F393309

General Info

Members Datasets Scaffolds Average Seq Length
296 178 592 137

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_1373028|Ga0395901_1373028_80_502
Length 128
Sequence MQITRNKLETTPGPSDWFTGTVYIDTITSPEGDWNLGAAAVHFTPGARTAWEGLGLCQREGGPIEVIRPGDRVFFAPGENHWHGAAPTRLMTHIAMQLADESGSPVTWGEHVTDAQYAQPPAPEGREQ

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
123 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
124 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
125 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
128 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
129 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
130 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
131 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
132 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
133 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
134 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
135 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
136 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 2.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.53
Rhizosphere 82.43
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_1373028 3300038443 Bacteria 666
2 Ga0065704_10534219 3300005289 Bacteria 645
3 Ga0070683_100027093 3300005329 Bacteria 5166
4 Ga0070683_100052083 3300005329 Bacteria 3791
5 Ga0070683_100109441 3300005329 Bacteria 2606
6 Ga0070683_100389302 3300005329 Bacteria 1329
7 Ga0070690_100701839 3300005330 Bacteria 777
8 Ga0070680_100020155 3300005336 Bacteria 5290
9 Ga0070680_100052049 3300005336 Bacteria 3342
10 Ga0070682_100030774 3300005337 Bacteria 3243
11 Ga0070682_100474324 3300005337 Bacteria 963
12 Ga0070660_100053659 3300005339 Bacteria 3110
13 Ga0070689_101137378 3300005340 Bacteria 699
14 Ga0070691_10067355 3300005341 Bacteria 1732
15 Ga0070691_10328720 3300005341 Bacteria 843
16 Ga0070661_100027030 3300005344 Bacteria 4130
17 Ga0070661_100212400 3300005344 Bacteria 1482
18 Ga0070661_100671711 3300005344 Bacteria 842
19 Ga0070674_100176560 3300005356 Bacteria 1633
20 Ga0070667_101220440 3300005367 Unclassified 704
21 Ga0070709_10445583 3300005434 Bacteria 974
22 Ga0070714_100020526 3300005435 Bacteria 5397
23 Ga0070714_100149349 3300005435 Bacteria 2104
24 Ga0070714_101130400 3300005435 Bacteria 764
25 Ga0070713_100398161 3300005436 Bacteria 1285
26 Ga0070713_100520394 3300005436 Bacteria 1124
27 Ga0070710_10062886 3300005437 Bacteria 2119
28 Ga0070701_10257658 3300005438 Bacteria 1056
29 Ga0070708_100051366 3300005445 Bacteria 3653
30 Ga0070681_10009501 3300005458 Bacteria 9573
31 Ga0070681_10020001 3300005458 Bacteria 6707
32 Ga0070681_10095678 3300005458 Bacteria 2918
33 Ga0070707_100005696 3300005468 Bacteria 11628
34 Ga0070679_100036093 3300005530 Bacteria 4905
35 Ga0070679_100046170 3300005530 Bacteria 4341
36 Ga0070679_100073356 3300005530 Bacteria 3414
37 Ga0070679_100117180 3300005530 Bacteria 2648
38 Ga0070684_100012113 3300005535 Bacteria 6898
39 Ga0070684_100016241 3300005535 Bacteria 6081
40 Ga0070684_101054068 3300005535 Bacteria 764
41 Ga0068853_101602786 3300005539 Bacteria 631
42 Ga0070686_100059154 3300005544 Bacteria 2468
43 Ga0070693_101312306 3300005547 Bacteria 560
44 Ga0070665_100506195 3300005548 Bacteria 1219
45 Ga0070704_100007494 3300005549 Bacteria 6496
46 Ga0068855_100061255 3300005563 Bacteria 4397
47 Ga0068855_100616046 3300005563 Bacteria 1169
48 Ga0070664_100059613 3300005564 Bacteria 3248
49 Ga0070664_100121143 3300005564 Bacteria 2291
50 Ga0068857_100030148 3300005577 Bacteria 4787
51 Ga0068857_100034147 3300005577 Bacteria 4500
52 Ga0068854_100481659 3300005578 Bacteria 1042
53 Ga0068856_100014461 3300005614 Bacteria 7624
54 Ga0068856_100035794 3300005614 Bacteria 4866
55 Ga0068856_100562484 3300005614 Bacteria 1162
56 Ga0068856_100657379 3300005614 Bacteria 1069
57 Ga0070702_100417931 3300005615 Bacteria 964
58 Ga0070702_101643374 3300005615 Bacteria 533
59 Ga0068852_100149768 3300005616 Bacteria 2169
60 Ga0068852_102208093 3300005616 Unclassified 572
61 Ga0068870_10951044 3300005840 Bacteria 610
62 Ga0068863_101115547 3300005841 Bacteria 794
63 Ga0068858_100548643 3300005842 Bacteria 1119
64 Ga0070717_10058354 3300006028 Bacteria 3191
65 Ga0070717_10396348 3300006028 Bacteria 1239
66 Ga0070717_11558842 3300006028 Bacteria 599
67 Ga0070712_101083692 3300006175 Bacteria 695
68 Ga0075433_10478759 3300006852 Bacteria 1097
69 Ga0075434_100013809 3300006871 Bacteria 7701
70 Ga0075434_101562505 3300006871 Bacteria 669
71 Ga0075436_100028054 3300006914 Bacteria 3874
72 Ga0075435_100010431 3300007076 Bacteria 6796
73 Ga0075435_101374618 3300007076 Unclassified 619
74 Ga0099795_10002958 3300007788 Bacteria 4121
75 Ga0105240_10050561 3300009093 Bacteria 5239
76 Ga0105240_11321782 3300009093 Bacteria 760
77 Ga0105245_10086715 3300009098 Bacteria 2872
78 Ga0105245_10329818 3300009098 Bacteria 1506
79 Ga0105242_10003053 3300009176 Bacteria 13084
80 Ga0105237_10029633 3300009545 Bacteria 5561
81 Ga0105238_10235365 3300009551 Bacteria 1809
82 Ga0105238_10241301 3300009551 Bacteria 1785
83 Ga0105249_12832211 3300009553 Bacteria 556
84 Ga0099796_10087357 3300010159 Bacteria 1154
85 Ga0105239_10673347 3300010375 Bacteria 1182
86 Ga0105239_11666871 3300010375 Bacteria 738
87 Ga0157370_10752318 3300013104 Bacteria 888
88 Ga0157369_10025790 3300013105 Bacteria 6520
89 Ga0157369_10042363 3300013105 Bacteria 4966
90 Ga0157369_11128395 3300013105 Bacteria 801
91 Ga0157372_10006441 3300013307 Bacteria 12499
92 Ga0157372_10384177 3300013307 Bacteria 1636
93 Ga0157375_10220065 3300013308 Bacteria 2057
94 Ga0182008_10271237 3300014497 Bacteria 880
95 Ga0157377_10635356 3300014745 Bacteria 766
96 Ga0157379_10930545 3300014968 Bacteria 826
97 Ga0157376_10437213 3300014969 Bacteria 1273
98 Ga0182005_1255917 3300015265 Unclassified 543
99 Ga0206356_10331473 3300020070 Bacteria 851
100 Ga0206356_11062105 3300020070 Bacteria 1732
101 Ga0206356_11213427 3300020070 Bacteria 812
102 Ga0206353_10279259 3300020082 Bacteria 1247
103 Ga0206353_10390966 3300020082 Bacteria 1245
104 Ga0154015_1519419 3300020610 Bacteria 516
105 Ga0213875_10001898 3300021388 Bacteria 12935
106 Ga0224712_10445396 3300022467 Bacteria 621
107 Ga0207680_10584226 3300025903 Bacteria 799
108 Ga0207699_10101497 3300025906 Bacteria 1826
109 Ga0207643_10750407 3300025908 Bacteria 632
110 Ga0207707_10066803 3300025912 Bacteria 3131
111 Ga0207707_10457418 3300025912 Bacteria 1092
112 Ga0207707_10656975 3300025912 Bacteria 883
113 Ga0207695_10024882 3300025913 Bacteria 6719
114 Ga0207671_10133344 3300025914 Bacteria 1908
115 Ga0207663_10053614 3300025916 Bacteria 2520
116 Ga0207660_10035619 3300025917 Bacteria 3456
117 Ga0207657_10065204 3300025919 Bacteria 3106
118 Ga0207652_10008951 3300025921 Bacteria 8068
119 Ga0207652_10037885 3300025921 Bacteria 4083
120 Ga0207652_10444204 3300025921 Bacteria 1169
121 Ga0207694_10195421 3300025924 Bacteria 1645
122 Ga0207687_10053507 3300025927 Bacteria 2820
123 Ga0207687_10095592 3300025927 Bacteria 2176
124 Ga0207687_10230444 3300025927 Bacteria 1463
125 Ga0207700_11627143 3300025928 Bacteria 571
126 Ga0207664_10368505 3300025929 Bacteria 1274
127 Ga0207644_10021592 3300025931 Bacteria 4389
128 Ga0207644_10143205 3300025931 Bacteria 1843
129 Ga0207665_10705909 3300025939 Bacteria 793
130 Ga0207711_10490714 3300025941 Bacteria 1144
131 Ga0207689_10427561 3300025942 Bacteria 1105
132 Ga0207661_10001706 3300025944 Bacteria 15000
133 Ga0207661_10057950 3300025944 Bacteria 3116
134 Ga0207661_10250907 3300025944 Bacteria 1573
135 Ga0207661_10585751 3300025944 Bacteria 1023
136 Ga0207661_10611820 3300025944 Bacteria 1000
137 Ga0207679_10072923 3300025945 Bacteria 2595
138 Ga0207679_10149123 3300025945 Bacteria 1901
139 Ga0207679_10305019 3300025945 Bacteria 1374
140 Ga0207667_10046064 3300025949 Bacteria 4617
141 Ga0207640_10852870 3300025981 Bacteria 793
142 Ga0207677_11740798 3300026023 Bacteria 578
143 Ga0207639_10017717 3300026041 Bacteria 5051
144 Ga0207639_11469551 3300026041 Bacteria 640
145 Ga0207702_10011886 3300026078 Bacteria 7247
146 Ga0207702_11961623 3300026078 Bacteria 576
147 Ga0207674_10010849 3300026116 Bacteria 10270
148 Ga0207674_10735813 3300026116 Bacteria 952
149 Ga0207683_10229326 3300026121 Bacteria 1693
150 Ga0207683_10550383 3300026121 Bacteria 1067
151 Ga0207698_10189846 3300026142 Bacteria 1829
152 Ga0207698_10820625 3300026142 Bacteria 933
153 Ga0207698_11311876 3300026142 Bacteria 738
154 Ga0268266_11753083 3300028379 Unclassified 596
155 Ga0265336_10027559 3300028666 Bacteria 1779
156 Ga0265338_10026977 3300028800 Bacteria 5777
157 Ga0265330_10105491 3300031235 Bacteria 1205
158 Ga0265325_10043684 3300031241 Bacteria 2337
159 Ga0265339_10044702 3300031249 Bacteria 2441
160 Ga0265313_10027776 3300031595 Bacteria 2957
161 Ga0265314_10069016 3300031711 Bacteria 2373
162 Ga0265342_10264945 3300031712 Bacteria 913
163 Ga0307416_100678969 3300032002 Bacteria 1117
164 Ga0307415_100105731 3300032126 Bacteria 2076
165 Ga0373945_0365121 3300035116 Bacteria 628
166 Ga0373943_0053567 3300035170 Bacteria 1993
167 Ga0373943_0086522 3300035170 Bacteria 1616
168 Ga0373931_0040712 3300035691 Bacteria 2439
169 Ga0373935_0234455 3300035692 Bacteria 1279
170 Ga0373947_0691062 3300035725 Bacteria 696
171 Ga0373925_0288892 3300037068 Bacteria 1322
172 Ga0373925_0561158 3300037068 Bacteria 939
173 Ga0395899_0017920 3300037312 Bacteria 5389
174 Ga0395899_0215682 3300037312 Bacteria 1332
175 Ga0395900_0008487 3300037418 Bacteria 10562
176 Ga0395900_0022229 3300037418 Bacteria 6488
177 Ga0395900_0027519 3300037418 Bacteria 5825
178 Ga0395900_0064296 3300037418 Bacteria 3771
179 Ga0395900_0259746 3300037418 Bacteria 1735
180 Ga0395898_0010747 3300037466 Bacteria 9562
181 Ga0395898_0047675 3300037466 Bacteria 4203
182 Ga0395898_0056255 3300037466 Bacteria 3835
183 Ga0395898_0088580 3300037466 Bacteria 2979
184 Ga0395898_0109491 3300037466 Bacteria 2648
185 Ga0395898_0122394 3300037466 Bacteria 2493
186 Ga0395898_0188361 3300037466 Bacteria 1972
187 Ga0395898_0261093 3300037466 Bacteria 1652
188 Ga0395898_0410652 3300037466 Bacteria 1291
189 Ga0395898_0570864 3300037466 Bacteria 1074
190 Ga0395898_0580297 3300037466 Bacteria 1064
191 Ga0395898_0901302 3300037466 Bacteria 822
192 Ga0395905_0010983 3300037471 Bacteria 8763
193 Ga0395905_0024574 3300037471 Bacteria 5685
194 Ga0395905_0086419 3300037471 Bacteria 2939
195 Ga0395905_0264546 3300037471 Bacteria 1605
196 Ga0436364_1411651 3300037853 Bacteria 18872
197 Ga0395901_0003734 3300038443 Bacteria 15341
198 Ga0395901_0053786 3300038443 Bacteria 4183
199 Ga0395901_0068887 3300038443 Bacteria 3685
200 Ga0395901_0070636 3300038443 Bacteria 3638
201 Ga0395901_0077075 3300038443 Bacteria 3479
202 Ga0395901_0288686 3300038443 Bacteria 1703
203 Ga0395901_0477360 3300038443 Bacteria 1272
204 Ga0395901_0651356 3300038443 Bacteria 1056
205 Ga0395901_1565846 3300038443 Bacteria 613
206 Ga0436365_0988706 3300039437 Bacteria 2865
207 Ga0436360_0588557 3300039438 Bacteria 1460
208 Ga0436362_0765238 3300039453 Bacteria 2835
209 Ga0451791_1951398 3300041451 Bacteria 969
210 Ga0451793_0340483 3300041452 Bacteria 1028
211 Ga0451795_1389145 3300041456 Bacteria 1951
212 Ga0451798_0661951 3300041458 Bacteria 1115
213 Ga0451802_0469833 3300041460 Bacteria 2891
214 Ga0451804_0535290 3300041463 Bacteria 1190
215 Ga0451807_1521185 3300041486 Bacteria 2574
216 Ga0451835_0545002 3300041492 Bacteria 1064
217 Ga0451839_1618842 3300041496 Bacteria 2311
218 Ga0451841_1150082 3300041498 Bacteria 527
219 Ga0451845_0886322 3300041501 Bacteria 2072
220 Ga0451849_1280701 3300041505 Bacteria 2893
221 Ga0451855_0994883 3300041511 Bacteria 1328
222 Ga0439463_032347 3300042016 Bacteria 1322
223 Ga0439434_0312223 3300042435 Bacteria 545
224 Ga0450916_036672 3300042530 Bacteria 733
225 Ga0439440_0247967 3300042993 Bacteria 542
226 Ga0466961_0015871 3300044693 Bacteria 4833
227 Ga0466963_0225330 3300044694 Bacteria 1313
228 Ga0466963_0243106 3300044694 Bacteria 1262
229 Ga0466963_1018666 3300044694 Bacteria 583
230 Ga0466971_0079812 3300044719 Bacteria 1491
231 Ga0466967_0027152 3300045976 Bacteria 4758
232 Ga0466967_0208131 3300045976 Bacteria 1855
233 Ga0466967_1455830 3300045976 Bacteria 682
234 Ga0495592_0121605 3300046454 Bacteria 1836
235 Ga0495603_0807139 3300046455 Bacteria 535
236 Ga0495580_0373759 3300046472 Bacteria 963
237 Ga0495652_0308448 3300046529 Bacteria 1148
238 Ga0495652_0623244 3300046529 Bacteria 733
239 Ga0495640_0211707 3300046533 Bacteria 1225
240 Ga0495645_0195895 3300046543 Bacteria 1374
241 Ga0495667_0179278 3300046559 Bacteria 1360
242 Ga0495668_0615575 3300046616 Bacteria 600
243 Ga0495635_0688479 3300046663 Bacteria 663
244 Ga0495599_0364430 3300046678 Bacteria 865
245 Ga0495674_0117544 3300047319 Bacteria 2249
246 Ga0495674_1077026 3300047319 Bacteria 613
247 Ga0495676_0075728 3300047321 Bacteria 2572
248 Ga0496100_0016385 3300048903 Bacteria 4352
249 Ga0496101_0048766 3300048904 Bacteria 3044
250 Ga0496101_0398079 3300048904 Bacteria 1084
251 Ga0496101_0510214 3300048904 Bacteria 950
252 Ga0496102_1062423 3300048905 Bacteria 730
253 Ga0496103_0035231 3300048906 Bacteria 3064
254 Ga0496104_0044335 3300048907 Bacteria 4179
255 Ga0496104_0046842 3300048907 Bacteria 4074
256 Ga0496104_0365438 3300048907 Bacteria 1355
257 Ga0496105_0003678 3300048908 Bacteria 11409
258 Ga0496105_1114811 3300048908 Bacteria 585
259 Ga0496106_0013197 3300048909 Bacteria 6096
260 Ga0496106_0116038 3300048909 Bacteria 2088
261 Ga0496106_0882607 3300048909 Bacteria 707
262 Ga0496107_0013606 3300048910 Bacteria 5688
263 Ga0496107_0095729 3300048910 Bacteria 2172
264 Ga0496108_0073925 3300048911 Bacteria 2877
265 Ga0496108_0110456 3300048911 Bacteria 2350
266 Ga0496109_0002814 3300048912 Bacteria 14568
267 Ga0496109_0035657 3300048912 Bacteria 4489
268 Ga0496109_0361645 3300048912 Bacteria 1371
269 Ga0496110_0018730 3300048913 Bacteria 5808
270 Ga0496110_0186664 3300048913 Bacteria 1883
271 Ga0496110_0227646 3300048913 Bacteria 1695
272 Ga0496110_0447728 3300048913 Bacteria 1177
273 Ga0496110_0613468 3300048913 Bacteria 986
274 Ga0496110_1179856 3300048913 Bacteria 674
275 Ga0496111_0007856 3300048914 Bacteria 7028
276 Ga0496111_0045980 3300048914 Bacteria 3142
277 Ga0496112_0345281 3300048915 Bacteria 1431
278 Ga0496112_0484460 3300048915 Bacteria 1173
279 Ga0496113_0246690 3300048916 Bacteria 1425
280 Ga0496114_0011141 3300048917 Bacteria 7178
281 Ga0496114_0206144 3300048917 Bacteria 1723
282 Ga0496115_0167442 3300048918 Bacteria 1817
283 Ga0496115_0549081 3300048918 Bacteria 924
284 Ga0501068_0488305 3300049584 Bacteria 798
285 Ga0501069_0040125 3300049585 Bacteria 2587
286 Ga0501069_0438766 3300049585 Bacteria 775
287 nmdc:mga0n895_202053_c1 3300050512 Bacteria 2018
288 nmdc:mga0rr50_189284_c1 3300050513 Bacteria 1686
289 nmdc:mga08x19_45779_c1 3300050514 Bacteria 2796
290 nmdc:mga08x19_70293_c1 3300050514 Bacteria 2281
291 nmdc:mga0a205_394413_c1 3300050515 Bacteria 1248
292 Ga0495601_0227801 3300053077 Bacteria 1217
293 Ga0495601_0477220 3300053077 Bacteria 806
294 Ga0495612_0071627 3300053078 Bacteria 1446
295 Ga0495595_0052052 3300053084 Bacteria 1899
296 Ga0587119_072375 3300059658 Bacteria 549
297 Ga0395901_1373028
298 Ga0065704_10534219
299 Ga0070683_100027093
300 Ga0070683_100052083
301 Ga0070683_100109441
302 Ga0070683_100389302
303 Ga0070690_100701839
304 Ga0070680_100020155
305 Ga0070680_100052049
306 Ga0070682_100030774
307 Ga0070682_100474324
308 Ga0070660_100053659
309 Ga0070689_101137378
310 Ga0070691_10067355
311 Ga0070691_10328720
312 Ga0070661_100027030
313 Ga0070661_100212400
314 Ga0070661_100671711
315 Ga0070674_100176560
316 Ga0070667_101220440
317 Ga0070709_10445583
318 Ga0070714_100020526
319 Ga0070714_100149349
320 Ga0070714_101130400
321 Ga0070713_100398161
322 Ga0070713_100520394
323 Ga0070710_10062886
324 Ga0070701_10257658
325 Ga0070708_100051366
326 Ga0070681_10009501
327 Ga0070681_10020001
328 Ga0070681_10095678
329 Ga0070707_100005696
330 Ga0070679_100036093
331 Ga0070679_100046170
332 Ga0070679_100073356
333 Ga0070679_100117180
334 Ga0070684_100012113
335 Ga0070684_100016241
336 Ga0070684_101054068
337 Ga0068853_101602786
338 Ga0070686_100059154
339 Ga0070693_101312306
340 Ga0070665_100506195
341 Ga0070704_100007494
342 Ga0068855_100061255
343 Ga0068855_100616046
344 Ga0070664_100059613
345 Ga0070664_100121143
346 Ga0068857_100030148
347 Ga0068857_100034147
348 Ga0068854_100481659
349 Ga0068856_100014461
350 Ga0068856_100035794
351 Ga0068856_100562484
352 Ga0068856_100657379
353 Ga0070702_100417931
354 Ga0070702_101643374
355 Ga0068852_100149768
356 Ga0068852_102208093
357 Ga0068870_10951044
358 Ga0068863_101115547
359 Ga0068858_100548643
360 Ga0070717_10058354
361 Ga0070717_10396348
362 Ga0070717_11558842
363 Ga0070712_101083692
364 Ga0075433_10478759
365 Ga0075434_100013809
366 Ga0075434_101562505
367 Ga0075436_100028054
368 Ga0075435_100010431
369 Ga0075435_101374618
370 Ga0099795_10002958
371 Ga0105240_10050561
372 Ga0105240_11321782
373 Ga0105245_10086715
374 Ga0105245_10329818
375 Ga0105242_10003053
376 Ga0105237_10029633
377 Ga0105238_10235365
378 Ga0105238_10241301
379 Ga0105249_12832211
380 Ga0099796_10087357
381 Ga0105239_10673347
382 Ga0105239_11666871
383 Ga0157370_10752318
384 Ga0157369_10025790
385 Ga0157369_10042363
386 Ga0157369_11128395
387 Ga0157372_10006441
388 Ga0157372_10384177
389 Ga0157375_10220065
390 Ga0182008_10271237
391 Ga0157377_10635356
392 Ga0157379_10930545
393 Ga0157376_10437213
394 Ga0182005_1255917
395 Ga0206356_10331473
396 Ga0206356_11062105
397 Ga0206356_11213427
398 Ga0206353_10279259
399 Ga0206353_10390966
400 Ga0154015_1519419
401 Ga0213875_10001898
402 Ga0224712_10445396
403 Ga0207680_10584226
404 Ga0207699_10101497
405 Ga0207643_10750407
406 Ga0207707_10066803
407 Ga0207707_10457418
408 Ga0207707_10656975
409 Ga0207695_10024882
410 Ga0207671_10133344
411 Ga0207663_10053614
412 Ga0207660_10035619
413 Ga0207657_10065204
414 Ga0207652_10008951
415 Ga0207652_10037885
416 Ga0207652_10444204
417 Ga0207694_10195421
418 Ga0207687_10053507
419 Ga0207687_10095592
420 Ga0207687_10230444
421 Ga0207700_11627143
422 Ga0207664_10368505
423 Ga0207644_10021592
424 Ga0207644_10143205
425 Ga0207665_10705909
426 Ga0207711_10490714
427 Ga0207689_10427561
428 Ga0207661_10001706
429 Ga0207661_10057950
430 Ga0207661_10250907
431 Ga0207661_10585751
432 Ga0207661_10611820
433 Ga0207679_10072923
434 Ga0207679_10149123
435 Ga0207679_10305019
436 Ga0207667_10046064
437 Ga0207640_10852870
438 Ga0207677_11740798
439 Ga0207639_10017717
440 Ga0207639_11469551
441 Ga0207702_10011886
442 Ga0207702_11961623
443 Ga0207674_10010849
444 Ga0207674_10735813
445 Ga0207683_10229326
446 Ga0207683_10550383
447 Ga0207698_10189846
448 Ga0207698_10820625
449 Ga0207698_11311876
450 Ga0268266_11753083
451 Ga0265336_10027559
452 Ga0265338_10026977
453 Ga0265330_10105491
454 Ga0265325_10043684
455 Ga0265339_10044702
456 Ga0265313_10027776
457 Ga0265314_10069016
458 Ga0265342_10264945
459 Ga0307416_100678969
460 Ga0307415_100105731
461 Ga0373945_0365121
462 Ga0373943_0053567
463 Ga0373943_0086522
464 Ga0373931_0040712
465 Ga0373935_0234455
466 Ga0373947_0691062
467 Ga0373925_0288892
468 Ga0373925_0561158
469 Ga0395899_0017920
470 Ga0395899_0215682
471 Ga0395900_0008487
472 Ga0395900_0022229
473 Ga0395900_0027519
474 Ga0395900_0064296
475 Ga0395900_0259746
476 Ga0395898_0010747
477 Ga0395898_0047675
478 Ga0395898_0056255
479 Ga0395898_0088580
480 Ga0395898_0109491
481 Ga0395898_0122394
482 Ga0395898_0188361
483 Ga0395898_0261093
484 Ga0395898_0410652
485 Ga0395898_0570864
486 Ga0395898_0580297
487 Ga0395898_0901302
488 Ga0395905_0010983
489 Ga0395905_0024574
490 Ga0395905_0086419
491 Ga0395905_0264546
492 Ga0436364_1411651
493 Ga0395901_0003734
494 Ga0395901_0053786
495 Ga0395901_0068887
496 Ga0395901_0070636
497 Ga0395901_0077075
498 Ga0395901_0288686
499 Ga0395901_0477360
500 Ga0395901_0651356
501 Ga0395901_1565846
502 Ga0436365_0988706
503 Ga0436360_0588557
504 Ga0436362_0765238
505 Ga0451791_1951398
506 Ga0451793_0340483
507 Ga0451795_1389145
508 Ga0451798_0661951
509 Ga0451802_0469833
510 Ga0451804_0535290
511 Ga0451807_1521185
512 Ga0451835_0545002
513 Ga0451839_1618842
514 Ga0451841_1150082
515 Ga0451845_0886322
516 Ga0451849_1280701
517 Ga0451855_0994883
518 Ga0439463_032347
519 Ga0439434_0312223
520 Ga0450916_036672
521 Ga0439440_0247967
522 Ga0466961_0015871
523 Ga0466963_0225330
524 Ga0466963_0243106
525 Ga0466963_1018666
526 Ga0466971_0079812
527 Ga0466967_0027152
528 Ga0466967_0208131
529 Ga0466967_1455830
530 Ga0495592_0121605
531 Ga0495603_0807139
532 Ga0495580_0373759
533 Ga0495652_0308448
534 Ga0495652_0623244
535 Ga0495640_0211707
536 Ga0495645_0195895
537 Ga0495667_0179278
538 Ga0495668_0615575
539 Ga0495635_0688479
540 Ga0495599_0364430
541 Ga0495674_0117544
542 Ga0495674_1077026
543 Ga0495676_0075728
544 Ga0496100_0016385
545 Ga0496101_0048766
546 Ga0496101_0398079
547 Ga0496101_0510214
548 Ga0496102_1062423
549 Ga0496103_0035231
550 Ga0496104_0044335
551 Ga0496104_0046842
552 Ga0496104_0365438
553 Ga0496105_0003678
554 Ga0496105_1114811
555 Ga0496106_0013197
556 Ga0496106_0116038
557 Ga0496106_0882607
558 Ga0496107_0013606
559 Ga0496107_0095729
560 Ga0496108_0073925
561 Ga0496108_0110456
562 Ga0496109_0002814
563 Ga0496109_0035657
564 Ga0496109_0361645
565 Ga0496110_0018730
566 Ga0496110_0186664
567 Ga0496110_0227646
568 Ga0496110_0447728
569 Ga0496110_0613468
570 Ga0496110_1179856
571 Ga0496111_0007856
572 Ga0496111_0045980
573 Ga0496112_0345281
574 Ga0496112_0484460
575 Ga0496113_0246690
576 Ga0496114_0011141
577 Ga0496114_0206144
578 Ga0496115_0167442
579 Ga0496115_0549081
580 Ga0501068_0488305
581 Ga0501069_0040125
582 Ga0501069_0438766
583 nmdc:mga0n895_202053_c1
584 nmdc:mga0rr50_189284_c1
585 nmdc:mga08x19_45779_c1
586 nmdc:mga08x19_70293_c1
587 nmdc:mga0a205_394413_c1
588 Ga0495601_0227801
589 Ga0495601_0477220
590 Ga0495612_0071627
591 Ga0495595_0052052
592 Ga0587119_072375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bif-assembly2.cif.gz_H biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria 0.9415 1 129
4uxa-assembly3.cif.gz_R improved variant of (r)-selective manganese-dependent hydroxynitrile lyase from bacteria 0.9339 1 129
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.9221 22 112
4bif-assembly2.cif.gz_H biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria 0.9204 1 129
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.9135 20 110
ID Description Score Start End Superfamily
4bifA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9427 1 129 2.60.120.10
2f4pA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9233 11 132 2.60.120.10
4bifA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9216 1 129 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9099 36 108 2.60.120.10
2ozjB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.892 22 112 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q6DG11-F1-model_v4 deleted 1.001 36 131
AF-F3KPW6-F1-model_v4 Cupin 2 barrel domain-containing protein 1.001 38 129
AF-A0A5C7VIN8-F1-model_v4 Cupin domain-containing protein 0.9968 38 129
AF-A0A1B0ZP83-F1-model_v4 Cupin type-2 domain-containing protein 0.9944 34 129
AF-A0A527ZL51-F1-model_v4 Cupin domain-containing protein 0.9937 34 129

Map