F393424

General Info

Members Datasets Scaffolds Average Seq Length
296 105 257 201

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0129753|Ga0501079_0129753_857_1540
Length 227
Sequence VLWRRPTFDGGGKTYARSAADRQDMTRFLFFIDALSTWVGKAFGWLILVLTLGVSYEVFVRYVLRAPTTWAFDISYITYGAMFLMAGAYTLARNGHVRADVLYRFWRPRTQAVMDLLLYILFFLPAVAAWIYAGXXXXAFSIRFREVSIFSPAGIPVFPLKALIPITGVLLLLQGSAEIIRCILCIRTGAWPQRLHDVEETESVILHEQQLQRERGEQPLPSTEPRA

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
3 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
4 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
5 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
6 2791355199
7 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
8 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
9 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
10 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
11 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
12 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
13 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
14 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
15 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
16 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
17 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
18 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
19 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
20 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
21 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
22 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
23 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
24 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
25 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
26 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
27 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
28 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
29 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
30 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
31 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
32 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
33 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
34 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
46 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
47 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
48 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
61 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
62 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
63 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
64 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
65 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
77 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
78 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
82 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
83 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
84 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
85 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
86 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
87 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
88 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
92 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
93 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
94 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
95 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
96 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
99 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
101 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
102 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
103 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
104 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
105 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.12
Metatranscriptomes 0
Isolates 12.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 7.43
Rhizoplane 0
Rhizosphere 84.46
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10002933 3300005937 Bacteria 19997
2 Ga0081455_10004832 3300005937 Bacteria 14960
3 Ga0081455_10005800 3300005937 Bacteria 13445
4 Ga0081455_10018439 3300005937 Bacteria 6650
5 Ga0081455_10039100 3300005937 Bacteria 4196
6 Ga0081455_10044230 3300005937 Bacteria 3887
7 Ga0081455_10088540 3300005937 Bacteria 2515
8 Ga0081455_10151552 3300005937 Bacteria 1787
9 Ga0081455_10176331 3300005937 Bacteria 1623
10 Ga0081538_10001845 3300005981 Bacteria 21365
11 Ga0081538_10009807 3300005981 Bacteria 7924
12 Ga0081538_10018035 3300005981 Bacteria 5324
13 Ga0081538_10022802 3300005981 Bacteria 4522
14 Ga0081538_10027073 3300005981 Bacteria 3985
15 Ga0081538_10045533 3300005981 Bacteria 2718
16 Ga0081538_10088136 3300005981 Bacteria 1616
17 Ga0075365_10134617 3300006038 Bacteria 1712
18 Ga0075365_10248028 3300006038 Bacteria 1251
19 Ga0075428_100018423 3300006844 Bacteria 7720
20 Ga0075428_100132196 3300006844 Bacteria 2714
21 Ga0075428_100153073 3300006844 Bacteria 2505
22 Ga0075428_100223766 3300006844 Bacteria 2032
23 Ga0075428_100497242 3300006844 Bacteria 1305
24 Ga0075428_100684622 3300006844 Unclassified 1093
25 Ga0075428_100983205 3300006844 Bacteria 894
26 Ga0075430_100024832 3300006846 Bacteria 5098
27 Ga0075430_100045344 3300006846 Bacteria 3715
28 Ga0075430_100070874 3300006846 Bacteria 2924
29 Ga0075430_100115697 3300006846 Bacteria 2235
30 Ga0075430_100235662 3300006846 Bacteria 1517
31 Ga0075430_100263097 3300006846 Bacteria 1428
32 Ga0075430_100520369 3300006846 Bacteria 982
33 Ga0075431_100000047 3300006847 Bacteria 64846
34 Ga0075431_100001046 3300006847 Bacteria 24694
35 Ga0075431_100002212 3300006847 Bacteria 18636
36 Ga0075431_100037341 3300006847 Bacteria 5005
37 Ga0075431_100056923 3300006847 Bacteria 4032
38 Ga0075431_100092377 3300006847 Bacteria 3123
39 Ga0075431_100356208 3300006847 Bacteria 1470
40 Ga0075429_100002645 3300006880 Bacteria 15072
41 Ga0075429_100006836 3300006880 Bacteria 9899
42 Ga0075429_100138124 3300006880 Bacteria 2133
43 Ga0075429_100219909 3300006880 Bacteria 1664
44 Ga0111539_10000271 3300009094 Bacteria 61942
45 Ga0111539_10022092 3300009094 Bacteria 7820
46 Ga0111539_10070474 3300009094 Bacteria 4127
47 Ga0111539_10139403 3300009094 Bacteria 2840
48 Ga0114129_10009382 3300009147 Bacteria 13948
49 Ga0114129_10150935 3300009147 Bacteria 3180
50 Ga0114129_10241315 3300009147 Bacteria 2429
51 Ga0114129_10343311 3300009147 Bacteria 1980
52 Ga0114129_10530858 3300009147 Bacteria 1533
53 Ga0114129_10857200 3300009147 Bacteria 1154
54 Ga0114129_11600753 3300009147 Bacteria 797
55 Ga0157380_10213511 3300014326 Bacteria 1721
56 Ga0214544_1000002 3300021320 Bacteria 753857
57 Ga0214542_1000001 3300021321 Bacteria 1018696
58 Ga0214545_1000001 3300021324 Bacteria 1092817
59 Ga0214543_1000001 3300021327 Bacteria 776921
60 Ga0209758_1036863 3300025297 Bacteria 1900
61 Ga0209998_10002713 3300027717 Bacteria 3996
62 Ga0209974_10057755 3300027876 Bacteria 1311
63 Ga0207428_10003003 3300027907 Bacteria 16656
64 Ga0207428_10033436 3300027907 Bacteria 4223
65 Ga0207428_10116121 3300027907 Bacteria 2056
66 Ga0316576_10127045 3300031727 Bacteria 1917
67 Ga0316576_10230407 3300031727 Bacteria 1393
68 Ga0316578_10220238 3300031728 Bacteria 1141
69 Ga0307405_10097056 3300031731 Bacteria 1967
70 Ga0307410_10286401 3300031852 Bacteria 1295
71 Ga0307407_10610935 3300031903 Bacteria 813
72 Ga0307412_10597761 3300031911 Bacteria 934
73 Ga0307415_100188960 3300032126 Bacteria 1624
74 Ga0307415_100261277 3300032126 Bacteria 1413
75 Ga0439453_0018141 3300041408 Bacteria 1242
76 Ga0439465_0154324 3300041413 Bacteria 821
77 Ga0439465_0181917 3300041413 Bacteria 761
78 Ga0439450_062918 3300042008 Bacteria 900
79 Ga0439455_0003639 3300042012 Bacteria 2972
80 Ga0439440_0029945 3300042993 Bacteria 1280
81 Ga0501031_0114141 3300049568 Bacteria 1764
82 Ga0501033_0018327 3300049570 Bacteria 5289
83 Ga0501033_0114583 3300049570 Bacteria 1959
84 Ga0501033_0134793 3300049570 Bacteria 1787
85 Ga0501036_0000453 3300049572 Bacteria 29270
86 Ga0501036_0011964 3300049572 Bacteria 7194
87 Ga0501036_0863409 3300049572 Bacteria 744
88 Ga0501037_0793937 3300049573 Bacteria 625
89 Ga0501038_0019239 3300049574 Bacteria 6159
90 Ga0501038_0948544 3300049574 Unclassified 633
91 Ga0501039_0002602 3300049575 Bacteria 13483
92 Ga0501039_0323475 3300049575 Bacteria 1212
93 Ga0501039_0426842 3300049575 Bacteria 1041
94 Ga0501039_0445405 3300049575 Bacteria 1017
95 Ga0501039_0539724 3300049575 Bacteria 915
96 Ga0501040_0004163 3300049576 Bacteria 9417
97 Ga0501040_0043801 3300049576 Bacteria 3051
98 Ga0501040_0090510 3300049576 Bacteria 2127
99 Ga0501040_0125163 3300049576 Bacteria 1805
100 Ga0501040_0134671 3300049576 Bacteria 1739
101 Ga0501040_0272721 3300049576 Bacteria 1208
102 Ga0501041_0000149 3300049577 Bacteria 30838
103 Ga0501041_0055903 3300049577 Bacteria 2410
104 Ga0501041_0197700 3300049577 Bacteria 1260
105 Ga0501041_0205898 3300049577 Bacteria 1234
106 Ga0501041_0448775 3300049577 Bacteria 819
107 Ga0501042_0000458 3300049578 Bacteria 21022
108 Ga0501042_0106665 3300049578 Bacteria 2016
109 Ga0501042_0233555 3300049578 Bacteria 1327
110 Ga0501042_0239307 3300049578 Bacteria 1310
111 Ga0501042_0389495 3300049578 Bacteria 1009
112 Ga0501046_0004205 3300049580 Bacteria 13112
113 Ga0501046_0067834 3300049580 Bacteria 2777
114 Ga0501046_0408468 3300049580 Bacteria 980
115 Ga0501048_0014856 3300049582 Bacteria 5758
116 Ga0501048_0033055 3300049582 Bacteria 3738
117 Ga0501068_0003516 3300049584 Bacteria 8464
118 Ga0501068_0142225 3300049584 Bacteria 1504
119 Ga0501068_0159661 3300049584 Bacteria 1421
120 Ga0501068_0321384 3300049584 Bacteria 992
121 Ga0501068_0560419 3300049584 Bacteria 743
122 Ga0501069_0023005 3300049585 Bacteria 3394
123 Ga0501071_0138836 3300049587 Bacteria 1809
124 Ga0501071_0248885 3300049587 Bacteria 1341
125 Ga0501071_0288469 3300049587 Bacteria 1243
126 Ga0501072_0001148 3300049588 Bacteria 19673
127 Ga0501072_0007174 3300049588 Bacteria 8453
128 Ga0501072_0010265 3300049588 Bacteria 7135
129 Ga0501072_0080972 3300049588 Bacteria 2573
130 Ga0501072_0120159 3300049588 Bacteria 2093
131 Ga0501072_0163722 3300049588 Bacteria 1774
132 Ga0501072_0211141 3300049588 Bacteria 1547
133 Ga0501072_0441249 3300049588 Bacteria 1031
134 Ga0501072_0596859 3300049588 Bacteria 871
135 Ga0501072_0876337 3300049588 Bacteria 702
136 Ga0501073_0092496 3300049589 Bacteria 2102
137 Ga0501073_0439935 3300049589 Bacteria 901
138 Ga0501074_0078827 3300049590 Bacteria 2364
139 Ga0501074_0131626 3300049590 Bacteria 1789
140 Ga0501074_0565568 3300049590 Bacteria 805
141 Ga0501075_0000399 3300049591 Bacteria 25242
142 Ga0501075_0004525 3300049591 Bacteria 9418
143 Ga0501075_0021650 3300049591 Bacteria 4689
144 Ga0501075_0044168 3300049591 Bacteria 3343
145 Ga0501075_0173952 3300049591 Bacteria 1643
146 Ga0501075_0196207 3300049591 Bacteria 1540
147 Ga0501075_0224844 3300049591 Bacteria 1432
148 Ga0501075_0430143 3300049591 Bacteria 1006
149 Ga0501075_0433863 3300049591 Bacteria 1002
150 Ga0501075_0470655 3300049591 Bacteria 958
151 Ga0501076_0000050 3300049592 Bacteria 57032
152 Ga0501076_0003192 3300049592 Bacteria 11434
153 Ga0501076_0044541 3300049592 Bacteria 3500
154 Ga0501076_0158681 3300049592 Bacteria 1842
155 Ga0501076_0169734 3300049592 Bacteria 1778
156 Ga0501076_0253189 3300049592 Bacteria 1441
157 Ga0501076_0440302 3300049592 Bacteria 1073
158 Ga0501076_0880807 3300049592 Bacteria 738
159 Ga0501077_0000158 3300049593 Bacteria 38011
160 Ga0501077_0012850 3300049593 Bacteria 5247
161 Ga0501077_0107885 3300049593 Bacteria 1764
162 Ga0501077_0171825 3300049593 Bacteria 1377
163 Ga0501077_0281545 3300049593 Bacteria 1058
164 Ga0501077_0306500 3300049593 Bacteria 1012
165 Ga0501077_0314853 3300049593 Bacteria 998
166 Ga0501077_0617003 3300049593 Bacteria 697
167 Ga0501079_0002659 3300049741 Bacteria 12995
168 Ga0501079_0129753 3300049741 Bacteria 1961
169 Ga0501079_0177683 3300049741 Bacteria 1661
170 Ga0501079_0178415 3300049741 Bacteria 1657
171 Ga0501079_0241271 3300049741 Bacteria 1412
172 Ga0501079_0396868 3300049741 Bacteria 1082
173 Ga0501079_0703023 3300049741 Bacteria 796
174 Ga0501080_0017360 3300049742 Bacteria 6653
175 Ga0501080_0024771 3300049742 Bacteria 5565
176 Ga0501080_0057011 3300049742 Bacteria 3638
177 Ga0501080_0076849 3300049742 Bacteria 3105
178 Ga0501080_0131350 3300049742 Bacteria 2319
179 Ga0501080_0631576 3300049742 Bacteria 949
180 Ga0501081_0043711 3300049743 Bacteria 3074
181 Ga0501081_0092999 3300049743 Bacteria 2122
182 Ga0501081_0173321 3300049743 Bacteria 1558
183 Ga0501081_0271249 3300049743 Bacteria 1241
184 Ga0501081_0509696 3300049743 Bacteria 897
185 Ga0501083_0120459 3300049744 Bacteria 1721
186 Ga0501083_0154186 3300049744 Bacteria 1504
187 Ga0501083_0476463 3300049744 Bacteria 812
188 Ga0501035_0008676 3300049822 Bacteria 9462
189 Ga0501035_0362078 3300049822 Bacteria 1212
190 Ga0501035_0465886 3300049822 Bacteria 1044
191 Ga0501035_0704834 3300049822 Bacteria 814
192 Ga0501044_0720104 3300049823 Bacteria 882
193 Ga0501045_0013566 3300049824 Bacteria 5756
194 Ga0501045_0071472 3300049824 Bacteria 2554
195 Ga0501045_0082968 3300049824 Bacteria 2364
196 Ga0501045_0107149 3300049824 Bacteria 2071
197 Ga0501045_0179039 3300049824 Bacteria 1580
198 Ga0501045_0233476 3300049824 Bacteria 1369
199 Ga0501045_0318299 3300049824 Bacteria 1157
200 nmdc:mga05p37_170272_c1 3300050507 Bacteria 2656
201 nmdc:mga05p37_266033_c1 3300050507 Bacteria 2050
202 nmdc:mga05p37_57_c1 3300050507 Bacteria 96042
203 nmdc:mga05p37_607540_c1 3300050507 Bacteria 1233
204 nmdc:mga05p37_622863_c1 3300050507 Bacteria 1214
205 nmdc:mga09592_1069451_c1 3300050508 Unclassified 672
206 nmdc:mga09592_226_c1 3300050508 Bacteria 40643
207 nmdc:mga09592_40954_c1 3300050508 Bacteria 3894
208 nmdc:mga09592_48479_c1 3300050508 Bacteria 3581
209 nmdc:mga09592_6736_c1 3300050508 Bacteria 9346
210 nmdc:mga0qj67_144170_c1 3300050509 Bacteria 1931
211 nmdc:mga0qj67_34887_c1 3300050509 Bacteria 3931
212 nmdc:mga0qj67_381746_c1 3300050509 Bacteria 1138
213 nmdc:mga0qj67_42644_c1 3300050509 Bacteria 3572
214 nmdc:mga0qj67_64724_c1 3300050509 Bacteria 2909
215 nmdc:mga0qj67_7547_c1 3300050509 Bacteria 8036
216 nmdc:mga0qj67_75886_c1 3300050509 Bacteria 2688
217 nmdc:mga06r32_109346_c1 3300050510 Bacteria 2718
218 nmdc:mga06r32_154_c1 3300050510 Bacteria 52497
219 nmdc:mga06r32_168852_c1 3300050510 Bacteria 2171
220 nmdc:mga06r32_1985_c1 3300050510 Bacteria 18277
221 nmdc:mga06r32_346584_c1 3300050510 Bacteria 1470
222 nmdc:mga06r32_430789_c1 3300050510 Bacteria 1300
223 nmdc:mga06r32_7252_c1 3300050510 Bacteria 9988
224 nmdc:mga06r32_746098_c1 3300050510 Bacteria 942
225 nmdc:mga06r32_880493_c1 3300050510 Bacteria 853
226 nmdc:mga08y16_124735_c1 3300050511 Bacteria 2679
227 nmdc:mga08y16_14201_c1 3300050511 Bacteria 8381
228 Ga0501084_0000359 3300054114 Bacteria 34827
229 Ga0501084_0001173 3300054114 Bacteria 20442
230 Ga0501084_0176310 3300054114 Bacteria 1804
231 Ga0501084_0186010 3300054114 Bacteria 1753
232 Ga0501084_0207731 3300054114 Bacteria 1652
233 Ga0501084_0306665 3300054114 Bacteria 1341
234 Ga0501084_0359254 3300054114 Bacteria 1231
235 Ga0501084_0611482 3300054114 Bacteria 921
236 Ga0501084_0629260 3300054114 Bacteria 906
237 Ga0501084_0836148 3300054114 Bacteria 775
238 Ga0590071_015205 3300059421 Bacteria 1806
239 Ga0590077_018037 3300059426 Bacteria 1488
240 Ga0590077_045459 3300059426 Bacteria 981
241 Ga0501082_0005095 3300060353 Bacteria 11449
242 Ga0501082_0070944 3300060353 Bacteria 2999
243 Ga0501082_0078912 3300060353 Bacteria 2840
244 Ga0501082_0238224 3300060353 Bacteria 1583
245 Ga0501082_0432722 3300060353 Bacteria 1149
246 Ga0530510_0000088 3300061734 Bacteria 48774
247 Ga0530510_0004053 3300061734 Bacteria 10112
248 Ga0530510_0015191 3300061734 Bacteria 5437
249 Ga0530510_0090701 3300061734 Bacteria 2229
250 Ga0530510_0103130 3300061734 Bacteria 2086
251 Ga0530510_0153256 3300061734 Bacteria 1703
252 Ga0530510_0186917 3300061734 Bacteria 1537
253 Ga0530510_0208479 3300061734 Bacteria 1452
254 Ga0530510_0226755 3300061734 Bacteria 1389
255 Ga0530510_0229154 3300061734 Bacteria 1382
256 Ga0530510_0329647 3300061734 Bacteria 1145
257 Ga0530510_0722118 3300061734 Bacteria 759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031911 Ga0307412_10597761 Ga0307412_105977611 185
2 3300032126 Ga0307415_100261277 Ga0307415_1002612772 187
3 3300061734 Ga0530510_0208479 Ga0530510_0208479_39_605 187
4 3300031727 Ga0316576_10230407 Ga0316576_102304072 188
5 3300049573 Ga0501037_0793937 Ga0501037_0793937_17_586 189
6 3300041413 Ga0439465_0154324 Ga0439465_0154324_133_738 190
7 3300049593 Ga0501077_0617003 Ga0501077_0617003_29_601 190
8 3300049743 Ga0501081_0509696 Ga0501081_0509696_25_597 190
9 3300049742 Ga0501080_0631576 Ga0501080_0631576_354_929 191
10 3300049568 Ga0501031_0114141 Ga0501031_0114141_1119_1733 192
11 3300049570 Ga0501033_0114583 Ga0501033_0114583_84_698 192
12 3300049572 Ga0501036_0000453 Ga0501036_0000453_17529_18143 192
13 3300049574 Ga0501038_0948544 Ga0501038_0948544_11_589 192
14 3300049575 Ga0501039_0002602 Ga0501039_0002602_12848_13462 192
15 3300049576 Ga0501040_0004163 Ga0501040_0004163_75_689 192
16 3300049577 Ga0501041_0000149 Ga0501041_0000149_30126_30740 192
17 3300049578 Ga0501042_0000458 Ga0501042_0000458_56_670 192
18 3300049580 Ga0501046_0004205 Ga0501046_0004205_72_686 192
19 3300049582 Ga0501048_0014856 Ga0501048_0014856_102_716 192
20 3300049584 Ga0501068_0003516 Ga0501068_0003516_31_645 192
21 3300049588 Ga0501072_0001148 Ga0501072_0001148_19006_19620 192
22 3300049590 Ga0501074_0131626 Ga0501074_0131626_89_703 192
23 3300049591 Ga0501075_0004525 Ga0501075_0004525_76_690 192
24 3300049592 Ga0501076_0003192 Ga0501076_0003192_95_709 192
25 3300049593 Ga0501077_0000158 Ga0501077_0000158_34130_34744 192
26 3300049742 Ga0501080_0024771 Ga0501080_0024771_4882_5496 192
27 3300049744 Ga0501083_0476463 Ga0501083_0476463_147_761 192
28 3300049822 Ga0501035_0008676 Ga0501035_0008676_8745_9359 192
29 3300049824 Ga0501045_0013566 Ga0501045_0013566_104_718 192
30 3300054114 Ga0501084_0000359 Ga0501084_0000359_34102_34716 192
31 3300060353 Ga0501082_0005095 Ga0501082_0005095_10726_11340 192
32 3300061734 Ga0530510_0015191 Ga0530510_0015191_4754_5368 192
33 3300006844 Ga0075428_100018423 Ga0075428_1000184235 193
34 3300006846 Ga0075430_100263097 Ga0075430_1002630972 193
35 3300006847 Ga0075431_100056923 Ga0075431_1000569232 193
36 3300006880 Ga0075429_100138124 Ga0075429_1001381242 193
37 3300009147 Ga0114129_10150935 Ga0114129_101509354 193
38 3300049743 Ga0501081_0271249 Ga0501081_0271249_117_698 193
39 3300050507 nmdc:mga05p37_622863_c1 nmdc:mga05p37_622863_c1_34_615 193
40 3300050508 nmdc:mga09592_40954_c1 nmdc:mga09592_40954_c1_1123_1704 193
41 3300050509 nmdc:mga0qj67_42644_c1 nmdc:mga0qj67_42644_c1_581_1162 193
42 3300006844 Ga0075428_100684622 Ga0075428_1006846221 194
43 3300006846 Ga0075430_100070874 Ga0075430_1000708742 194
44 3300006846 Ga0075430_100235662 Ga0075430_1002356622 194
45 3300009094 Ga0111539_10022092 Ga0111539_100220922 194
46 3300009147 Ga0114129_10241315 Ga0114129_102413152 194
47 3300014326 Ga0157380_10213511 Ga0157380_102135112 194
48 3300027907 Ga0207428_10116121 Ga0207428_101161211 194
49 3300050507 nmdc:mga05p37_170272_c1 nmdc:mga05p37_170272_c1_1383_1970 194
50 3300050508 nmdc:mga09592_1069451_c1 nmdc:mga09592_1069451_c1_11_598 194
51 3300050509 nmdc:mga0qj67_144170_c1 nmdc:mga0qj67_144170_c1_180_770 194
52 3300050511 nmdc:mga08y16_124735_c1 nmdc:mga08y16_124735_c1_1275_1862 194
53 3300005937 Ga0081455_10004832 Ga0081455_1000483210 196
54 3300005937 Ga0081455_10039100 Ga0081455_100391003 196
55 3300005937 Ga0081455_10088540 Ga0081455_100885402 196
56 3300005937 Ga0081455_10176331 Ga0081455_101763311 196
57 3300005981 Ga0081538_10009807 Ga0081538_100098072 196
58 3300005981 Ga0081538_10045533 Ga0081538_100455332 196
59 3300031731 Ga0307405_10097056 Ga0307405_100970562 196
60 3300049575 Ga0501039_0445405 Ga0501039_0445405_38_628 196
61 3300049588 Ga0501072_0596859 Ga0501072_0596859_232_822 196
62 3300049591 Ga0501075_0470655 Ga0501075_0470655_238_828 196
63 3300049592 Ga0501076_0440302 Ga0501076_0440302_143_733 196
64 3300049593 Ga0501077_0171825 Ga0501077_0171825_402_992 196
65 3300049741 Ga0501079_0241271 Ga0501079_0241271_808_1398 196
66 iso_pu_bacteria 2513237102 2513701656 196
67 iso_pu_bacteria 2513237161 2514011832 196
68 iso_pu_bacteria 2617270741 2617375756 196
69 iso_pu_bacteria 2824600985 2824605770 196
70 iso_pu_bacteria 2824609381 2824614433 196
71 iso_pu_bacteria 2824617872 2824618810 196
72 iso_pu_bacteria 2824626560 2824628916 196
73 iso_pu_bacteria 2824635225 2824638427 196
74 iso_pu_bacteria 2824644064 2824648059 196
75 iso_pu_bacteria 2824714736 2824718604 196
76 iso_pu_bacteria 2824723954 2824726018 196
77 iso_pu_bacteria 2824732956 2824736619 196
78 iso_pu_bacteria 2824746037 2824749270 196
79 iso_pu_bacteria 2838122688 2838123726 196
80 iso_pu_bacteria 2841941048 2841948666 196
81 iso_pu_bacteria 2841949485 2841949826 196
82 iso_pu_bacteria 2841966195 2841966244 196
83 iso_pu_bacteria 2841974524 2841974983 196
84 iso_pu_bacteria 2841983080 2841983450 196
85 iso_pu_bacteria 2857509624 2857514294 196
86 iso_pu_bacteria 2885366525 2885374353 196
87 iso_pu_bacteria 2888419890 2888424554 196
88 iso_pu_bacteria 2889033259 2889035421 196
89 iso_pu_bacteria 2889033259 2889038812 196
90 iso_pu_bacteria 2908775508 2908780191 196
91 iso_pu_bacteria 3005506211 3005510350 196
92 iso_pu_bacteria 3005587118 3005592618 196
93 iso_pu_bacteria 8056681323 8056681503 196
94 3300027876 Ga0209974_10057755 Ga0209974_100577552 197
95 iso_pu_bacteria 2513237101 2513695176 197
96 iso_pu_bacteria 2721755755 2723841704 197
97 iso_pu_bacteria 2791355199 2793080861 197
98 iso_pu_bacteria 2874604998 2874608000 197
99 iso_pu_bacteria 8006964411 8006967522 197
100 iso_pu_bacteria 8006994254 8007000323 197
101 iso_pu_bacteria 8056673599 8056676020 197
102 3300006038 Ga0075365_10134617 Ga0075365_101346172 199
103 3300031903 Ga0307407_10610935 Ga0307407_106109351 199
104 3300041413 Ga0439465_0181917 Ga0439465_0181917_60_659 199
105 3300049575 Ga0501039_0539724 Ga0501039_0539724_60_662 199
106 3300049576 Ga0501040_0090510 Ga0501040_0090510_1471_2073 199
107 3300049576 Ga0501040_0125163 Ga0501040_0125163_1149_1748 199
108 3300049587 Ga0501071_0248885 Ga0501071_0248885_623_1225 199
109 3300049591 Ga0501075_0430143 Ga0501075_0430143_336_938 199
110 3300049592 Ga0501076_0158681 Ga0501076_0158681_501_1100 199
111 3300049593 Ga0501077_0281545 Ga0501077_0281545_318_920 199
112 3300049743 Ga0501081_0092999 Ga0501081_0092999_74_676 199
113 3300049744 Ga0501083_0154186 Ga0501083_0154186_814_1416 199
114 3300049822 Ga0501035_0362078 Ga0501035_0362078_89_691 199
115 3300049824 Ga0501045_0071472 Ga0501045_0071472_1855_2457 199
116 3300049824 Ga0501045_0179039 Ga0501045_0179039_825_1424 199
117 3300059426 Ga0590077_018037 Ga0590077_018037_832_1434 199
118 3300060353 Ga0501082_0238224 Ga0501082_0238224_66_668 199
119 3300061734 Ga0530510_0103130 Ga0530510_0103130_1470_2072 199
120 3300006038 Ga0075365_10248028 Ga0075365_102480282 200
121 3300021320 Ga0214544_1000002 Ga0214544_1000002418 200
122 3300021321 Ga0214542_1000001 Ga0214542_1000001768 200
123 3300021324 Ga0214545_1000001 Ga0214545_1000001834 200
124 3300021327 Ga0214543_1000001 Ga0214543_1000001361 200
125 3300025297 Ga0209758_1036863 Ga0209758_10368632 200
126 3300031727 Ga0316576_10127045 Ga0316576_101270452 200
127 3300031728 Ga0316578_10220238 Ga0316578_102202382 200
128 3300049577 Ga0501041_0448775 Ga0501041_0448775_108_710 200
129 3300049589 Ga0501073_0092496 Ga0501073_0092496_386_988 200
130 3300049743 Ga0501081_0043711 Ga0501081_0043711_1038_1640 200
131 3300005937 Ga0081455_10005800 Ga0081455_1000580011 201
132 3300005937 Ga0081455_10151552 Ga0081455_101515522 201
133 3300005981 Ga0081538_10022802 Ga0081538_100228025 201
134 3300005981 Ga0081538_10027073 Ga0081538_100270733 201
135 3300005981 Ga0081538_10088136 Ga0081538_100881362 201
136 3300006844 Ga0075428_100132196 Ga0075428_1001321962 201
137 3300006844 Ga0075428_100223766 Ga0075428_1002237662 201
138 3300006844 Ga0075428_100983205 Ga0075428_1009832051 201
139 3300006846 Ga0075430_100045344 Ga0075430_1000453442 201
140 3300006846 Ga0075430_100520369 Ga0075430_1005203692 201
141 3300006847 Ga0075431_100001046 Ga0075431_10000104611 201
142 3300006847 Ga0075431_100002212 Ga0075431_1000022125 201
143 3300006880 Ga0075429_100006836 Ga0075429_1000068362 201
144 3300009147 Ga0114129_10343311 Ga0114129_103433112 201
145 3300009147 Ga0114129_10857200 Ga0114129_108572001 201
146 3300049575 Ga0501039_0323475 Ga0501039_0323475_408_1013 201
147 3300049576 Ga0501040_0272721 Ga0501040_0272721_185_790 201
148 3300049578 Ga0501042_0239307 Ga0501042_0239307_106_714 201
149 3300049580 Ga0501046_0408468 Ga0501046_0408468_320_925 201
150 3300049584 Ga0501068_0159661 Ga0501068_0159661_316_921 201
151 3300049587 Ga0501071_0288469 Ga0501071_0288469_241_849 201
152 3300049588 Ga0501072_0211141 Ga0501072_0211141_287_892 201
153 3300049591 Ga0501075_0196207 Ga0501075_0196207_710_1315 201
154 3300049591 Ga0501075_0433863 Ga0501075_0433863_235_843 201
155 3300049592 Ga0501076_0253189 Ga0501076_0253189_588_1193 201
156 3300049593 Ga0501077_0314853 Ga0501077_0314853_329_937 201
157 3300049741 Ga0501079_0396868 Ga0501079_0396868_446_1054 201
158 3300049822 Ga0501035_0704834 Ga0501035_0704834_60_668 201
159 3300050507 nmdc:mga05p37_266033_c1 nmdc:mga05p37_266033_c1_336_941 201
160 3300050507 nmdc:mga05p37_607540_c1 nmdc:mga05p37_607540_c1_524_1129 201
161 3300050508 nmdc:mga09592_6736_c1 nmdc:mga09592_6736_c1_7736_8341 201
162 3300050509 nmdc:mga0qj67_7547_c1 nmdc:mga0qj67_7547_c1_3059_3664 201
163 3300050510 nmdc:mga06r32_1985_c1 nmdc:mga06r32_1985_c1_5255_5860 201
164 3300050510 nmdc:mga06r32_7252_c1 nmdc:mga06r32_7252_c1_2214_2819 201
165 3300054114 Ga0501084_0306665 Ga0501084_0306665_203_811 201
166 3300054114 Ga0501084_0359254 Ga0501084_0359254_581_1186 201
167 3300059421 Ga0590071_015205 Ga0590071_015205_539_1147 201
168 3300059426 Ga0590077_045459 Ga0590077_045459_287_895 201
169 iso_pu_bacteria 2876808645 2876813524 201
170 iso_pu_bacteria 2879110137 2879112240 201
171 3300006844 Ga0075428_100497242 Ga0075428_1004972422 202
172 3300031852 Ga0307410_10286401 Ga0307410_102864012 202
173 3300041408 Ga0439453_0018141 Ga0439453_0018141_579_1223 202
174 3300049572 Ga0501036_0863409 Ga0501036_0863409_73_681 202
175 3300049584 Ga0501068_0321384 Ga0501068_0321384_28_636 202
176 3300049591 Ga0501075_0044168 Ga0501075_0044168_416_1024 202
177 3300049591 Ga0501075_0173952 Ga0501075_0173952_164_778 202
178 3300049592 Ga0501076_0169734 Ga0501076_0169734_492_1100 202
179 3300049593 Ga0501077_0306500 Ga0501077_0306500_282_890 202
180 3300049741 Ga0501079_0177683 Ga0501079_0177683_653_1267 202
181 3300049824 Ga0501045_0107149 Ga0501045_0107149_423_1031 202
182 3300050510 nmdc:mga06r32_746098_c1 nmdc:mga06r32_746098_c1_256_864 202
183 3300054114 Ga0501084_0611482 Ga0501084_0611482_222_830 202
184 3300054114 Ga0501084_0836148 Ga0501084_0836148_69_677 202
185 3300061734 Ga0530510_0153256 Ga0530510_0153256_498_1112 202
186 3300061734 Ga0530510_0229154 Ga0530510_0229154_191_805 202
187 3300061734 Ga0530510_0722118 Ga0530510_0722118_76_684 202
188 3300005937 Ga0081455_10044230 Ga0081455_100442303 203
189 3300005981 Ga0081538_10001845 Ga0081538_1000184511 203
190 3300009094 Ga0111539_10139403 Ga0111539_101394033 203
191 3300049570 Ga0501033_0018327 Ga0501033_0018327_127_738 203
192 3300049570 Ga0501033_0134793 Ga0501033_0134793_12_623 203
193 3300049572 Ga0501036_0011964 Ga0501036_0011964_6008_6619 203
194 3300049574 Ga0501038_0019239 Ga0501038_0019239_5498_6109 203
195 3300049576 Ga0501040_0043801 Ga0501040_0043801_297_911 203
196 3300049577 Ga0501041_0055903 Ga0501041_0055903_806_1417 203
197 3300049578 Ga0501042_0106665 Ga0501042_0106665_32_643 203
198 3300049580 Ga0501046_0067834 Ga0501046_0067834_874_1485 203
199 3300049582 Ga0501048_0033055 Ga0501048_0033055_538_1149 203
200 3300049584 Ga0501068_0142225 Ga0501068_0142225_813_1424 203
201 3300049585 Ga0501069_0023005 Ga0501069_0023005_1924_2535 203
202 3300049587 Ga0501071_0138836 Ga0501071_0138836_47_658 203
203 3300049588 Ga0501072_0080972 Ga0501072_0080972_1592_2206 203
204 3300049588 Ga0501072_0163722 Ga0501072_0163722_100_711 203
205 3300049588 Ga0501072_0876337 Ga0501072_0876337_63_674 203
206 3300049589 Ga0501073_0439935 Ga0501073_0439935_26_637 203
207 3300049590 Ga0501074_0078827 Ga0501074_0078827_1703_2314 203
208 3300049590 Ga0501074_0565568 Ga0501074_0565568_137_748 203
209 3300049591 Ga0501075_0000399 Ga0501075_0000399_18654_19265 203
210 3300049591 Ga0501075_0021650 Ga0501075_0021650_502_1116 203
211 3300049592 Ga0501076_0000050 Ga0501076_0000050_32573_33184 203
212 3300049592 Ga0501076_0880807 Ga0501076_0880807_107_718 203
213 3300049741 Ga0501079_0129753 Ga0501079_0129753_857_1540 203
214 3300049741 Ga0501079_0178415 Ga0501079_0178415_739_1350 203
215 3300049741 Ga0501079_0703023 Ga0501079_0703023_82_693 203
216 3300049742 Ga0501080_0017360 Ga0501080_0017360_65_676 203
217 3300049742 Ga0501080_0057011 Ga0501080_0057011_1761_2372 203
218 3300049822 Ga0501035_0465886 Ga0501035_0465886_351_962 203
219 3300049823 Ga0501044_0720104 Ga0501044_0720104_249_860 203
220 3300049824 Ga0501045_0082968 Ga0501045_0082968_883_1494 203
221 3300049824 Ga0501045_0233476 Ga0501045_0233476_301_984 203
222 3300049824 Ga0501045_0318299 Ga0501045_0318299_227_841 203
223 3300050510 nmdc:mga06r32_880493_c1 nmdc:mga06r32_880493_c1_164_775 203
224 3300054114 Ga0501084_0001173 Ga0501084_0001173_88_699 203
225 3300054114 Ga0501084_0629260 Ga0501084_0629260_194_877 203
226 3300060353 Ga0501082_0070944 Ga0501082_0070944_34_645 203
227 3300061734 Ga0530510_0000088 Ga0530510_0000088_30642_31253 203
228 3300061734 Ga0530510_0004053 Ga0530510_0004053_6961_7644 203
229 3300061734 Ga0530510_0226755 Ga0530510_0226755_750_1364 203
230 3300061734 Ga0530510_0329647 Ga0530510_0329647_207_821 204
231 iso_pu_bacteria 2824679649 2824684479 204
232 iso_pu_bacteria 2922393267 2922396208 204
233 3300049578 Ga0501042_0389495 Ga0501042_0389495_15_632 205
234 3300049588 Ga0501072_0007174 Ga0501072_0007174_1501_2118 205
235 3300049588 Ga0501072_0441249 Ga0501072_0441249_234_851 205
236 3300049591 Ga0501075_0224844 Ga0501075_0224844_378_995 205
237 3300049593 Ga0501077_0012850 Ga0501077_0012850_3330_3947 205
238 3300049741 Ga0501079_0002659 Ga0501079_0002659_969_1586 205
239 3300049742 Ga0501080_0076849 Ga0501080_0076849_2272_2889 205
240 3300049743 Ga0501081_0173321 Ga0501081_0173321_922_1539 205
241 3300049744 Ga0501083_0120459 Ga0501083_0120459_360_977 205
242 3300054114 Ga0501084_0176310 Ga0501084_0176310_537_1154 205
243 3300054114 Ga0501084_0207731 Ga0501084_0207731_912_1529 205
244 3300060353 Ga0501082_0078912 Ga0501082_0078912_793_1410 205
245 3300006844 Ga0075428_100153073 Ga0075428_1001530732 206
246 3300006846 Ga0075430_100024832 Ga0075430_1000248323 206
247 3300006847 Ga0075431_100000047 Ga0075431_10000004725 206
248 3300006847 Ga0075431_100092377 Ga0075431_1000923772 206
249 3300006847 Ga0075431_100356208 Ga0075431_1003562082 206
250 3300006880 Ga0075429_100002645 Ga0075429_1000026454 206
251 3300009094 Ga0111539_10000271 Ga0111539_1000027131 206
252 3300009094 Ga0111539_10070474 Ga0111539_100704743 206
253 3300009147 Ga0114129_10009382 Ga0114129_1000938213 206
254 3300009147 Ga0114129_10530858 Ga0114129_105308582 206
255 3300009147 Ga0114129_11600753 Ga0114129_116007531 206
256 3300027907 Ga0207428_10003003 Ga0207428_1000300315 206
257 3300027907 Ga0207428_10033436 Ga0207428_100334362 206
258 3300042993 Ga0439440_0029945 Ga0439440_0029945_158_778 206
259 3300049577 Ga0501041_0197700 Ga0501041_0197700_334_1026 206
260 3300049584 Ga0501068_0560419 Ga0501068_0560419_24_644 206
261 3300049588 Ga0501072_0120159 Ga0501072_0120159_927_1547 206
262 3300050507 nmdc:mga05p37_57_c1 nmdc:mga05p37_57_c1_60152_60772 206
263 3300050508 nmdc:mga09592_226_c1 nmdc:mga09592_226_c1_23180_23800 206
264 3300050508 nmdc:mga09592_48479_c1 nmdc:mga09592_48479_c1_575_1195 206
265 3300050509 nmdc:mga0qj67_64724_c1 nmdc:mga0qj67_64724_c1_233_853 206
266 3300050509 nmdc:mga0qj67_75886_c1 nmdc:mga0qj67_75886_c1_367_987 206
267 3300050510 nmdc:mga06r32_109346_c1 nmdc:mga06r32_109346_c1_273_893 206
268 3300050510 nmdc:mga06r32_154_c1 nmdc:mga06r32_154_c1_15624_16244 206
269 3300050510 nmdc:mga06r32_430789_c1 nmdc:mga06r32_430789_c1_54_674 206
270 3300050511 nmdc:mga08y16_14201_c1 nmdc:mga08y16_14201_c1_6163_6783 206
271 3300061734 Ga0530510_0186917 Ga0530510_0186917_756_1376 206
272 3300005981 Ga0081538_10018035 Ga0081538_100180353 207
273 3300005937 Ga0081455_10002933 Ga0081455_1000293328 209
274 3300005937 Ga0081455_10018439 Ga0081455_100184393 209
275 3300006846 Ga0075430_100115697 Ga0075430_1001156971 209
276 3300006847 Ga0075431_100037341 Ga0075431_1000373413 209
277 3300006880 Ga0075429_100219909 Ga0075429_1002199092 209
278 3300027717 Ga0209998_10002713 Ga0209998_100027135 209
279 3300032126 Ga0307415_100188960 Ga0307415_1001889602 209
280 3300042008 Ga0439450_062918 Ga0439450_062918_19_651 209
281 3300042012 Ga0439455_0003639 Ga0439455_0003639_1613_2242 209
282 3300049575 Ga0501039_0426842 Ga0501039_0426842_380_1024 209
283 3300049576 Ga0501040_0134671 Ga0501040_0134671_957_1601 209
284 3300049577 Ga0501041_0205898 Ga0501041_0205898_72_716 209
285 3300049578 Ga0501042_0233555 Ga0501042_0233555_225_869 209
286 3300049588 Ga0501072_0010265 Ga0501072_0010265_225_869 209
287 3300049592 Ga0501076_0044541 Ga0501076_0044541_453_1085 209
288 3300049593 Ga0501077_0107885 Ga0501077_0107885_805_1437 209
289 3300049742 Ga0501080_0131350 Ga0501080_0131350_168_812 209
290 3300050509 nmdc:mga0qj67_34887_c1 nmdc:mga0qj67_34887_c1_850_1485 209
291 3300050509 nmdc:mga0qj67_381746_c1 nmdc:mga0qj67_381746_c1_309_941 209
292 3300050510 nmdc:mga06r32_168852_c1 nmdc:mga06r32_168852_c1_820_1455 209
293 3300050510 nmdc:mga06r32_346584_c1 nmdc:mga06r32_346584_c1_483_1115 209
294 3300054114 Ga0501084_0186010 Ga0501084_0186010_50_694 209
295 3300060353 Ga0501082_0432722 Ga0501082_0432722_244_888 209
296 3300061734 Ga0530510_0090701 Ga0530510_0090701_1082_1726 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

50

185

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uun-assembly3.cif.gz_A crystal structure of n-terminal first spectrin repeat of dystrophin 0.6817 47 164
3uun-assembly3.cif.gz_A crystal structure of n-terminal first spectrin repeat of dystrophin 0.6531 47 164
3uun-assembly3.cif.gz_B crystal structure of n-terminal first spectrin repeat of dystrophin 0.645 49 164
3uun-assembly3.cif.gz_B crystal structure of n-terminal first spectrin repeat of dystrophin 0.6179 49 164
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.571 8 155
ID Description Score Start End Superfamily
af_Q9UPN3_6555_6663_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6899 57 162 1.20.58.60
3uunA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6817 47 164 1.20.58.60
af_Q03001_6707_6815_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6791 49 162 1.20.58.60
af_Q03001_6707_6815_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6591 49 162 1.20.58.60
3uunA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6531 47 164 1.20.58.60
ID Description Score Start End GO Terms
AF-A0A2E9J660-F1-model_v4 TRAP transporter small permease protein 0.9196 63 168 GO:0005886
GO:0022857
AF-A0A2E9J660-F1-model_v4 TRAP transporter small permease protein 0.8879 63 168 GO:0005886
GO:0022857
AF-A0A0R2UZ86-F1-model_v4 TRAP transporter small permease protein 0.8196 56 171 GO:0005886
GO:0022857
AF-A0A6I1ZTD8-F1-model_v4 TRAP transporter small permease subunit 0.8145 57 169 GO:0005886
AF-A0A6I2A2Z9-F1-model_v4 TRAP transporter small permease subunit 0.814 56 169 GO:0005886

Feature Viewer

pLDDT pTM Quality
64.74 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map