F393306

General Info

Members Datasets Scaffolds Average Seq Length
296 190 592 126

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0623485|Ga0436364_0623485_252_644
Length 130
Sequence MVLVDTSVWVRFLANRAPYAQELEKLLAIDEVEGHEFVYGELLMSHASRRRLLAAYERIPQASTVAHREVVEFVRNRNLHGRGVGWIDIHLLASALVGRLFLWTADYRLSVLAAELGVAYTGFASAQINS

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
130 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
131 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.68
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 41.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0623485 3300037853 Bacteria 741
2 Ga0065712_10636384 3300005290 Unclassified 574
3 Ga0065715_10300529 3300005293 Bacteria 1042
4 Ga0065707_10003338 3300005295 Unclassified 3816
5 Ga0070680_100313497 3300005336 Bacteria 1331
6 Ga0070680_100903358 3300005336 Unclassified 762
7 Ga0068868_101230642 3300005338 Unclassified 693
8 Ga0070687_100211221 3300005343 Bacteria 1182
9 Ga0070668_100757472 3300005347 Bacteria 860
10 Ga0070669_100803237 3300005353 Unclassified 800
11 Ga0070675_100311369 3300005354 Bacteria 1389
12 Ga0070675_100383516 3300005354 Bacteria 1251
13 Ga0070675_100597548 3300005354 Bacteria 1001
14 Ga0070674_100371588 3300005356 Unclassified 1161
15 Ga0070673_100247672 3300005364 Bacteria 1552
16 Ga0070688_100143392 3300005365 Unclassified 1625
17 Ga0070709_10596199 3300005434 Bacteria 850
18 Ga0070713_100220566 3300005436 Unclassified 1720
19 Ga0070711_101495557 3300005439 Unclassified 589
20 Ga0070705_100541303 3300005440 Unclassified 891
21 Ga0070700_101613509 3300005441 Unclassified 554
22 Ga0070694_100613895 3300005444 Bacteria 877
23 Ga0070708_100013399 3300005445 Bacteria 6711
24 Ga0070678_100788710 3300005456 Bacteria 862
25 Ga0070662_100299924 3300005457 Bacteria 1305
26 Ga0070662_101501830 3300005457 Unclassified 581
27 Ga0068867_100426998 3300005459 Unclassified 1124
28 Ga0068867_101783126 3300005459 Unclassified 578
29 Ga0070707_101646287 3300005468 Unclassified 609
30 Ga0070698_100566846 3300005471 Bacteria 1075
31 Ga0070679_101086112 3300005530 Unclassified 745
32 Ga0070697_100856854 3300005536 Unclassified 805
33 Ga0068853_100606195 3300005539 Bacteria 1040
34 Ga0070672_100400946 3300005543 Bacteria 1176
35 Ga0070672_100667215 3300005543 Unclassified 909
36 Ga0070695_100417738 3300005545 Unclassified 1021
37 Ga0070696_100373316 3300005546 Bacteria 1110
38 Ga0070696_101428442 3300005546 Unclassified 590
39 Ga0070704_100666960 3300005549 Unclassified 919
40 Ga0068855_100165563 3300005563 Bacteria 2507
41 Ga0070664_100542722 3300005564 Unclassified 1075
42 Ga0070702_100667448 3300005615 Bacteria 788
43 Ga0068859_100173373 3300005617 Unclassified 2239
44 Ga0068859_100767283 3300005617 Unclassified 1053
45 Ga0068866_10487297 3300005718 Bacteria 813
46 Ga0068861_100743370 3300005719 Unclassified 915
47 Ga0068863_101318186 3300005841 Unclassified 729
48 Ga0068858_100461943 3300005842 Bacteria 1224
49 Ga0068858_101185911 3300005842 Unclassified 750
50 Ga0068858_101489832 3300005842 Unclassified 667
51 Ga0068862_100490287 3300005844 Bacteria 1165
52 Ga0068862_101000302 3300005844 Unclassified 827
53 Ga0081540_1158297 3300005983 Unclassified 883
54 Ga0075432_10402774 3300006058 Unclassified 591
55 Ga0070715_10387192 3300006163 Bacteria 773
56 Ga0070716_100138575 3300006173 Bacteria 1548
57 Ga0075428_100096219 3300006844 Bacteria 3227
58 Ga0075428_101450462 3300006844 Unclassified 720
59 Ga0075430_100029293 3300006846 Bacteria 4672
60 Ga0075430_100057035 3300006846 Bacteria 3285
61 Ga0075430_100075349 3300006846 Bacteria 2829
62 Ga0075431_100012386 3300006847 Bacteria 8607
63 Ga0075431_100040828 3300006847 Bacteria 4783
64 Ga0075431_100072006 3300006847 Bacteria 3566
65 Ga0075433_10036649 3300006852 Bacteria 4226
66 Ga0075433_10168105 3300006852 Bacteria 1952
67 Ga0075433_10672943 3300006852 Unclassified 907
68 Ga0075433_11146339 3300006852 Unclassified 675
69 Ga0075434_100026397 3300006871 Bacteria 5689
70 Ga0075434_100153305 3300006871 Bacteria 2324
71 Ga0075434_100402239 3300006871 Unclassified 1390
72 Ga0075429_100069662 3300006880 Bacteria 3062
73 Ga0075429_100251166 3300006880 Unclassified 1549
74 Ga0068865_100452611 3300006881 Unclassified 1062
75 Ga0075436_100019170 3300006914 Bacteria 4687
76 Ga0075436_101244769 3300006914 Unclassified 562
77 Ga0097620_100173385 3300006931 Unclassified 2239
78 Ga0097620_100767355 3300006931 Unclassified 1053
79 Ga0075435_100007449 3300007076 Bacteria 7798
80 Ga0075435_100011791 3300007076 Bacteria 6450
81 Ga0075435_100351474 3300007076 Unclassified 1263
82 Ga0105240_10829007 3300009093 Bacteria 1000
83 Ga0111539_10059995 3300009094 Bacteria 4509
84 Ga0111539_11058156 3300009094 Unclassified 943
85 Ga0111539_11956187 3300009094 Unclassified 680
86 Ga0105245_11006464 3300009098 Unclassified 878
87 Ga0105247_11397836 3300009101 Unclassified 566
88 Ga0114129_10053509 3300009147 Bacteria 5661
89 Ga0114129_10088006 3300009147 Bacteria 4306
90 Ga0114129_10653859 3300009147 Bacteria 1356
91 Ga0114129_10668110 3300009147 Bacteria 1339
92 Ga0114129_10825888 3300009147 Bacteria 1180
93 Ga0105243_10070211 3300009148 Bacteria 2828
94 Ga0105242_10048795 3300009176 Bacteria 3442
95 Ga0105242_10911891 3300009176 Unclassified 880
96 Ga0105248_10036052 3300009177 Bacteria 5532
97 Ga0105248_11718093 3300009177 Unclassified 711
98 Ga0105238_10037818 3300009551 Bacteria 4904
99 Ga0105238_10226269 3300009551 Bacteria 1847
100 Ga0105249_10097117 3300009553 Bacteria 2765
101 Ga0105249_10395345 3300009553 Unclassified 1411
102 Ga0105249_10570514 3300009553 Bacteria 1184
103 Ga0105249_11458193 3300009553 Bacteria 756
104 Ga0157316_1003157 3300012510 Bacteria 1171
105 Ga0157370_10581567 3300013104 Bacteria 1026
106 Ga0157378_11616250 3300013297 Unclassified 694
107 Ga0163162_10244725 3300013306 Bacteria 1925
108 Ga0163162_10458751 3300013306 Unclassified 1406
109 Ga0157372_10282868 3300013307 Bacteria 1929
110 Ga0157375_10165661 3300013308 Bacteria 2355
111 Ga0163163_12153718 3300014325 Unclassified 617
112 Ga0157380_10073910 3300014326 Bacteria 2766
113 Ga0157376_10026045 3300014969 Bacteria 4615
114 Ga0163161_10190364 3300017792 Bacteria 1577
115 Ga0206350_11431312 3300020080 Bacteria 781
116 Ga0213875_10001842 3300021388 Bacteria 13171
117 Ga0213875_10147818 3300021388 Bacteria 1101
118 Ga0213875_10158055 3300021388 Unclassified 1063
119 Ga0213875_10414551 3300021388 Unclassified 643
120 Ga0213875_10604471 3300021388 Unclassified 530
121 Ga0213871_10127685 3300021441 Unclassified 762
122 Ga0224712_10400664 3300022467 Bacteria 654
123 Ga0207699_10327237 3300025906 Bacteria 1077
124 Ga0207671_10367360 3300025914 Bacteria 1142
125 Ga0207663_10353036 3300025916 Unclassified 1114
126 Ga0207662_10063748 3300025918 Bacteria 2216
127 Ga0207646_10680492 3300025922 Bacteria 921
128 Ga0207681_10335926 3300025923 Unclassified 1206
129 Ga0207694_10278290 3300025924 Bacteria 1374
130 Ga0207700_10229339 3300025928 Bacteria 1578
131 Ga0207706_10428699 3300025933 Bacteria 1145
132 Ga0207706_10701731 3300025933 Unclassified 864
133 Ga0207686_11044766 3300025934 Unclassified 664
134 Ga0207669_10340671 3300025937 Unclassified 1155
135 Ga0207665_10327459 3300025939 Unclassified 1151
136 Ga0207711_10098220 3300025941 Bacteria 2587
137 Ga0207679_10607233 3300025945 Unclassified 986
138 Ga0207667_10025561 3300025949 Bacteria 6462
139 Ga0207651_10693865 3300025960 Bacteria 896
140 Ga0207712_10051482 3300025961 Unclassified 2880
141 Ga0207712_10689656 3300025961 Bacteria 891
142 Ga0207668_10348421 3300025972 Bacteria 1238
143 Ga0207668_11907005 3300025972 Unclassified 536
144 Ga0207703_10405439 3300026035 Bacteria 1266
145 Ga0207639_10743673 3300026041 Bacteria 912
146 Ga0207708_11305616 3300026075 Unclassified 636
147 Ga0207708_11487229 3300026075 Unclassified 595
148 Ga0207648_11884887 3300026089 Unclassified 559
149 Ga0207675_100148042 3300026118 Bacteria 2234
150 Ga0207428_10631557 3300027907 Unclassified 770
151 Ga0268265_10069782 3300028380 Bacteria 2730
152 Ga0268265_10444218 3300028380 Bacteria 1210
153 Ga0265338_10037359 3300028800 Bacteria 4624
154 Ga0265762_1015161 3300030760 Bacteria 1394
155 Ga0265328_10000234 3300031239 Bacteria 25554
156 Ga0265339_10009416 3300031249 Bacteria 6143
157 Ga0265316_10034280 3300031344 Bacteria 4125
158 Ga0265316_10383975 3300031344 Bacteria 1013
159 Ga0265316_10387627 3300031344 Bacteria 1007
160 Ga0307408_100370951 3300031548 Bacteria 1220
161 Ga0265314_10002220 3300031711 Bacteria 20216
162 Ga0265342_10001187 3300031712 Bacteria 24743
163 Ga0307416_100206730 3300032002 Bacteria 1868
164 Ga0307411_10247343 3300032005 Bacteria 1400
165 Ga0307415_100932219 3300032126 Bacteria 803
166 Ga0373950_0000038 3300034818 Bacteria 117886
167 Ga0373941_0013828 3300035115 Bacteria 2143
168 Ga0373953_0045650 3300035117 Bacteria 1757
169 Ga0373954_0180093 3300035118 Bacteria 1036
170 Ga0373956_0554217 3300035119 Bacteria 549
171 Ga0373931_1051857 3300035691 Unclassified 553
172 Ga0373933_0462267 3300035724 Bacteria 830
173 Ga0373933_0601633 3300035724 Bacteria 722
174 Ga0373947_0056940 3300035725 Unclassified 2364
175 Ga0373937_0062965 3300036401 Unclassified 3411
176 Ga0373937_0200237 3300036401 Bacteria 1877
177 Ga0373925_0165979 3300037068 Bacteria 1741
178 Ga0373925_0236984 3300037068 Unclassified 1460
179 Ga0436364_0129256 3300037853 Bacteria 1305
180 Ga0436364_0223795 3300037853 Bacteria 27679
181 Ga0436364_0272606 3300037853 Unclassified 657
182 Ga0436364_1550170 3300037853 Unclassified 1747
183 Ga0436365_1452684 3300039437 Unclassified 1214
184 Ga0436360_0462992 3300039438 Unclassified 765
185 Ga0436363_0130836 3300039450 Unclassified 963
186 Ga0451791_0586700 3300041451 Bacteria 595
187 Ga0439443_075657 3300042003 Unclassified 620
188 Ga0439460_0170815 3300042461 Bacteria 732
189 Ga0453683_1062446 3300044673 Unclassified 539
190 Ga0466968_0332006 3300044735 Unclassified 736
191 Ga0451576_0370131 3300045051 Bacteria 1501
192 Ga0451576_0408214 3300045051 Bacteria 1424
193 Ga0495580_0084671 3300046472 Unclassified 2208
194 Ga0495587_0332071 3300046536 Bacteria 849
195 Ga0495645_0158273 3300046543 Bacteria 1568
196 Ga0495667_0045648 3300046559 Bacteria 2900
197 Ga0495667_0517452 3300046559 Unclassified 747
198 Ga0495659_0217639 3300046664 Unclassified 788
199 Ga0495623_0386888 3300046679 Bacteria 755
200 Ga0495658_0169815 3300046683 Unclassified 1349
201 Ga0495675_0278418 3300047444 Bacteria 998
202 Ga0495602_0182466 3300048088 Bacteria 1617
203 Ga0495602_0472718 3300048088 Bacteria 881
204 Ga0496112_0321139 3300048915 Bacteria 1493
205 Ga0501032_0296306 3300049569 Unclassified 1046
206 Ga0501033_0062808 3300049570 Bacteria 2735
207 Ga0501033_0176032 3300049570 Unclassified 1535
208 Ga0501034_0004072 3300049571 Bacteria 16405
209 Ga0501034_0030297 3300049571 Bacteria 5499
210 Ga0501036_0315561 3300049572 Unclassified 1306
211 Ga0501037_0218634 3300049573 Unclassified 1341
212 Ga0501037_0542397 3300049573 Unclassified 786
213 Ga0501038_0060969 3300049574 Bacteria 3227
214 Ga0501038_0553894 3300049574 Bacteria 874
215 Ga0501040_0011635 3300049576 Bacteria 5759
216 Ga0501040_0287771 3300049576 Unclassified 1174
217 Ga0501041_0021340 3300049577 Bacteria 3881
218 Ga0501042_0025422 3300049578 Bacteria 4159
219 Ga0501042_0778143 3300049578 Unclassified 696
220 Ga0501043_0003266 3300049579 Bacteria 13371
221 Ga0501043_0292583 3300049579 Unclassified 1246
222 Ga0501043_1216135 3300049579 Unclassified 528
223 Ga0501046_0062311 3300049580 Bacteria 2914
224 Ga0501046_0079840 3300049580 Bacteria 2529
225 Ga0501046_0191666 3300049580 Unclassified 1524
226 Ga0501047_0018258 3300049581 Bacteria 6722
227 Ga0501047_0873710 3300049581 Unclassified 713
228 Ga0501048_0396271 3300049582 Unclassified 986
229 Ga0501068_0058556 3300049584 Bacteria 2338
230 Ga0501068_0287945 3300049584 Unclassified 1050
231 Ga0501069_0959008 3300049585 Unclassified 521
232 Ga0501070_0069596 3300049586 Bacteria 2913
233 Ga0501070_0268392 3300049586 Bacteria 1394
234 Ga0501071_0008379 3300049587 Bacteria 6832
235 Ga0501071_1553448 3300049587 Unclassified 511
236 Ga0501072_0000067 3300049588 Bacteria 75685
237 Ga0501072_0030638 3300049588 Bacteria 4208
238 Ga0501073_0019283 3300049589 Bacteria 4926
239 Ga0501074_0061608 3300049590 Bacteria 2703
240 Ga0501074_0095662 3300049590 Bacteria 2127
241 Ga0501075_0001318 3300049591 Bacteria 16097
242 Ga0501075_0160155 3300049591 Unclassified 1717
243 Ga0501075_0678454 3300049591 Unclassified 785
244 Ga0501076_0000549 3300049592 Bacteria 23984
245 Ga0501076_0067363 3300049592 Plasmid 2859
246 Ga0501076_0068190 3300049592 Bacteria 2841
247 Ga0501076_0938877 3300049592 Unclassified 713
248 Ga0501077_0048568 3300049593 Unclassified 2696
249 Ga0501261_039417 3300049690 Unclassified 740
250 Ga0501079_0001109 3300049741 Bacteria 18728
251 Ga0501079_0042637 3300049741 Bacteria 3503
252 Ga0501080_0014456 3300049742 Bacteria 7271
253 Ga0501080_0105919 3300049742 Bacteria 2607
254 Ga0501080_0138184 3300049742 Bacteria 2254
255 Ga0501080_0226256 3300049742 Bacteria 1710
256 Ga0501081_0015453 3300049743 Bacteria 5037
257 Ga0501081_0464311 3300049743 Unclassified 941
258 Ga0501083_0298191 3300049744 Unclassified 1048
259 Ga0501035_0014917 3300049822 Bacteria 7170
260 Ga0501035_0509790 3300049822 Unclassified 989
261 Ga0501044_0423471 3300049823 Bacteria 1241
262 Ga0501045_0029268 3300049824 Bacteria 3980
263 Ga0501045_0428523 3300049824 Unclassified 984
264 nmdc:mga05p37_1479808_c1 3300050507 Unclassified 678
265 nmdc:mga05p37_214899_c1 3300050507 Unclassified 2323
266 nmdc:mga05p37_466590_c1 3300050507 Bacteria 1458
267 nmdc:mga05p37_53412_c1 3300050507 Bacteria 4969
268 nmdc:mga09592_5575_c1 3300050508 Bacteria 10250
269 nmdc:mga09592_76841_c1 3300050508 Bacteria 2840
270 nmdc:mga0qj67_186249_c1 3300050509 Bacteria 1686
271 nmdc:mga06r32_309175_c1 3300050510 Unclassified 1566
272 nmdc:mga08y16_149103_c1 3300050511 Bacteria 2432
273 nmdc:mga08y16_1805489_c1 3300050511 Unclassified 564
274 nmdc:mga08y16_300506_c1 3300050511 Unclassified 1654
275 nmdc:mga0n895_184348_c1 3300050512 Unclassified 2119
276 nmdc:mga0n895_32526_c1 3300050512 Bacteria 5007
277 nmdc:mga0n895_430844_c1 3300050512 Bacteria 1333
278 nmdc:mga0rr50_1132021_c1 3300050513 Unclassified 666
279 nmdc:mga0rr50_20085_c1 3300050513 Unclassified 4527
280 nmdc:mga0rr50_30749_c1 3300050513 Bacteria 3806
281 nmdc:mga08x19_101786_c1 3300050514 Unclassified 1907
282 nmdc:mga08x19_21972_c1 3300050514 Bacteria 3946
283 nmdc:mga0a205_35814_c1 3300050515 Bacteria 4767
284 nmdc:mga0a205_590956_c1 3300050515 Unclassified 964
285 nmdc:mga0a205_79599_c1 3300050515 Unclassified 3167
286 Ga0495601_0445996 3300053077 Bacteria 837
287 Ga0501084_0019193 3300054114 Bacteria 5694
288 Ga0501084_0689886 3300054114 Unclassified 861
289 Ga0501084_1093971 3300054114 Unclassified 669
290 Ga0590074_116821 3300059423 Unclassified 529
291 Ga0590075_092082 3300059424 Unclassified 787
292 Ga0501082_0009760 3300060353 Bacteria 8270
293 Ga0501082_0092936 3300060353 Bacteria 2606
294 Ga0501082_0141822 3300060353 Bacteria 2085
295 Ga0530510_0000801 3300061734 Bacteria 20461
296 Ga0530510_0156619 3300061734 Unclassified 1684
297 Ga0436364_0623485
298 Ga0065712_10636384
299 Ga0065715_10300529
300 Ga0065707_10003338
301 Ga0070680_100313497
302 Ga0070680_100903358
303 Ga0068868_101230642
304 Ga0070687_100211221
305 Ga0070668_100757472
306 Ga0070669_100803237
307 Ga0070675_100311369
308 Ga0070675_100383516
309 Ga0070675_100597548
310 Ga0070674_100371588
311 Ga0070673_100247672
312 Ga0070688_100143392
313 Ga0070709_10596199
314 Ga0070713_100220566
315 Ga0070711_101495557
316 Ga0070705_100541303
317 Ga0070700_101613509
318 Ga0070694_100613895
319 Ga0070708_100013399
320 Ga0070678_100788710
321 Ga0070662_100299924
322 Ga0070662_101501830
323 Ga0068867_100426998
324 Ga0068867_101783126
325 Ga0070707_101646287
326 Ga0070698_100566846
327 Ga0070679_101086112
328 Ga0070697_100856854
329 Ga0068853_100606195
330 Ga0070672_100400946
331 Ga0070672_100667215
332 Ga0070695_100417738
333 Ga0070696_100373316
334 Ga0070696_101428442
335 Ga0070704_100666960
336 Ga0068855_100165563
337 Ga0070664_100542722
338 Ga0070702_100667448
339 Ga0068859_100173373
340 Ga0068859_100767283
341 Ga0068866_10487297
342 Ga0068861_100743370
343 Ga0068863_101318186
344 Ga0068858_100461943
345 Ga0068858_101185911
346 Ga0068858_101489832
347 Ga0068862_100490287
348 Ga0068862_101000302
349 Ga0081540_1158297
350 Ga0075432_10402774
351 Ga0070715_10387192
352 Ga0070716_100138575
353 Ga0075428_100096219
354 Ga0075428_101450462
355 Ga0075430_100029293
356 Ga0075430_100057035
357 Ga0075430_100075349
358 Ga0075431_100012386
359 Ga0075431_100040828
360 Ga0075431_100072006
361 Ga0075433_10036649
362 Ga0075433_10168105
363 Ga0075433_10672943
364 Ga0075433_11146339
365 Ga0075434_100026397
366 Ga0075434_100153305
367 Ga0075434_100402239
368 Ga0075429_100069662
369 Ga0075429_100251166
370 Ga0068865_100452611
371 Ga0075436_100019170
372 Ga0075436_101244769
373 Ga0097620_100173385
374 Ga0097620_100767355
375 Ga0075435_100007449
376 Ga0075435_100011791
377 Ga0075435_100351474
378 Ga0105240_10829007
379 Ga0111539_10059995
380 Ga0111539_11058156
381 Ga0111539_11956187
382 Ga0105245_11006464
383 Ga0105247_11397836
384 Ga0114129_10053509
385 Ga0114129_10088006
386 Ga0114129_10653859
387 Ga0114129_10668110
388 Ga0114129_10825888
389 Ga0105243_10070211
390 Ga0105242_10048795
391 Ga0105242_10911891
392 Ga0105248_10036052
393 Ga0105248_11718093
394 Ga0105238_10037818
395 Ga0105238_10226269
396 Ga0105249_10097117
397 Ga0105249_10395345
398 Ga0105249_10570514
399 Ga0105249_11458193
400 Ga0157316_1003157
401 Ga0157370_10581567
402 Ga0157378_11616250
403 Ga0163162_10244725
404 Ga0163162_10458751
405 Ga0157372_10282868
406 Ga0157375_10165661
407 Ga0163163_12153718
408 Ga0157380_10073910
409 Ga0157376_10026045
410 Ga0163161_10190364
411 Ga0206350_11431312
412 Ga0213875_10001842
413 Ga0213875_10147818
414 Ga0213875_10158055
415 Ga0213875_10414551
416 Ga0213875_10604471
417 Ga0213871_10127685
418 Ga0224712_10400664
419 Ga0207699_10327237
420 Ga0207671_10367360
421 Ga0207663_10353036
422 Ga0207662_10063748
423 Ga0207646_10680492
424 Ga0207681_10335926
425 Ga0207694_10278290
426 Ga0207700_10229339
427 Ga0207706_10428699
428 Ga0207706_10701731
429 Ga0207686_11044766
430 Ga0207669_10340671
431 Ga0207665_10327459
432 Ga0207711_10098220
433 Ga0207679_10607233
434 Ga0207667_10025561
435 Ga0207651_10693865
436 Ga0207712_10051482
437 Ga0207712_10689656
438 Ga0207668_10348421
439 Ga0207668_11907005
440 Ga0207703_10405439
441 Ga0207639_10743673
442 Ga0207708_11305616
443 Ga0207708_11487229
444 Ga0207648_11884887
445 Ga0207675_100148042
446 Ga0207428_10631557
447 Ga0268265_10069782
448 Ga0268265_10444218
449 Ga0265338_10037359
450 Ga0265762_1015161
451 Ga0265328_10000234
452 Ga0265339_10009416
453 Ga0265316_10034280
454 Ga0265316_10383975
455 Ga0265316_10387627
456 Ga0307408_100370951
457 Ga0265314_10002220
458 Ga0265342_10001187
459 Ga0307416_100206730
460 Ga0307411_10247343
461 Ga0307415_100932219
462 Ga0373950_0000038
463 Ga0373941_0013828
464 Ga0373953_0045650
465 Ga0373954_0180093
466 Ga0373956_0554217
467 Ga0373931_1051857
468 Ga0373933_0462267
469 Ga0373933_0601633
470 Ga0373947_0056940
471 Ga0373937_0062965
472 Ga0373937_0200237
473 Ga0373925_0165979
474 Ga0373925_0236984
475 Ga0436364_0129256
476 Ga0436364_0223795
477 Ga0436364_0272606
478 Ga0436364_1550170
479 Ga0436365_1452684
480 Ga0436360_0462992
481 Ga0436363_0130836
482 Ga0451791_0586700
483 Ga0439443_075657
484 Ga0439460_0170815
485 Ga0453683_1062446
486 Ga0466968_0332006
487 Ga0451576_0370131
488 Ga0451576_0408214
489 Ga0495580_0084671
490 Ga0495587_0332071
491 Ga0495645_0158273
492 Ga0495667_0045648
493 Ga0495667_0517452
494 Ga0495659_0217639
495 Ga0495623_0386888
496 Ga0495658_0169815
497 Ga0495675_0278418
498 Ga0495602_0182466
499 Ga0495602_0472718
500 Ga0496112_0321139
501 Ga0501032_0296306
502 Ga0501033_0062808
503 Ga0501033_0176032
504 Ga0501034_0004072
505 Ga0501034_0030297
506 Ga0501036_0315561
507 Ga0501037_0218634
508 Ga0501037_0542397
509 Ga0501038_0060969
510 Ga0501038_0553894
511 Ga0501040_0011635
512 Ga0501040_0287771
513 Ga0501041_0021340
514 Ga0501042_0025422
515 Ga0501042_0778143
516 Ga0501043_0003266
517 Ga0501043_0292583
518 Ga0501043_1216135
519 Ga0501046_0062311
520 Ga0501046_0079840
521 Ga0501046_0191666
522 Ga0501047_0018258
523 Ga0501047_0873710
524 Ga0501048_0396271
525 Ga0501068_0058556
526 Ga0501068_0287945
527 Ga0501069_0959008
528 Ga0501070_0069596
529 Ga0501070_0268392
530 Ga0501071_0008379
531 Ga0501071_1553448
532 Ga0501072_0000067
533 Ga0501072_0030638
534 Ga0501073_0019283
535 Ga0501074_0061608
536 Ga0501074_0095662
537 Ga0501075_0001318
538 Ga0501075_0160155
539 Ga0501075_0678454
540 Ga0501076_0000549
541 Ga0501076_0067363
542 Ga0501076_0068190
543 Ga0501076_0938877
544 Ga0501077_0048568
545 Ga0501261_039417
546 Ga0501079_0001109
547 Ga0501079_0042637
548 Ga0501080_0014456
549 Ga0501080_0105919
550 Ga0501080_0138184
551 Ga0501080_0226256
552 Ga0501081_0015453
553 Ga0501081_0464311
554 Ga0501083_0298191
555 Ga0501035_0014917
556 Ga0501035_0509790
557 Ga0501044_0423471
558 Ga0501045_0029268
559 Ga0501045_0428523
560 nmdc:mga05p37_1479808_c1
561 nmdc:mga05p37_214899_c1
562 nmdc:mga05p37_466590_c1
563 nmdc:mga05p37_53412_c1
564 nmdc:mga09592_5575_c1
565 nmdc:mga09592_76841_c1
566 nmdc:mga0qj67_186249_c1
567 nmdc:mga06r32_309175_c1
568 nmdc:mga08y16_149103_c1
569 nmdc:mga08y16_1805489_c1
570 nmdc:mga08y16_300506_c1
571 nmdc:mga0n895_184348_c1
572 nmdc:mga0n895_32526_c1
573 nmdc:mga0n895_430844_c1
574 nmdc:mga0rr50_1132021_c1
575 nmdc:mga0rr50_20085_c1
576 nmdc:mga0rr50_30749_c1
577 nmdc:mga08x19_101786_c1
578 nmdc:mga08x19_21972_c1
579 nmdc:mga0a205_35814_c1
580 nmdc:mga0a205_590956_c1
581 nmdc:mga0a205_79599_c1
582 Ga0495601_0445996
583 Ga0501084_0019193
584 Ga0501084_0689886
585 Ga0501084_1093971
586 Ga0590074_116821
587 Ga0590075_092082
588 Ga0501082_0009760
589 Ga0501082_0092936
590 Ga0501082_0141822
591 Ga0530510_0000801
592 Ga0530510_0156619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

115

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.8214 2 120
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.8055 1 120
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.798 2 120
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.7885 1 120
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.7719 1 107
ID Description Score Start End Superfamily
af_P9WF73_1_115_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9178 1 116 3.40.50.1010
af_P9WF73_1_115_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9027 1 116 3.40.50.1010
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8169 1 120 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7998 1 113 3.40.50.1010
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7991 1 120 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2N9MF49-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 1.001 1 122 GO:0000287
GO:0004540
GO:0090729
AF-A0A143PUR4-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9997 1 122 GO:0000287
GO:0004540
GO:0090729
AF-A0A2V8UB32-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9995 1 122 GO:0000287
GO:0004540
GO:0090729
AF-A0A359LUG6-F1-model_v4 PIN domain-containing protein 0.995 1 119
AF-A0A2N9MF49-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9928 1 122 GO:0000287
GO:0004540
GO:0090729

Map