F393314

General Info

Members Datasets Scaffolds Average Seq Length
296 188 592 229

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1483152|Ga0436365_1483152_48_821
Length 257
Sequence VRLAAEAEAAIPATAGLNVNPRAILHALTMANPVFLITGASSGIGEATARHAAEAGYRVVLAARSSDRLDQLAASLGGAERALAVQCDVAEWEQQQAMVAAALEHFGRLDVVFANAGFGAARGFLEESVEHWRAMVLTNVYGAALTIRATLAALKDTRGHLLLTGSVAGRRALPGSLYSATKWAVTGMGESARQELNGTGVRVTLIEPGKVSTEFFEDPVENGLEADDIARAVMYAISQPPHVDVNEILIRPTAQEN

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
188 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.34
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0.34
Rhizoplane 12.16
Rhizosphere 81.76
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1483152 3300039437 Bacteria 1832
2 rootL2_10248204 3300003322 Bacteria 1474
3 Ga0070682_100393838 3300005337 Bacteria 1046
4 Ga0068868_100045772 3300005338 Bacteria 3424
5 Ga0070691_10025833 3300005341 Bacteria 2736
6 Ga0070709_10041876 3300005434 Bacteria 2824
7 Ga0070714_100009285 3300005435 Bacteria 7730
8 Ga0070714_100024650 3300005435 Bacteria 4956
9 Ga0070714_100530301 3300005435 Bacteria 1125
10 Ga0070714_100991315 3300005435 Bacteria 817
11 Ga0070713_100007509 3300005436 Bacteria 7660
12 Ga0070713_100402424 3300005436 Bacteria 1279
13 Ga0070713_100880826 3300005436 Bacteria 860
14 Ga0070710_10029700 3300005437 Bacteria 2934
15 Ga0070711_100071894 3300005439 Bacteria 2439
16 Ga0070700_100032995 3300005441 Bacteria 3116
17 Ga0070679_100693616 3300005530 Bacteria 961
18 Ga0070672_100262858 3300005543 Bacteria 1456
19 Ga0070695_100435666 3300005545 Bacteria 1001
20 Ga0070693_100262241 3300005547 Bacteria 1150
21 Ga0070704_100040596 3300005549 Bacteria 3205
22 Ga0070664_100183787 3300005564 Bacteria 1859
23 Ga0068856_100012113 3300005614 Bacteria 8352
24 Ga0068856_100015429 3300005614 Bacteria 7383
25 Ga0068856_100160421 3300005614 Bacteria 2259
26 Ga0070702_100202215 3300005615 Bacteria 1316
27 Ga0068852_100051604 3300005616 Bacteria 3531
28 Ga0068866_10401858 3300005718 Bacteria 884
29 Ga0068861_100455188 3300005719 Bacteria 1148
30 Ga0081455_10228849 3300005937 Bacteria 1373
31 Ga0081538_10010117 3300005981 Bacteria 7761
32 Ga0081540_1000943 3300005983 Bacteria 26189
33 Ga0081539_10000427 3300005985 Bacteria 89575
34 Ga0081539_10002674 3300005985 Bacteria 24249
35 Ga0070717_10073462 3300006028 Bacteria 2858
36 Ga0070717_10109757 3300006028 Bacteria 2352
37 Ga0070717_10482504 3300006028 Bacteria 1119
38 Ga0070717_10550512 3300006028 Bacteria 1045
39 Ga0075365_10003532 3300006038 Bacteria 8082
40 Ga0070715_10000176 3300006163 Bacteria 14876
41 Ga0070716_100036121 3300006173 Bacteria 2722
42 Ga0070712_100004573 3300006175 Bacteria 8544
43 Ga0075428_100362313 3300006844 Bacteria 1555
44 Ga0075428_100366668 3300006844 Bacteria 1545
45 Ga0075431_100411087 3300006847 Bacteria 1353
46 Ga0075433_10164686 3300006852 Bacteria 1973
47 Ga0075433_10440211 3300006852 Bacteria 1149
48 Ga0075434_100001194 3300006871 Bacteria 21560
49 Ga0075435_100247655 3300007076 Bacteria 1517
50 Ga0105240_10437184 3300009093 Bacteria 1467
51 Ga0111539_10999693 3300009094 Bacteria 972
52 Ga0105245_10088429 3300009098 Bacteria 2846
53 Ga0105245_10368031 3300009098 Bacteria 1428
54 Ga0105245_10548342 3300009098 Bacteria 1178
55 Ga0114129_10012418 3300009147 Bacteria 12124
56 Ga0105243_10148283 3300009148 Unclassified 2010
57 Ga0105238_11137670 3300009551 Bacteria 804
58 Ga0105249_10253092 3300009553 Bacteria 1747
59 Ga0105249_10397262 3300009553 Bacteria 1408
60 Ga0105249_10450165 3300009553 Unclassified 1326
61 Ga0105239_10291278 3300010375 Bacteria 1838
62 Ga0157371_10315360 3300013102 Bacteria 1134
63 Ga0157369_10092202 3300013105 Bacteria 3233
64 Ga0157374_10013446 3300013296 Bacteria 7143
65 Ga0163162_10304446 3300013306 Bacteria 1726
66 Ga0157380_10637929 3300014326 Bacteria 1060
67 Ga0157377_10461050 3300014745 Bacteria 880
68 Ga0157379_10308460 3300014968 Bacteria 1443
69 Ga0206354_10944073 3300020081 Bacteria 1862
70 Ga0213873_10002462 3300021358 Bacteria 3203
71 Ga0213875_10000050 3300021388 Bacteria 143822
72 Ga0213875_10022724 3300021388 Bacteria 2999
73 Ga0207426_1039390 3300025302 Bacteria 1481
74 Ga0207692_10011020 3300025898 Bacteria 3828
75 Ga0207692_10052619 3300025898 Bacteria 2070
76 Ga0207692_10373908 3300025898 Bacteria 883
77 Ga0207685_10053473 3300025905 Bacteria 1569
78 Ga0207699_10004354 3300025906 Bacteria 6772
79 Ga0207699_10087660 3300025906 Bacteria 1946
80 Ga0207695_10392136 3300025913 Bacteria 1273
81 Ga0207693_10004097 3300025915 Bacteria 12388
82 Ga0207693_10008315 3300025915 Bacteria 8492
83 Ga0207663_10038404 3300025916 Bacteria 2894
84 Ga0207687_10017615 3300025927 Bacteria 4705
85 Ga0207687_10505936 3300025927 Bacteria 1009
86 Ga0207700_10257838 3300025928 Bacteria 1492
87 Ga0207700_10370663 3300025928 Bacteria 1250
88 Ga0207700_10715301 3300025928 Bacteria 894
89 Ga0207664_10000650 3300025929 Bacteria 24061
90 Ga0207664_10118771 3300025929 Bacteria 2209
91 Ga0207664_10681060 3300025929 Bacteria 925
92 Ga0207690_10028004 3300025932 Bacteria 3567
93 Ga0207709_10259745 3300025935 Unclassified 1273
94 Ga0207669_10452550 3300025937 Bacteria 1018
95 Ga0207665_10169772 3300025939 Bacteria 1574
96 Ga0207691_10681717 3300025940 Bacteria 867
97 Ga0207661_10287568 3300025944 Bacteria 1471
98 Ga0207712_10318199 3300025961 Bacteria 1283
99 Ga0207668_10262916 3300025972 Bacteria 1407
100 Ga0207668_10681939 3300025972 Bacteria 902
101 Ga0207677_10030284 3300026023 Bacteria 3452
102 Ga0207677_10101337 3300026023 Bacteria 2120
103 Ga0207677_10339841 3300026023 Bacteria 1254
104 Ga0207708_10202452 3300026075 Bacteria 1584
105 Ga0207702_10013180 3300026078 Bacteria 6874
106 Ga0207648_10093446 3300026089 Bacteria 2630
107 Ga0207676_10134287 3300026095 Bacteria 2109
108 Ga0207675_100021981 3300026118 Bacteria 5939
109 Ga0207675_100093453 3300026118 Bacteria 2829
110 Ga0207675_100127538 3300026118 Bacteria 2411
111 Ga0207428_10269417 3300027907 Bacteria 1266
112 Ga0265338_10016219 3300028800 Bacteria 8121
113 Ga0265327_10014948 3300031251 Bacteria 5048
114 Ga0265327_10115629 3300031251 Bacteria 1277
115 Ga0307408_100474607 3300031548 Bacteria 1090
116 Ga0307405_10004276 3300031731 Bacteria 6725
117 Ga0307405_10256984 3300031731 Bacteria 1303
118 Ga0307413_10161993 3300031824 Bacteria 1573
119 Ga0307413_10184685 3300031824 Bacteria 1491
120 Ga0307413_10282749 3300031824 Bacteria 1249
121 Ga0307410_10045091 3300031852 Bacteria 2933
122 Ga0307410_10466533 3300031852 Bacteria 1033
123 Ga0307406_10044827 3300031901 Bacteria 2773
124 Ga0307412_10271544 3300031911 Bacteria 1327
125 Ga0307416_100208125 3300032002 Bacteria 1863
126 Ga0307416_100558424 3300032002 Bacteria 1219
127 Ga0307414_10240412 3300032004 Bacteria 1499
128 Ga0307411_10013440 3300032005 Bacteria 4518
129 Ga0307415_100178496 3300032126 Bacteria 1663
130 Ga0307415_100994730 3300032126 Bacteria 779
131 Ga0373923_0301285 3300035111 Bacteria 758
132 Ga0373945_0053621 3300035116 Bacteria 1489
133 Ga0373924_0031775 3300035410 Bacteria 2125
134 Ga0373927_0183542 3300035695 Bacteria 1373
135 Ga0395900_0163424 3300037418 Bacteria 2270
136 Ga0395898_0574376 3300037466 Bacteria 1070
137 Ga0395905_0089163 3300037471 Bacteria 2891
138 Ga0436364_0344394 3300037853 Bacteria 19362
139 Ga0436364_0750607 3300037853 Bacteria 104121
140 Ga0436364_1048543 3300037853 Bacteria 1947
141 Ga0436364_1269393 3300037853 Bacteria 5020
142 Ga0436364_1292807 3300037853 Bacteria 1854
143 Ga0436365_0329952 3300039437 Bacteria 1486
144 Ga0436365_0848463 3300039437 Bacteria 4862
145 Ga0436361_1162873 3300039447 Bacteria 2136
146 Ga0436363_0422117 3300039450 Bacteria 1984
147 Ga0436362_0455804 3300039453 Bacteria 3372
148 Ga0466966_0123745 3300044684 Bacteria 1587
149 Ga0466961_0075366 3300044693 Bacteria 2139
150 Ga0466961_0274739 3300044693 Bacteria 1032
151 Ga0466961_0306656 3300044693 Bacteria 969
152 Ga0466963_0002425 3300044694 Bacteria 10425
153 Ga0466963_0004240 3300044694 Bacteria 8317
154 Ga0466963_0007235 3300044694 Bacteria 6619
155 Ga0466963_0009780 3300044694 Bacteria 5784
156 Ga0466963_0015205 3300044694 Bacteria 4760
157 Ga0466964_0049221 3300044706 Bacteria 1725
158 Ga0466971_0048796 3300044719 Bacteria 1904
159 Ga0466971_0064418 3300044719 Bacteria 1659
160 Ga0466971_0069947 3300044719 Bacteria 1593
161 Ga0466971_0070474 3300044719 Bacteria 1587
162 Ga0466970_0012758 3300044765 Bacteria 4301
163 Ga0466957_0018577 3300044842 Bacteria 4084
164 Ga0466957_0111630 3300044842 Bacteria 1734
165 Ga0466959_0000644 3300045049 Bacteria 20310
166 Ga0466959_0086698 3300045049 Bacteria 2252
167 Ga0466959_0088095 3300045049 Bacteria 2232
168 Ga0466959_0231593 3300045049 Bacteria 1278
169 Ga0466959_0274292 3300045049 Bacteria 1159
170 Ga0466959_0356121 3300045049 Bacteria 997
171 Ga0466959_0538629 3300045049 Bacteria 788
172 Ga0466958_0005965 3300045836 Bacteria 6592
173 Ga0466958_0014130 3300045836 Bacteria 4555
174 Ga0466958_0053040 3300045836 Bacteria 2459
175 Ga0466958_0106282 3300045836 Bacteria 1750
176 Ga0466958_0232515 3300045836 Bacteria 1177
177 Ga0466958_0271445 3300045836 Bacteria 1086
178 Ga0466967_0019264 3300045976 Bacteria 5483
179 Ga0466967_0100290 3300045976 Bacteria 2645
180 Ga0466967_0957353 3300045976 Bacteria 852
181 Ga0466967_0974116 3300045976 Bacteria 844
182 Ga0495627_052776 3300046453 Bacteria 1219
183 Ga0495592_0039722 3300046454 Bacteria 3534
184 Ga0495653_0036712 3300046463 Bacteria 3857
185 Ga0495582_0146507 3300046473 Bacteria 1339
186 Ga0495605_0274416 3300046474 Bacteria 718
187 Ga0495664_0101368 3300046477 Bacteria 1735
188 Ga0495608_0025281 3300046511 Bacteria 4053
189 Ga0495628_0126086 3300046516 Bacteria 1961
190 Ga0495652_0036389 3300046529 Bacteria 4281
191 Ga0495652_0293207 3300046529 Bacteria 1186
192 Ga0495640_0104454 3300046533 Bacteria 1857
193 Ga0495640_0322732 3300046533 Bacteria 956
194 Ga0495587_0008734 3300046536 Bacteria 6500
195 Ga0495598_0086079 3300046537 Bacteria 1017
196 Ga0495667_0016463 3300046559 Bacteria 4995
197 Ga0495668_0316652 3300046616 Bacteria 856
198 Ga0495635_0004028 3300046663 Bacteria 10199
199 Ga0495657_0029105 3300046675 Bacteria 3877
200 Ga0495599_0008455 3300046678 Bacteria 6257
201 Ga0495623_0114361 3300046679 Bacteria 1632
202 Ga0495646_0051395 3300046680 Bacteria 2494
203 Ga0495646_0130553 3300046680 Bacteria 1415
204 Ga0495613_0295579 3300046689 Bacteria 1122
205 Ga0495604_0042169 3300047317 Bacteria 3577
206 Ga0495674_0196349 3300047319 Bacteria 1676
207 Ga0495674_0328766 3300047319 Bacteria 1244
208 Ga0495676_0151201 3300047321 Bacteria 1652
209 Ga0495680_0031051 3300047322 Bacteria 4352
210 Ga0495680_0174196 3300047322 Bacteria 1556
211 Ga0495684_0116147 3300047471 Bacteria 2017
212 Ga0495602_0405380 3300048088 Bacteria 971
213 Ga0496100_0441568 3300048903 Bacteria 996
214 Ga0496101_0555765 3300048904 Bacteria 908
215 Ga0496102_0033943 3300048905 Bacteria 4588
216 Ga0496102_0090728 3300048905 Bacteria 2828
217 Ga0496103_0371765 3300048906 Bacteria 919
218 Ga0496104_0050464 3300048907 Bacteria 3925
219 Ga0496104_0234661 3300048907 Bacteria 1746
220 Ga0496105_0033846 3300048908 Bacteria 4199
221 Ga0496105_0110443 3300048908 Bacteria 2270
222 Ga0496108_0075084 3300048911 Bacteria 2855
223 Ga0496108_0162838 3300048911 Bacteria 1928
224 Ga0496108_0481104 3300048911 Bacteria 1085
225 Ga0496108_0780386 3300048911 Bacteria 825
226 Ga0496109_0001964 3300048912 Bacteria 17052
227 Ga0496109_0050779 3300048912 Bacteria 3776
228 Ga0496109_0054449 3300048912 Bacteria 3650
229 Ga0496109_0080725 3300048912 Bacteria 2997
230 Ga0496109_0085767 3300048912 Bacteria 2907
231 Ga0496110_0004233 3300048913 Bacteria 11103
232 Ga0496110_0005813 3300048913 Bacteria 9693
233 Ga0496110_0126967 3300048913 Bacteria 2302
234 Ga0496110_0216171 3300048913 Bacteria 1743
235 Ga0496110_0280734 3300048913 Bacteria 1516
236 Ga0496111_0005273 3300048914 Bacteria 8251
237 Ga0496111_0067812 3300048914 Bacteria 2592
238 Ga0496112_0099933 3300048915 Bacteria 2871
239 Ga0496112_0390300 3300048915 Bacteria 1332
240 Ga0496113_0003306 3300048916 Bacteria 9625
241 Ga0496113_0048622 3300048916 Bacteria 3156
242 Ga0496113_0085702 3300048916 Bacteria 2420
243 Ga0496113_0108962 3300048916 Bacteria 2153
244 Ga0496113_0147122 3300048916 Bacteria 1857
245 Ga0496113_0414413 3300048916 Bacteria 1082
246 Ga0496114_0353515 3300048917 Bacteria 1300
247 Ga0496114_0714808 3300048917 Bacteria 878
248 Ga0496115_0164281 3300048918 Bacteria 1836
249 Ga0496121_0002372 3300048924 Bacteria 28962
250 Ga0496121_0176929 3300048924 Bacteria 1544
251 Ga0496124_0025667 3300048927 Bacteria 5331
252 Ga0501031_0190661 3300049568 Bacteria 1339
253 Ga0501036_0173685 3300049572 Bacteria 1815
254 Ga0501039_0095807 3300049575 Bacteria 2314
255 Ga0501039_0551706 3300049575 Bacteria 904
256 Ga0501040_0331671 3300049576 Bacteria 1089
257 Ga0501041_0397480 3300049577 Bacteria 873
258 Ga0501042_0050789 3300049578 Bacteria 2958
259 Ga0501042_0114286 3300049578 Bacteria 1944
260 Ga0501046_0488867 3300049580 Bacteria 882
261 Ga0501067_0027697 3300049583 Bacteria 3140
262 Ga0501068_0004349 3300049584 Bacteria 7699
263 Ga0501069_0010998 3300049585 Bacteria 4800
264 Ga0501071_0114403 3300049587 Bacteria 1996
265 Ga0501072_0008487 3300049588 Bacteria 7795
266 Ga0501072_0331812 3300049588 Bacteria 1208
267 Ga0501072_0363391 3300049588 Bacteria 1149
268 Ga0501074_0201871 3300049590 Bacteria 1417
269 Ga0501075_0408621 3300049591 Bacteria 1035
270 Ga0501075_0752879 3300049591 Bacteria 741
271 Ga0501076_0075747 3300049592 Bacteria 2697
272 Ga0501076_0353876 3300049592 Bacteria 1206
273 Ga0501079_0017853 3300049741 Bacteria 5419
274 Ga0501035_0541162 3300049822 Bacteria 955
275 Ga0501045_0181168 3300049824 Bacteria 1570
276 nmdc:mga05p37_9202_c1 3300050507 Bacteria 11674
277 nmdc:mga0qj67_198929_c1 3300050509 Bacteria 1628
278 nmdc:mga06r32_800534_c1 3300050510 Bacteria 903
279 nmdc:mga0n895_52756_c1 3300050512 Bacteria 3993
280 nmdc:mga0rr50_216583_c1 3300050513 Bacteria 1580
281 nmdc:mga0a205_197705_c1 3300050515 Bacteria 1901
282 nmdc:mga0a205_97371_c1 3300050515 Bacteria 2841
283 Ga0495601_0296494 3300053077 Bacteria 1054
284 Ga0495612_0243437 3300053078 Bacteria 799
285 Ga0495655_0110221 3300053083 Bacteria 826
286 Ga0495595_0005374 3300053084 Bacteria 5188
287 Ga0495619_0002364 3300053085 Bacteria 12403
288 Ga0495619_0318051 3300053085 Bacteria 1077
289 Ga0501084_0233955 3300054114 Bacteria 1551
290 Ga0501082_0176756 3300060353 Bacteria 1856
291 Ga0501082_0392722 3300060353 Bacteria 1211
292 Ga0466962_0042841 3300061719 Bacteria 2167
293 Ga0466962_0064395 3300061719 Bacteria 1750
294 Ga0466962_0067574 3300061719 Bacteria 1707
295 Ga0530510_0570732 3300061734 Bacteria 860
296 2842336385 2842333319 Bacteria 8899485
297 Ga0436365_1483152
298 rootL2_10248204
299 Ga0070682_100393838
300 Ga0068868_100045772
301 Ga0070691_10025833
302 Ga0070709_10041876
303 Ga0070714_100009285
304 Ga0070714_100024650
305 Ga0070714_100530301
306 Ga0070714_100991315
307 Ga0070713_100007509
308 Ga0070713_100402424
309 Ga0070713_100880826
310 Ga0070710_10029700
311 Ga0070711_100071894
312 Ga0070700_100032995
313 Ga0070679_100693616
314 Ga0070672_100262858
315 Ga0070695_100435666
316 Ga0070693_100262241
317 Ga0070704_100040596
318 Ga0070664_100183787
319 Ga0068856_100012113
320 Ga0068856_100015429
321 Ga0068856_100160421
322 Ga0070702_100202215
323 Ga0068852_100051604
324 Ga0068866_10401858
325 Ga0068861_100455188
326 Ga0081455_10228849
327 Ga0081538_10010117
328 Ga0081540_1000943
329 Ga0081539_10000427
330 Ga0081539_10002674
331 Ga0070717_10073462
332 Ga0070717_10109757
333 Ga0070717_10482504
334 Ga0070717_10550512
335 Ga0075365_10003532
336 Ga0070715_10000176
337 Ga0070716_100036121
338 Ga0070712_100004573
339 Ga0075428_100362313
340 Ga0075428_100366668
341 Ga0075431_100411087
342 Ga0075433_10164686
343 Ga0075433_10440211
344 Ga0075434_100001194
345 Ga0075435_100247655
346 Ga0105240_10437184
347 Ga0111539_10999693
348 Ga0105245_10088429
349 Ga0105245_10368031
350 Ga0105245_10548342
351 Ga0114129_10012418
352 Ga0105243_10148283
353 Ga0105238_11137670
354 Ga0105249_10253092
355 Ga0105249_10397262
356 Ga0105249_10450165
357 Ga0105239_10291278
358 Ga0157371_10315360
359 Ga0157369_10092202
360 Ga0157374_10013446
361 Ga0163162_10304446
362 Ga0157380_10637929
363 Ga0157377_10461050
364 Ga0157379_10308460
365 Ga0206354_10944073
366 Ga0213873_10002462
367 Ga0213875_10000050
368 Ga0213875_10022724
369 Ga0207426_1039390
370 Ga0207692_10011020
371 Ga0207692_10052619
372 Ga0207692_10373908
373 Ga0207685_10053473
374 Ga0207699_10004354
375 Ga0207699_10087660
376 Ga0207695_10392136
377 Ga0207693_10004097
378 Ga0207693_10008315
379 Ga0207663_10038404
380 Ga0207687_10017615
381 Ga0207687_10505936
382 Ga0207700_10257838
383 Ga0207700_10370663
384 Ga0207700_10715301
385 Ga0207664_10000650
386 Ga0207664_10118771
387 Ga0207664_10681060
388 Ga0207690_10028004
389 Ga0207709_10259745
390 Ga0207669_10452550
391 Ga0207665_10169772
392 Ga0207691_10681717
393 Ga0207661_10287568
394 Ga0207712_10318199
395 Ga0207668_10262916
396 Ga0207668_10681939
397 Ga0207677_10030284
398 Ga0207677_10101337
399 Ga0207677_10339841
400 Ga0207708_10202452
401 Ga0207702_10013180
402 Ga0207648_10093446
403 Ga0207676_10134287
404 Ga0207675_100021981
405 Ga0207675_100093453
406 Ga0207675_100127538
407 Ga0207428_10269417
408 Ga0265338_10016219
409 Ga0265327_10014948
410 Ga0265327_10115629
411 Ga0307408_100474607
412 Ga0307405_10004276
413 Ga0307405_10256984
414 Ga0307413_10161993
415 Ga0307413_10184685
416 Ga0307413_10282749
417 Ga0307410_10045091
418 Ga0307410_10466533
419 Ga0307406_10044827
420 Ga0307412_10271544
421 Ga0307416_100208125
422 Ga0307416_100558424
423 Ga0307414_10240412
424 Ga0307411_10013440
425 Ga0307415_100178496
426 Ga0307415_100994730
427 Ga0373923_0301285
428 Ga0373945_0053621
429 Ga0373924_0031775
430 Ga0373927_0183542
431 Ga0395900_0163424
432 Ga0395898_0574376
433 Ga0395905_0089163
434 Ga0436364_0344394
435 Ga0436364_0750607
436 Ga0436364_1048543
437 Ga0436364_1269393
438 Ga0436364_1292807
439 Ga0436365_0329952
440 Ga0436365_0848463
441 Ga0436361_1162873
442 Ga0436363_0422117
443 Ga0436362_0455804
444 Ga0466966_0123745
445 Ga0466961_0075366
446 Ga0466961_0274739
447 Ga0466961_0306656
448 Ga0466963_0002425
449 Ga0466963_0004240
450 Ga0466963_0007235
451 Ga0466963_0009780
452 Ga0466963_0015205
453 Ga0466964_0049221
454 Ga0466971_0048796
455 Ga0466971_0064418
456 Ga0466971_0069947
457 Ga0466971_0070474
458 Ga0466970_0012758
459 Ga0466957_0018577
460 Ga0466957_0111630
461 Ga0466959_0000644
462 Ga0466959_0086698
463 Ga0466959_0088095
464 Ga0466959_0231593
465 Ga0466959_0274292
466 Ga0466959_0356121
467 Ga0466959_0538629
468 Ga0466958_0005965
469 Ga0466958_0014130
470 Ga0466958_0053040
471 Ga0466958_0106282
472 Ga0466958_0232515
473 Ga0466958_0271445
474 Ga0466967_0019264
475 Ga0466967_0100290
476 Ga0466967_0957353
477 Ga0466967_0974116
478 Ga0495627_052776
479 Ga0495592_0039722
480 Ga0495653_0036712
481 Ga0495582_0146507
482 Ga0495605_0274416
483 Ga0495664_0101368
484 Ga0495608_0025281
485 Ga0495628_0126086
486 Ga0495652_0036389
487 Ga0495652_0293207
488 Ga0495640_0104454
489 Ga0495640_0322732
490 Ga0495587_0008734
491 Ga0495598_0086079
492 Ga0495667_0016463
493 Ga0495668_0316652
494 Ga0495635_0004028
495 Ga0495657_0029105
496 Ga0495599_0008455
497 Ga0495623_0114361
498 Ga0495646_0051395
499 Ga0495646_0130553
500 Ga0495613_0295579
501 Ga0495604_0042169
502 Ga0495674_0196349
503 Ga0495674_0328766
504 Ga0495676_0151201
505 Ga0495680_0031051
506 Ga0495680_0174196
507 Ga0495684_0116147
508 Ga0495602_0405380
509 Ga0496100_0441568
510 Ga0496101_0555765
511 Ga0496102_0033943
512 Ga0496102_0090728
513 Ga0496103_0371765
514 Ga0496104_0050464
515 Ga0496104_0234661
516 Ga0496105_0033846
517 Ga0496105_0110443
518 Ga0496108_0075084
519 Ga0496108_0162838
520 Ga0496108_0481104
521 Ga0496108_0780386
522 Ga0496109_0001964
523 Ga0496109_0050779
524 Ga0496109_0054449
525 Ga0496109_0080725
526 Ga0496109_0085767
527 Ga0496110_0004233
528 Ga0496110_0005813
529 Ga0496110_0126967
530 Ga0496110_0216171
531 Ga0496110_0280734
532 Ga0496111_0005273
533 Ga0496111_0067812
534 Ga0496112_0099933
535 Ga0496112_0390300
536 Ga0496113_0003306
537 Ga0496113_0048622
538 Ga0496113_0085702
539 Ga0496113_0108962
540 Ga0496113_0147122
541 Ga0496113_0414413
542 Ga0496114_0353515
543 Ga0496114_0714808
544 Ga0496115_0164281
545 Ga0496121_0002372
546 Ga0496121_0176929
547 Ga0496124_0025667
548 Ga0501031_0190661
549 Ga0501036_0173685
550 Ga0501039_0095807
551 Ga0501039_0551706
552 Ga0501040_0331671
553 Ga0501041_0397480
554 Ga0501042_0050789
555 Ga0501042_0114286
556 Ga0501046_0488867
557 Ga0501067_0027697
558 Ga0501068_0004349
559 Ga0501069_0010998
560 Ga0501071_0114403
561 Ga0501072_0008487
562 Ga0501072_0331812
563 Ga0501072_0363391
564 Ga0501074_0201871
565 Ga0501075_0408621
566 Ga0501075_0752879
567 Ga0501076_0075747
568 Ga0501076_0353876
569 Ga0501079_0017853
570 Ga0501035_0541162
571 Ga0501045_0181168
572 nmdc:mga05p37_9202_c1
573 nmdc:mga0qj67_198929_c1
574 nmdc:mga06r32_800534_c1
575 nmdc:mga0n895_52756_c1
576 nmdc:mga0rr50_216583_c1
577 nmdc:mga0a205_197705_c1
578 nmdc:mga0a205_97371_c1
579 Ga0495601_0296494
580 Ga0495612_0243437
581 Ga0495655_0110221
582 Ga0495595_0005374
583 Ga0495619_0002364
584 Ga0495619_0318051
585 Ga0501084_0233955
586 Ga0501082_0176756
587 Ga0501082_0392722
588 Ga0466962_0042841
589 Ga0466962_0064395
590 Ga0466962_0067574
591 Ga0530510_0570732
592 2842336385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

33

222

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

39

244

0.88

PF08659

KR

KR domain

33

208

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9511 4 226
2jap-assembly1.cif.gz_C clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta-lactamase inhibitor clavulanic acid 0.9441 3 227
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9426 4 226
1nff-assembly1.cif.gz_A crystal structure of rv2002 gene product from mycobacterium tuberculosis 0.9415 4 223
3l77-assembly1.cif.gz_A x-ray structure alcohol dehydrogenase from archaeon thermococcus sibiricus complexed with 5-hydroxy-nadp 0.9412 4 228
ID Description Score Start End Superfamily
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9616 2 92 3.40.50.720
af_Q2FVD5_4_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9535 1 224 3.40.50.720
3p19C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.952 4 226 3.40.50.720
3p19C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9435 4 226 3.40.50.720
af_O33263_1_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9429 3 208 3.40.50.720
ID Description Score Start End GO Terms
AF-Q1YK94-F1-model_v4 Dehydrogenase/oxidoreductase 0.9789 4 226 GO:0016020
GO:0016491
AF-A0A5C5G813-F1-model_v4 SDR family oxidoreductase 0.9776 3 224 GO:0016020
GO:0016491
AF-A0A6I4UY73-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9756 4 225 GO:0016020
GO:0016491
AF-A0A2Z4K1B1-F1-model_v4 Short-chain dehydrogenase 0.9755 3 225 GO:0016020
GO:0016491
AF-A0A7C9NYU1-F1-model_v4 deleted 0.9754 4 224

Map