F393311

General Info

Members Datasets Scaffolds Average Seq Length
296 180 592 338

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0112315|Ga0436365_0112315_3158_4183
Length 341
Sequence MRAILAAVLLSLLALPAAAQPAKNDDVYKYAGADREAKLLARAKQEGAVVLYTSLAPTESKPLAEAFEKKYGIKVDLWRALSDKVLQRVVTEGQANRHVVDVVETNGPEMEAIAQERLLAEVNSPFIADLPQDGIPAHRSWYPDRLNFFVVGYNTQRVKREELPKTYDGFLDPKWKGRIGLEATDSEWMAALVKKGGATGMDFMRKLAAMRPDVRKGHVLLAQLVATGEIPVGLTLYNANVESLKMKGAPIDFVPVQPVVARPQGIGVARNAPHPAAALLFLDFVLSPEGQKLYESMGRVPASTKVKSALNDFPFVMTDPGTILREAQKWDALWNELFISK

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
130 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
133 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
178 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 0.68
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 20.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0112315 3300039437 Bacteria 5736
2 SwRhRL2b_contig_129330 2162886007 Unclassified 2732
3 Ga0065704_10090765 3300005289 Unclassified 2765
4 Ga0065712_10188729 3300005290 Bacteria 1158
5 Ga0070658_10047835 3300005327 Bacteria 3461
6 Ga0070676_10078863 3300005328 Bacteria 1993
7 Ga0070683_100035662 3300005329 Bacteria 4547
8 Ga0070683_100491505 3300005329 Bacteria 1172
9 Ga0070670_100062887 3300005331 Bacteria 3186
10 Ga0068868_100088601 3300005338 Unclassified 2491
11 Ga0070689_100004532 3300005340 Bacteria 9406
12 Ga0070689_100005034 3300005340 Bacteria 8982
13 Ga0070689_100010085 3300005340 Bacteria 6726
14 Ga0070689_100023944 3300005340 Bacteria 4577
15 Ga0070689_100238541 3300005340 Bacteria 1497
16 Ga0070692_10119862 3300005345 Bacteria 1466
17 Ga0070669_100012693 3300005353 Bacteria 5980
18 Ga0070675_100000858 3300005354 Bacteria 21610
19 Ga0070675_100004786 3300005354 Bacteria 10321
20 Ga0070675_100035256 3300005354 Bacteria 4064
21 Ga0070671_100020972 3300005355 Bacteria 5331
22 Ga0070673_100033103 3300005364 Bacteria 3898
23 Ga0070673_100124057 3300005364 Unclassified 2159
24 Ga0070673_100131420 3300005364 Unclassified 2101
25 Ga0070673_100260470 3300005364 Bacteria 1515
26 Ga0070688_100029933 3300005365 Bacteria 3264
27 Ga0070659_100038956 3300005366 Bacteria 3709
28 Ga0070713_100032126 3300005436 Unclassified 4189
29 Ga0070701_10003079 3300005438 Bacteria 6538
30 Ga0070701_10144442 3300005438 Bacteria 1364
31 Ga0070700_100079064 3300005441 Unclassified 2119
32 Ga0070694_100032003 3300005444 Bacteria 3451
33 Ga0070681_10039880 3300005458 Bacteria 4708
34 Ga0070681_10370829 3300005458 Bacteria 1342
35 Ga0068867_100001733 3300005459 Bacteria 15197
36 Ga0068867_100032232 3300005459 Bacteria 3788
37 Ga0068867_100197220 3300005459 Unclassified 1610
38 Ga0070685_10025980 3300005466 Bacteria 3226
39 Ga0070707_100270833 3300005468 Bacteria 1651
40 Ga0070698_100000929 3300005471 Bacteria 32009
41 Ga0070698_100331078 3300005471 Viruses 1454
42 Ga0070699_100002294 3300005518 Bacteria 17216
43 Ga0070699_100028723 3300005518 Bacteria 4796
44 Ga0070699_100177985 3300005518 Unclassified 1886
45 Ga0070679_100197242 3300005530 Unclassified 1980
46 Ga0070679_100204231 3300005530 Bacteria 1941
47 Ga0070684_100186569 3300005535 Bacteria 1886
48 Ga0068853_100073359 3300005539 Bacteria 2984
49 Ga0070672_100219842 3300005543 Bacteria 1593
50 Ga0070696_100059047 3300005546 Bacteria 2680
51 Ga0070696_100111895 3300005546 Unclassified 1967
52 Ga0070693_100048390 3300005547 Bacteria 2421
53 Ga0070693_100200969 3300005547 Unclassified 1294
54 Ga0070665_100225998 3300005548 Bacteria 1872
55 Ga0070704_100000241 3300005549 Bacteria 23436
56 Ga0070704_100004620 3300005549 Bacteria 7966
57 Ga0070704_100078127 3300005549 Unclassified 2427
58 Ga0068855_100008189 3300005563 Bacteria 12635
59 Ga0068855_100022998 3300005563 Bacteria 7471
60 Ga0068855_100134277 3300005563 Bacteria 2824
61 Ga0070664_100063361 3300005564 Bacteria 3152
62 Ga0070664_100333462 3300005564 Bacteria 1377
63 Ga0068857_100013243 3300005577 Bacteria 7185
64 Ga0068857_100044190 3300005577 Bacteria 3951
65 Ga0068856_100022764 3300005614 Bacteria 6093
66 Ga0068856_100101981 3300005614 Bacteria 2863
67 Ga0068852_100001065 3300005616 Bacteria 18109
68 Ga0068852_100002049 3300005616 Bacteria 13738
69 Ga0068852_100074747 3300005616 Bacteria 2986
70 Ga0068852_100221008 3300005616 Bacteria 1801
71 Ga0068859_100004257 3300005617 Bacteria 14615
72 Ga0068859_100004351 3300005617 Bacteria 14452
73 Ga0068864_100038892 3300005618 Bacteria 4064
74 Ga0068861_100064698 3300005719 Bacteria 2814
75 Ga0068851_10008032 3300005834 Bacteria 4868
76 Ga0068870_10002848 3300005840 Bacteria 7279
77 Ga0068870_10075591 3300005840 Bacteria 1848
78 Ga0068863_100057236 3300005841 Bacteria 3690
79 Ga0068858_100026040 3300005842 Bacteria 5439
80 Ga0068858_100108686 3300005842 Bacteria 2589
81 Ga0068858_100260102 3300005842 Unclassified 1649
82 Ga0068860_100005055 3300005843 Bacteria 13424
83 Ga0068860_100291542 3300005843 Bacteria 1597
84 Ga0068862_100001515 3300005844 Bacteria 21305
85 Ga0070716_100050370 3300006173 Bacteria 2363
86 Ga0070716_100152605 3300006173 Unclassified 1488
87 Ga0075366_10011489 3300006195 Bacteria 5001
88 Ga0097621_100008366 3300006237 Bacteria 7446
89 Ga0097621_100017738 3300006237 Bacteria 5415
90 Ga0097621_100110032 3300006237 Unclassified 2327
91 Ga0068871_100027518 3300006358 Bacteria 4448
92 Ga0068871_100241502 3300006358 Unclassified 1570
93 Ga0075428_100033551 3300006844 Bacteria 5667
94 Ga0075428_100063935 3300006844 Bacteria 4029
95 Ga0075428_100196910 3300006844 Bacteria 2179
96 Ga0075430_100000498 3300006846 Bacteria 29452
97 Ga0075430_100012011 3300006846 Bacteria 7370
98 Ga0075430_100017098 3300006846 Bacteria 6178
99 Ga0075431_100101828 3300006847 Bacteria 2964
100 Ga0075433_10080305 3300006852 Bacteria 2875
101 Ga0075434_100071828 3300006871 Unclassified 3453
102 Ga0075434_100084158 3300006871 Bacteria 3179
103 Ga0075434_100107517 3300006871 Bacteria 2800
104 Ga0068865_100150317 3300006881 Bacteria 1766
105 Ga0068865_100186704 3300006881 Unclassified 1600
106 Ga0075436_100002057 3300006914 Bacteria 13866
107 Ga0097620_100004258 3300006931 Bacteria 14615
108 Ga0097620_100004351 3300006931 Bacteria 14452
109 Ga0075435_100066534 3300007076 Bacteria 2932
110 Ga0105240_10011662 3300009093 Bacteria 12216
111 Ga0105240_10017651 3300009093 Bacteria 9609
112 Ga0105240_10162158 3300009093 Bacteria 2654
113 Ga0111539_10134299 3300009094 Bacteria 2897
114 Ga0105245_10004647 3300009098 Bacteria 12131
115 Ga0105245_10125038 3300009098 Bacteria 2406
116 Ga0105245_10149053 3300009098 Unclassified 2210
117 Ga0105245_10309140 3300009098 Unclassified 1554
118 Ga0105245_10324442 3300009098 Bacteria 1518
119 Ga0114129_10027666 3300009147 Bacteria 8028
120 Ga0114129_10093618 3300009147 Unclassified 4162
121 Ga0114129_10170695 3300009147 Bacteria 2965
122 Ga0114129_10809295 3300009147 Bacteria 1195
123 Ga0105243_10000577 3300009148 Bacteria 36910
124 Ga0105243_10048460 3300009148 Bacteria 3349
125 Ga0105243_10089469 3300009148 Archaea 2531
126 Ga0105242_10007977 3300009176 Bacteria 8156
127 Ga0105242_10017936 3300009176 Bacteria 5528
128 Ga0105242_10169610 3300009176 Bacteria 1917
129 Ga0105248_10078410 3300009177 Bacteria 3713
130 Ga0105248_10166830 3300009177 Unclassified 2482
131 Ga0105248_10405463 3300009177 Unclassified 1535
132 Ga0105238_10053881 3300009551 Bacteria 4042
133 Ga0105238_10054442 3300009551 Unclassified 4017
134 Ga0105238_10223537 3300009551 Unclassified 1859
135 Ga0105238_10241236 3300009551 Bacteria 1785
136 Ga0105249_10172878 3300009553 Unclassified 2096
137 Ga0157370_10003202 3300013104 Bacteria 19355
138 Ga0157369_10001315 3300013105 Bacteria 30866
139 Ga0157374_10061150 3300013296 Unclassified 3527
140 Ga0157378_10018846 3300013297 Bacteria 6066
141 Ga0157378_10055450 3300013297 Bacteria 3530
142 Ga0157378_10065975 3300013297 Bacteria 3241
143 Ga0163162_10157971 3300013306 Unclassified 2388
144 Ga0163162_10195116 3300013306 Unclassified 2153
145 Ga0157372_10006079 3300013307 Bacteria 12828
146 Ga0157372_10137064 3300013307 Bacteria 2819
147 Ga0157372_10287882 3300013307 Unclassified 1911
148 Ga0157375_10004410 3300013308 Bacteria 12219
149 Ga0157375_10163187 3300013308 Unclassified 2371
150 Ga0157375_10577709 3300013308 Bacteria 1284
151 Ga0157380_10027480 3300014326 Bacteria 4327
152 Ga0157380_10090805 3300014326 Bacteria 2520
153 Ga0157377_10009874 3300014745 Bacteria 4704
154 Ga0157379_10066609 3300014968 Bacteria 3220
155 Ga0207656_10012436 3300025321 Unclassified 3236
156 Ga0207682_10071333 3300025893 Bacteria 1472
157 Ga0207688_10014977 3300025901 Bacteria 4208
158 Ga0207688_10087013 3300025901 Bacteria 1791
159 Ga0207680_10179627 3300025903 Bacteria 1430
160 Ga0207645_10032693 3300025907 Bacteria 3344
161 Ga0207645_10040744 3300025907 Unclassified 2974
162 Ga0207643_10005772 3300025908 Bacteria 6614
163 Ga0207643_10024385 3300025908 Bacteria 3338
164 Ga0207695_10009249 3300025913 Bacteria 12207
165 Ga0207695_10059044 3300025913 Bacteria 3980
166 Ga0207695_10076094 3300025913 Unclassified 3413
167 Ga0207671_10239195 3300025914 Bacteria 1426
168 Ga0207663_10117509 3300025916 Bacteria 1815
169 Ga0207660_10093422 3300025917 Unclassified 2235
170 Ga0207662_10017094 3300025918 Bacteria 4100
171 Ga0207662_10185724 3300025918 Unclassified 1340
172 Ga0207652_10356209 3300025921 Unclassified 1321
173 Ga0207646_10359932 3300025922 Bacteria 1314
174 Ga0207681_10034657 3300025923 Unclassified 3320
175 Ga0207694_10021893 3300025924 Bacteria 4846
176 Ga0207694_10154732 3300025924 Unclassified 1849
177 Ga0207650_10024301 3300025925 Bacteria 4306
178 Ga0207659_10004812 3300025926 Bacteria 8191
179 Ga0207659_10015590 3300025926 Unclassified 4929
180 Ga0207686_10004657 3300025934 Bacteria 7350
181 Ga0207709_10045876 3300025935 Bacteria 2649
182 Ga0207709_10055985 3300025935 Unclassified 2439
183 Ga0207670_10001458 3300025936 Bacteria 12413
184 Ga0207670_10073916 3300025936 Bacteria 2365
185 Ga0207670_10195301 3300025936 Bacteria 1534
186 Ga0207665_10177366 3300025939 Bacteria 1542
187 Ga0207691_10054282 3300025940 Bacteria 3655
188 Ga0207691_10079608 3300025940 Bacteria 2949
189 Ga0207679_10015500 3300025945 Bacteria 5038
190 Ga0207679_10244294 3300025945 Unclassified 1523
191 Ga0207667_10019934 3300025949 Bacteria 7472
192 Ga0207667_10042622 3300025949 Bacteria 4822
193 Ga0207667_10086280 3300025949 Bacteria 3248
194 Ga0207651_10054372 3300025960 Unclassified 2743
195 Ga0207668_10029877 3300025972 Bacteria 3577
196 Ga0207677_10156771 3300026023 Unclassified 1764
197 Ga0207677_10158202 3300026023 Unclassified 1757
198 Ga0207703_10001282 3300026035 Bacteria 23304
199 Ga0207639_10049445 3300026041 Bacteria 3188
200 Ga0207639_10286905 3300026041 Bacteria 1450
201 Ga0207708_10024888 3300026075 Bacteria 4530
202 Ga0207708_10095446 3300026075 Unclassified 2297
203 Ga0207708_10112429 3300026075 Bacteria 2115
204 Ga0207702_10036807 3300026078 Bacteria 4094
205 Ga0207702_10051811 3300026078 Bacteria 3471
206 Ga0207648_10002615 3300026089 Bacteria 19286
207 Ga0207648_10204277 3300026089 Unclassified 1753
208 Ga0207674_10021565 3300026116 Bacteria 6935
209 Ga0207674_10310569 3300026116 Bacteria 1526
210 Ga0207675_100078776 3300026118 Bacteria 3088
211 Ga0207675_100090345 3300026118 Bacteria 2879
212 Ga0207683_10069054 3300026121 Bacteria 3121
213 Ga0207683_10128360 3300026121 Bacteria 2280
214 Ga0207698_10000418 3300026142 Bacteria 24481
215 Ga0207698_10012296 3300026142 Bacteria 5595
216 Ga0207428_10018551 3300027907 Bacteria 5939
217 Ga0207428_10020252 3300027907 Bacteria 5654
218 Ga0268265_10001296 3300028380 Bacteria 21495
219 Ga0268264_10207938 3300028381 Bacteria 1795
220 Ga0307408_100136483 3300031548 Bacteria 1920
221 Ga0307408_100155534 3300031548 Bacteria 1810
222 Ga0373931_0020158 3300035691 Bacteria 3334
223 Ga0373933_0081240 3300035724 Unclassified 1988
224 Ga0373937_0023105 3300036401 Bacteria 5595
225 Ga0373925_0108545 3300037068 Bacteria 2142
226 Ga0395900_0117404 3300037418 Bacteria 2730
227 Ga0395905_0019758 3300037471 Bacteria 6386
228 Ga0395901_0015266 3300038443 Bacteria 7814
229 Ga0439441_000467 3300042001 Bacteria 4357
230 Ga0439443_000049 3300042003 Bacteria 6543
231 Ga0439435_0005039 3300042436 Bacteria 2882
232 Ga0439435_0045285 3300042436 Unclassified 1243
233 Ga0439444_0015593 3300042437 Bacteria 1284
234 Ga0439460_0000692 3300042461 Bacteria 7478
235 Ga0451576_0056391 3300045051 Bacteria 4109
236 Ga0451576_0151037 3300045051 Bacteria 2423
237 Ga0495603_0074148 3300046455 Bacteria 1998
238 Ga0495629_0004398 3300046459 Bacteria 10555
239 Ga0495651_0033218 3300046462 Bacteria 4025
240 Ga0495582_0104882 3300046473 Bacteria 1585
241 Ga0495584_0009898 3300046491 Bacteria 4901
242 Ga0495585_0000775 3300046492 Bacteria 28225
243 Ga0495594_0002153 3300046499 Bacteria 10259
244 Ga0495587_0003948 3300046536 Bacteria 9836
245 Ga0495598_0029876 3300046537 Bacteria 1523
246 Ga0495621_0011234 3300046539 Bacteria 2763
247 Ga0495621_0024451 3300046539 Bacteria 2018
248 Ga0495633_0015295 3300046558 Unclassified 3983
249 Ga0495659_0003912 3300046664 Unclassified 4722
250 Ga0495659_0015834 3300046664 Bacteria 2482
251 Ga0495623_0014417 3300046679 Bacteria 5115
252 Ga0495669_0014924 3300046684 Bacteria 3324
253 Ga0495670_0012582 3300046691 Bacteria 4162
254 Ga0495636_0024802 3300047318 Bacteria 2434
255 Ga0496104_0139125 3300048907 Bacteria 2333
256 Ga0496110_0065946 3300048913 Unclassified 3201
257 Ga0501036_0136043 3300049572 Bacteria 2074
258 Ga0501036_0265119 3300049572 Bacteria 1439
259 Ga0501040_0157316 3300049576 Archaea 1605
260 Ga0501047_0065808 3300049581 Bacteria 3493
261 Ga0501068_0125004 3300049584 Bacteria 1606
262 Ga0501069_0007993 3300049585 Bacteria 5554
263 Ga0501070_0000520 3300049586 Bacteria 35280
264 Ga0501072_0102074 3300049588 Bacteria 2280
265 Ga0501072_0178783 3300049588 Bacteria 1692
266 Ga0501073_0001617 3300049589 Bacteria 16692
267 Ga0501074_0045160 3300049590 Bacteria 3188
268 Ga0501076_0057794 3300049592 Unclassified 3081
269 Ga0501079_0001515 3300049741 Bacteria 16443
270 Ga0501083_0001545 3300049744 Bacteria 15735
271 Ga0501035_0296924 3300049822 Bacteria 1362
272 nmdc:mga05p37_235770_c1 3300050507 Unclassified 2202
273 nmdc:mga05p37_37882_c1 3300050507 Bacteria 5914
274 nmdc:mga05p37_46734_c1 3300050507 Bacteria 5322
275 nmdc:mga09592_212461_c1 3300050508 Unclassified 1676
276 nmdc:mga0qj67_166673_c1 3300050509 Unclassified 1789
277 nmdc:mga0qj67_18979_c1 3300050509 Bacteria 5247
278 nmdc:mga0qj67_216_c1 3300050509 Bacteria 39292
279 nmdc:mga0qj67_7277_c1 3300050509 Bacteria 8177
280 nmdc:mga06r32_140017_c1 3300050510 Bacteria 2395
281 nmdc:mga08y16_169615_c1 3300050511 Bacteria 2267
282 nmdc:mga08y16_177711_c1 3300050511 Bacteria 2210
283 nmdc:mga0n895_110051_c1 3300050512 Unclassified 2770
284 nmdc:mga0n895_123510_c1 3300050512 Unclassified 2611
285 nmdc:mga0n895_45616_c1 3300050512 Bacteria 4278
286 nmdc:mga0rr50_112833_c1 3300050513 Bacteria 2153
287 nmdc:mga0rr50_196956_c1 3300050513 Bacteria 1654
288 nmdc:mga08x19_1872_c1 3300050514 Bacteria 12891
289 nmdc:mga0a205_121332_c1 3300050515 Bacteria 2513
290 nmdc:mga0a205_459737_c1 3300050515 Unclassified 1132
291 Ga0495601_0011617 3300053077 Bacteria 5275
292 Ga0495595_0048516 3300053084 Unclassified 1961
293 Ga0500554_046141 3300053102 Bacteria 1356
294 Ga0500619_000044 3300053154 Bacteria 38579
295 Ga0501082_0108373 3300060353 Bacteria 2404
296 Ga0530510_0000897 3300061734 Bacteria 19627
297 Ga0436365_0112315
298 SwRhRL2b_contig_129330
299 Ga0065704_10090765
300 Ga0065712_10188729
301 Ga0070658_10047835
302 Ga0070676_10078863
303 Ga0070683_100035662
304 Ga0070683_100491505
305 Ga0070670_100062887
306 Ga0068868_100088601
307 Ga0070689_100004532
308 Ga0070689_100005034
309 Ga0070689_100010085
310 Ga0070689_100023944
311 Ga0070689_100238541
312 Ga0070692_10119862
313 Ga0070669_100012693
314 Ga0070675_100000858
315 Ga0070675_100004786
316 Ga0070675_100035256
317 Ga0070671_100020972
318 Ga0070673_100033103
319 Ga0070673_100124057
320 Ga0070673_100131420
321 Ga0070673_100260470
322 Ga0070688_100029933
323 Ga0070659_100038956
324 Ga0070713_100032126
325 Ga0070701_10003079
326 Ga0070701_10144442
327 Ga0070700_100079064
328 Ga0070694_100032003
329 Ga0070681_10039880
330 Ga0070681_10370829
331 Ga0068867_100001733
332 Ga0068867_100032232
333 Ga0068867_100197220
334 Ga0070685_10025980
335 Ga0070707_100270833
336 Ga0070698_100000929
337 Ga0070698_100331078
338 Ga0070699_100002294
339 Ga0070699_100028723
340 Ga0070699_100177985
341 Ga0070679_100197242
342 Ga0070679_100204231
343 Ga0070684_100186569
344 Ga0068853_100073359
345 Ga0070672_100219842
346 Ga0070696_100059047
347 Ga0070696_100111895
348 Ga0070693_100048390
349 Ga0070693_100200969
350 Ga0070665_100225998
351 Ga0070704_100000241
352 Ga0070704_100004620
353 Ga0070704_100078127
354 Ga0068855_100008189
355 Ga0068855_100022998
356 Ga0068855_100134277
357 Ga0070664_100063361
358 Ga0070664_100333462
359 Ga0068857_100013243
360 Ga0068857_100044190
361 Ga0068856_100022764
362 Ga0068856_100101981
363 Ga0068852_100001065
364 Ga0068852_100002049
365 Ga0068852_100074747
366 Ga0068852_100221008
367 Ga0068859_100004257
368 Ga0068859_100004351
369 Ga0068864_100038892
370 Ga0068861_100064698
371 Ga0068851_10008032
372 Ga0068870_10002848
373 Ga0068870_10075591
374 Ga0068863_100057236
375 Ga0068858_100026040
376 Ga0068858_100108686
377 Ga0068858_100260102
378 Ga0068860_100005055
379 Ga0068860_100291542
380 Ga0068862_100001515
381 Ga0070716_100050370
382 Ga0070716_100152605
383 Ga0075366_10011489
384 Ga0097621_100008366
385 Ga0097621_100017738
386 Ga0097621_100110032
387 Ga0068871_100027518
388 Ga0068871_100241502
389 Ga0075428_100033551
390 Ga0075428_100063935
391 Ga0075428_100196910
392 Ga0075430_100000498
393 Ga0075430_100012011
394 Ga0075430_100017098
395 Ga0075431_100101828
396 Ga0075433_10080305
397 Ga0075434_100071828
398 Ga0075434_100084158
399 Ga0075434_100107517
400 Ga0068865_100150317
401 Ga0068865_100186704
402 Ga0075436_100002057
403 Ga0097620_100004258
404 Ga0097620_100004351
405 Ga0075435_100066534
406 Ga0105240_10011662
407 Ga0105240_10017651
408 Ga0105240_10162158
409 Ga0111539_10134299
410 Ga0105245_10004647
411 Ga0105245_10125038
412 Ga0105245_10149053
413 Ga0105245_10309140
414 Ga0105245_10324442
415 Ga0114129_10027666
416 Ga0114129_10093618
417 Ga0114129_10170695
418 Ga0114129_10809295
419 Ga0105243_10000577
420 Ga0105243_10048460
421 Ga0105243_10089469
422 Ga0105242_10007977
423 Ga0105242_10017936
424 Ga0105242_10169610
425 Ga0105248_10078410
426 Ga0105248_10166830
427 Ga0105248_10405463
428 Ga0105238_10053881
429 Ga0105238_10054442
430 Ga0105238_10223537
431 Ga0105238_10241236
432 Ga0105249_10172878
433 Ga0157370_10003202
434 Ga0157369_10001315
435 Ga0157374_10061150
436 Ga0157378_10018846
437 Ga0157378_10055450
438 Ga0157378_10065975
439 Ga0163162_10157971
440 Ga0163162_10195116
441 Ga0157372_10006079
442 Ga0157372_10137064
443 Ga0157372_10287882
444 Ga0157375_10004410
445 Ga0157375_10163187
446 Ga0157375_10577709
447 Ga0157380_10027480
448 Ga0157380_10090805
449 Ga0157377_10009874
450 Ga0157379_10066609
451 Ga0207656_10012436
452 Ga0207682_10071333
453 Ga0207688_10014977
454 Ga0207688_10087013
455 Ga0207680_10179627
456 Ga0207645_10032693
457 Ga0207645_10040744
458 Ga0207643_10005772
459 Ga0207643_10024385
460 Ga0207695_10009249
461 Ga0207695_10059044
462 Ga0207695_10076094
463 Ga0207671_10239195
464 Ga0207663_10117509
465 Ga0207660_10093422
466 Ga0207662_10017094
467 Ga0207662_10185724
468 Ga0207652_10356209
469 Ga0207646_10359932
470 Ga0207681_10034657
471 Ga0207694_10021893
472 Ga0207694_10154732
473 Ga0207650_10024301
474 Ga0207659_10004812
475 Ga0207659_10015590
476 Ga0207686_10004657
477 Ga0207709_10045876
478 Ga0207709_10055985
479 Ga0207670_10001458
480 Ga0207670_10073916
481 Ga0207670_10195301
482 Ga0207665_10177366
483 Ga0207691_10054282
484 Ga0207691_10079608
485 Ga0207679_10015500
486 Ga0207679_10244294
487 Ga0207667_10019934
488 Ga0207667_10042622
489 Ga0207667_10086280
490 Ga0207651_10054372
491 Ga0207668_10029877
492 Ga0207677_10156771
493 Ga0207677_10158202
494 Ga0207703_10001282
495 Ga0207639_10049445
496 Ga0207639_10286905
497 Ga0207708_10024888
498 Ga0207708_10095446
499 Ga0207708_10112429
500 Ga0207702_10036807
501 Ga0207702_10051811
502 Ga0207648_10002615
503 Ga0207648_10204277
504 Ga0207674_10021565
505 Ga0207674_10310569
506 Ga0207675_100078776
507 Ga0207675_100090345
508 Ga0207683_10069054
509 Ga0207683_10128360
510 Ga0207698_10000418
511 Ga0207698_10012296
512 Ga0207428_10018551
513 Ga0207428_10020252
514 Ga0268265_10001296
515 Ga0268264_10207938
516 Ga0307408_100136483
517 Ga0307408_100155534
518 Ga0373931_0020158
519 Ga0373933_0081240
520 Ga0373937_0023105
521 Ga0373925_0108545
522 Ga0395900_0117404
523 Ga0395905_0019758
524 Ga0395901_0015266
525 Ga0439441_000467
526 Ga0439443_000049
527 Ga0439435_0005039
528 Ga0439435_0045285
529 Ga0439444_0015593
530 Ga0439460_0000692
531 Ga0451576_0056391
532 Ga0451576_0151037
533 Ga0495603_0074148
534 Ga0495629_0004398
535 Ga0495651_0033218
536 Ga0495582_0104882
537 Ga0495584_0009898
538 Ga0495585_0000775
539 Ga0495594_0002153
540 Ga0495587_0003948
541 Ga0495598_0029876
542 Ga0495621_0011234
543 Ga0495621_0024451
544 Ga0495633_0015295
545 Ga0495659_0003912
546 Ga0495659_0015834
547 Ga0495623_0014417
548 Ga0495669_0014924
549 Ga0495670_0012582
550 Ga0495636_0024802
551 Ga0496104_0139125
552 Ga0496110_0065946
553 Ga0501036_0136043
554 Ga0501036_0265119
555 Ga0501040_0157316
556 Ga0501047_0065808
557 Ga0501068_0125004
558 Ga0501069_0007993
559 Ga0501070_0000520
560 Ga0501072_0102074
561 Ga0501072_0178783
562 Ga0501073_0001617
563 Ga0501074_0045160
564 Ga0501076_0057794
565 Ga0501079_0001515
566 Ga0501083_0001545
567 Ga0501035_0296924
568 nmdc:mga05p37_235770_c1
569 nmdc:mga05p37_37882_c1
570 nmdc:mga05p37_46734_c1
571 nmdc:mga09592_212461_c1
572 nmdc:mga0qj67_166673_c1
573 nmdc:mga0qj67_18979_c1
574 nmdc:mga0qj67_216_c1
575 nmdc:mga0qj67_7277_c1
576 nmdc:mga06r32_140017_c1
577 nmdc:mga08y16_169615_c1
578 nmdc:mga08y16_177711_c1
579 nmdc:mga0n895_110051_c1
580 nmdc:mga0n895_123510_c1
581 nmdc:mga0n895_45616_c1
582 nmdc:mga0rr50_112833_c1
583 nmdc:mga0rr50_196956_c1
584 nmdc:mga08x19_1872_c1
585 nmdc:mga0a205_121332_c1
586 nmdc:mga0a205_459737_c1
587 Ga0495601_0011617
588 Ga0495595_0048516
589 Ga0500554_046141
590 Ga0500619_000044
591 Ga0501082_0108373
592 Ga0530510_0000897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

98

316

0.85

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

62

319

0.82

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

52

292

0.8

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

48

300

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f6r-assembly1.cif.gz_A crystal structure of metal-citrate-binding mutant (s164a) protein (mcta) of abc transporter in apo state 0.9033 25 325
7f6u-assembly1.cif.gz_A crystal structure of metal-citrate-binding mutant (y221a) protein (mcta) of abc transporter in apo state 0.8954 25 326
7f6s-assembly1.cif.gz_A crystal structure of metal-citrate-binding mutant (t199a) protein (mcta) of abc transporter in apo state 0.8936 25 326
7f6t-assembly1.cif.gz_A crystal structure of metal-citrate-binding mutant (y221f) protein (mcta) of abc transporter in apo state 0.8868 25 325
7f6q-assembly1.cif.gz_A crystal structure of metal-citrate-binding mutant (s79a) protein (mcta) of abc transporter in apo state 0.8617 24 326
ID Description Score Start End Superfamily
1xvyA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9026 36 282 3.40.190.10
4elqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8756 35 302 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8732 36 296 3.40.190.10
4r74A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8638 34 299 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8622 36 296 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A536SEA5-F1-model_v4 ABC transporter substrate-binding protein 0.9761 21 108
AF-A0A239IK27-F1-model_v4 Iron(III) transport system substrate-binding protein 0.9743 21 328
AF-A0A1F2T8L0-F1-model_v4 ABC transporter substrate-binding protein 0.968 30 329
AF-A0A537AAL3-F1-model_v4 ABC transporter substrate-binding protein 0.9679 20 129
AF-A0A536SK15-F1-model_v4 ABC transporter substrate-binding protein 0.9621 21 125

Map