmdc:mga0qj67_29_c3 3300050509 Bacteria 57362
280 nmdc:mga06r32_55_c1 3300050510 Bacteria 71298
281 nmdc:mga08y16_746432_c1 3300050511 Bacteria 975
282 nmdc:mga0n895_1390774_c1 3300050512 Bacteria 670
283 2984577585 2984576629 Bacteria 4248407
284 2558908623 2558860112 Bacteria 9931328
285 2676473821 2675903058 Bacteria 6822861
286 2740168452 2739367898 Bacteria 4367674
287 2753302915 2751185788 Bacteria 4541048
288 2816503877 2816332139 Bacteria 9138787
289 2827628710 2827628540 Bacteria 6858585
290 2919040973 2919039151 Bacteria 3391018
291 2919042656 2919042368 Bacteria 3905917
292 2928104965 2928104781 Bacteria 3877447
293 2984555063 2984551494 Bacteria 3877562
294 2990259744 2990256926 Bacteria 4252839
295 8054611629 8054609563 Bacteria 5170090
296 8055037999 8055037949 Bacteria 3337834
297 Ga0070658_10010997
298 Ga0070658_10362269
299 Ga0070683_100036404
300 Ga0070683_100324646
301 Ga0070690_101287171
302 Ga0070670_100645989
303 Ga0070680_100076833
304 Ga0070682_100080440
305 Ga0070682_100239210
306 Ga0068868_100178906
307 Ga0070660_100137959
308 Ga0070691_10396402
309 Ga0070661_100147230
310 Ga0070661_100822238
311 Ga0070692_10053646
312 Ga0070692_10097979
313 Ga0070671_100125576
314 Ga0070671_100813462
315 Ga0070659_100163246
316 Ga0070659_100581145
317 Ga0070659_100736908
318 Ga0070667_100178907
319 Ga0070667_100319543
320 Ga0070709_10499168
321 Ga0070714_100593526
322 Ga0070714_101392704
323 Ga0070713_100045679
324 Ga0070713_100305765
325 Ga0070713_101642227
326 Ga0070713_102433849
327 Ga0070710_10865026
328 Ga0070705_100794384
329 Ga0070663_100316047
330 Ga0070678_100178822
331 Ga0070678_100252513
332 Ga0070678_100759934
333 Ga0070662_100301491
334 Ga0070662_100594350
335 Ga0070681_10172522
336 Ga0068867_100764180
337 Ga0070685_10167499
338 Ga0070679_100018020
339 Ga0070679_100166977
340 Ga0070684_100008335
341 Ga0070684_100693091
342 Ga0068853_100006810
343 Ga0068853_102207433
344 Ga0070672_100923469
345 Ga0070665_100278137
346 Ga0070665_101952594
347 Ga0068855_100040228
348 Ga0068855_100213406
349 Ga0068855_100473812
350 Ga0068855_102273614
351 Ga0070664_100082218
352 Ga0070664_100118036
353 Ga0070664_100259042
354 Ga0070664_101150669
355 Ga0068857_100201462
356 Ga0068857_100363055
357 Ga0068857_100512780
358 Ga0068854_101616148
359 Ga0068856_100039950
360 Ga0068856_100074993
361 Ga0068856_101299665
362 Ga0068856_101539453
363 Ga0068856_101893413
364 Ga0068852_100129470
365 Ga0068859_100435422
366 Ga0068864_100364949
367 Ga0068870_10127176
368 Ga0068863_101702863
369 Ga0068860_101736675
370 Ga0081455_10006940
371 Ga0070717_10049880
372 Ga0097621_100854363
373 Ga0068871_100096232
374 Ga0068871_100851380
375 Ga0075428_100589317
376 Ga0075428_100973710
377 Ga0075430_100631508
378 Ga0075431_100639631
379 Ga0075431_100850695
380 Ga0075429_100067619
381 Ga0075429_100684660
382 Ga0097620_100435446
383 Ga0075435_101897293
384 Ga0105251_10201709
385 Ga0111539_10690162
386 Ga0105245_10369221
387 Ga0114129_10004167
388 Ga0114129_10006376
389 Ga0105243_10545897
390 Ga0105241_10091996
391 Ga0105241_10496998
392 Ga0105241_11149047
393 Ga0105237_10541532
394 Ga0105237_10638216
395 Ga0105238_10501117
396 Ga0105238_11443708
397 Ga0105028_116240
398 Ga0105239_10108512
399 Ga0105239_10292181
400 Ga0105239_10428778
401 Ga0105239_10639469
402 Ga0157373_10173160
403 Ga0157373_10240099
404 Ga0157373_10630521
405 Ga0157371_10590961
406 Ga0157371_10722146
407 Ga0157371_11094445
408 Ga0157370_10220182
409 Ga0157370_10446390
410 Ga0157370_11015539
411 Ga0157370_11046308
412 Ga0157370_11495017
413 Ga0157369_10001792
414 Ga0157369_10009812
415 Ga0157369_10048333
416 Ga0157369_10512660
417 Ga0157374_10011500
418 Ga0157374_10014173
419 Ga0157374_10603234
420 Ga0163162_11613094
421 Ga0157372_10126127
422 Ga0157372_10253679
423 Ga0157372_10260739
424 Ga0157372_10317499
425 Ga0157372_10428565
426 Ga0157372_10469557
427 Ga0157375_10638481
428 Ga0163163_10400370
429 Ga0163163_11691021
430 Ga0157379_10382333
431 Ga0157376_10948478
432 Ga0157376_11246364
433 Ga0206356_10789141
434 Ga0206349_1066511
435 Ga0206352_10091538
436 Ga0206350_11092091
437 Ga0206354_10423410
438 Ga0206353_10220224
439 Ga0206353_11341907
440 Ga0213872_10211229
441 Ga0213876_10061126
442 Ga0213875_10083018
443 Ga0213875_10203117
444 Ga0224712_10158454
445 Ga0224712_10642878
446 Ga0224712_10658327
447 Ga0207713_1116488
448 Ga0207710_10588035
449 Ga0207680_10519694
450 Ga0207647_10225487
451 Ga0207643_10090417
452 Ga0207705_10021504
453 Ga0207707_10089761
454 Ga0207707_10170310
455 Ga0207671_10312994
456 Ga0207660_11735947
457 Ga0207657_10164988
458 Ga0207649_10171003
459 Ga0207649_10428183
460 Ga0207649_10693154
461 Ga0207652_10012066
462 Ga0207652_10320166
463 Ga0207694_10254462
464 Ga0207650_10128820
465 Ga0207700_10363368
466 Ga0207664_10127950
467 Ga0207664_11074777
468 Ga0207644_10298269
469 Ga0207690_10270966
470 Ga0207706_10519320
471 Ga0207670_10557234
472 Ga0207669_10622390
473 Ga0207711_10545949
474 Ga0207689_10280536
475 Ga0207689_10800838
476 Ga0207661_10000887
477 Ga0207661_10400794
478 Ga0207661_10616651
479 Ga0207679_10035455
480 Ga0207679_10091818
481 Ga0207679_10159505
482 Ga0207679_10247320
483 Ga0207679_10655626
484 Ga0207667_10028555
485 Ga0207667_10872650
486 Ga0207667_11713048
487 Ga0207658_10198917
488 Ga0207678_10056979
489 Ga0207702_10056680
490 Ga0207702_10100897
491 Ga0207702_11137206
492 Ga0207702_11384868
493 Ga0207641_10056358
494 Ga0207641_10767210
495 Ga0207676_10130787
496 Ga0207676_10831421
497 Ga0207676_11800456
498 Ga0207674_10033872
499 Ga0207674_10170467
500 Ga0207674_11395699
501 Ga0207683_10215839
502 Ga0207683_10267852
503 Ga0207698_11431071
504 Ga0207698_11636298
505 Ga0268265_12139269
506 Ga0307408_100523430
507 Ga0307408_102122657
508 Ga0307410_10336921
509 Ga0307406_10153386
510 Ga0307407_10079334
511 Ga0307409_100204785
512 Ga0307409_101795524
513 Ga0307416_100275603
514 Ga0316212_1041254
515 Ga0436364_0027573
516 Ga0436364_0642410
517 Ga0436364_1221587
518 Ga0436365_0060487
519 Ga0436365_0159835
520 Ga0436365_0169824
521 Ga0436361_0277728
522 Ga0436363_0127371
523 Ga0436363_0258080
524 Ga0436362_0332686
525 Ga0451791_0189525
526 Ga0451802_0678122
527 Ga0451807_1122170
528 Ga0466970_0868177
529 Ga0466960_0090838
530 Ga0451576_1230274
531 Ga0466967_0228300
532 Ga0466967_0569602
533 Ga0466967_1445146
534 Ga0495580_0511190
535 Ga0495654_0143895
536 Ga0495626_0015800
537 Ga0496100_1356554
538 Ga0496101_1047586
539 Ga0496105_0538194
540 Ga0496107_0950889
541 Ga0496108_0386219
542 Ga0496109_0283037
543 Ga0496109_0717405
544 Ga0496109_1941232
545 Ga0496111_0055950
546 Ga0496111_0247415
547 Ga0496112_0016279
548 Ga0496112_0133216
549 Ga0496112_0460328
550 Ga0496114_0086435
551 Ga0496114_0454882
552 Ga0496115_0010443
553 Ga0496115_0399286
554 Ga0496117_0003826
555 Ga0496117_0212407
556 Ga0496118_0000290
557 Ga0496118_0562927
558 Ga0496119_0006128
559 Ga0496120_0060267
560 Ga0496122_0088830
561 Ga0496122_0129118
562 Ga0496122_0267838
563 Ga0496123_0053988
564 Ga0496123_0186425
565 Ga0496124_0000040
566 Ga0496124_0004897
567 Ga0496124_0082223
568 Ga0496124_0228915
569 Ga0501034_0007029
570 Ga0501034_0163825
571 nmdc:mga05p37_42653_c1
572 nmdc:mga05p37_744_c1
573 nmdc:mga09592_1372_c1
574 nmdc:mga09592_519860_c1
575 nmdc:mga0qj67_29_c3
576 nmdc:mga06r32_55_c1
577 nmdc:mga08y16_746432_c1
578 nmdc:mga0n895_1390774_c1
579 2984577585
580 2558908623
581 2676473821
582 2740168452
583 2753302915
584 2816503877
585 2827628710
586 2919040973
587 2919042656
588 2928104965
589 2984555063
590 2990259744
591 8054611629
592 8055037999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

1

102

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.8853 2 105
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.8738 1 105
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.8635 1 105
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.8574 1 105
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.8481 1 105
ID Description Score Start End Superfamily
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.843 1 99 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8191 1 99 3.30.70.100
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8018 2 94 3.30.70.100
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7938 2 99 3.30.70.100
af_I1LID7_431_528_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7708 40 59 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A2V9QIW7-F1-model_v4 L-rhamnose/proton symporter RhaT 1.005 1 85 GO:0005886
GO:0015153
GO:0015293
GO:0016857
GO:0019301
AF-A0A4R5G7Q0-F1-model_v4 L-rhamnose mutarotase 1.001 2 105 GO:0016857
GO:0019301
AF-X1DUB9-F1-model_v4 L-rhamnose mutarotase 1.001 1 71 GO:0016857
GO:0019301
AF-A0A1I3PTR7-F1-model_v4 L-rhamnose mutarotase 0.9979 1 105 GO:0016857
GO:0019301
AF-A0A2N3SJ52-F1-model_v4 deleted 0.9957 1 112

Map