F393275

General Info

Members Datasets Scaffolds Average Seq Length
296 171 592 118

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100283428|Ga0307409_1002834282
Length 138
Sequence MTAGGSRPRPPAAPGRWARVRRVSSGDTKTLIKQAVENLQQEVPALKQLKLVIRLELRARGDVPIWRVEVPGPKIDKDPAGDARIDVSVARSHFNELAAEGRLKHWVEAYDTGHVRVSGEPAVTKLIGNVIQRQLARA

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
121 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
122 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 1.69
Rhizosphere 96.28
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100283428 3300031995 Bacteria 1533
2 LJQas_1000545 3300000549 Bacteria 6181
3 JGI24735J21928_10062286 3300002067 Bacteria 1071
4 JGI25407J50210_10000174 3300003373 Bacteria 10478
5 JGI25407J50210_10011959 3300003373 Bacteria 2223
6 JGI25407J50210_10015507 3300003373 Bacteria 1968
7 JGI25407J50210_10020597 3300003373 Bacteria 1714
8 JGI25407J50210_10027031 3300003373 Bacteria 1488
9 JGI25407J50210_10037046 3300003373 Bacteria 1254
10 JGI25407J50210_10181935 3300003373 Bacteria 518
11 Ga0070658_10103313 3300005327 Bacteria 2357
12 Ga0070676_10320110 3300005328 Bacteria 1057
13 Ga0070683_100004572 3300005329 Bacteria 11420
14 Ga0070683_100037520 3300005329 Bacteria 4436
15 Ga0070680_100018952 3300005336 Bacteria 5445
16 Ga0070680_100732338 3300005336 Unclassified 851
17 Ga0070660_100004701 3300005339 Bacteria 9455
18 Ga0070660_100939129 3300005339 Bacteria 730
19 Ga0070691_10096479 3300005341 Bacteria 1464
20 Ga0070691_10296481 3300005341 Unclassified 882
21 Ga0070691_10347501 3300005341 Bacteria 823
22 Ga0070687_100447832 3300005343 Bacteria 858
23 Ga0070661_100408828 3300005344 Bacteria 1074
24 Ga0070692_10707397 3300005345 Bacteria 679
25 Ga0070668_100078797 3300005347 Bacteria 2577
26 Ga0070659_100022813 3300005366 Bacteria 4781
27 Ga0070711_100706755 3300005439 Bacteria 849
28 Ga0070705_101164527 3300005440 Bacteria 634
29 Ga0070700_100086104 3300005441 Bacteria 2040
30 Ga0070700_100984987 3300005441 Bacteria 692
31 Ga0070708_100683161 3300005445 Bacteria 967
32 Ga0070662_100107735 3300005457 Bacteria 2118
33 Ga0070681_10014682 3300005458 Bacteria 7790
34 Ga0070681_10232482 3300005458 Bacteria 1758
35 Ga0070679_100042669 3300005530 Bacteria 4518
36 Ga0070679_100055176 3300005530 Bacteria 3957
37 Ga0070684_100054473 3300005535 Bacteria 3485
38 Ga0070684_100166774 3300005535 Bacteria 1999
39 Ga0070684_101071994 3300005535 Bacteria 757
40 Ga0070696_100174416 3300005546 Bacteria 1591
41 Ga0070693_100363283 3300005547 Bacteria 994
42 Ga0070693_100589830 3300005547 Bacteria 801
43 Ga0070704_100135131 3300005549 Bacteria 1917
44 Ga0070704_100416105 3300005549 Bacteria 1150
45 Ga0068855_100156554 3300005563 Bacteria 2588
46 Ga0068855_100333636 3300005563 Bacteria 1674
47 Ga0068854_100202554 3300005578 Bacteria 1561
48 Ga0068854_100453446 3300005578 Bacteria 1072
49 Ga0068854_101076628 3300005578 Bacteria 715
50 Ga0068856_100065616 3300005614 Bacteria 3587
51 Ga0068852_100009704 3300005616 Bacteria 7153
52 Ga0068861_100032884 3300005719 Bacteria 3822
53 Ga0068863_101783593 3300005841 Unclassified 625
54 Ga0068860_102464130 3300005843 Bacteria 540
55 Ga0081455_10034175 3300005937 Bacteria 4558
56 Ga0081538_10000064 3300005981 Bacteria 99059
57 Ga0081538_10000221 3300005981 Bacteria 64192
58 Ga0081538_10000351 3300005981 Bacteria 52575
59 Ga0081538_10000513 3300005981 Bacteria 43328
60 Ga0081538_10000855 3300005981 Bacteria 32847
61 Ga0081538_10001118 3300005981 Bacteria 28443
62 Ga0081538_10002741 3300005981 Bacteria 16911
63 Ga0081538_10007705 3300005981 Bacteria 9277
64 Ga0081538_10008194 3300005981 Bacteria 8918
65 Ga0081538_10011323 3300005981 Bacteria 7234
66 Ga0081538_10012687 3300005981 Bacteria 6736
67 Ga0081538_10038673 3300005981 Bacteria 3073
68 Ga0081538_10047796 3300005981 Bacteria 2620
69 Ga0081538_10060344 3300005981 Bacteria 2182
70 Ga0081538_10072764 3300005981 Bacteria 1882
71 Ga0081538_10132772 3300005981 Bacteria 1166
72 Ga0081538_10161643 3300005981 Bacteria 994
73 Ga0075365_10466755 3300006038 Bacteria 892
74 Ga0075432_10575780 3300006058 Bacteria 512
75 Ga0075428_100018528 3300006844 Bacteria 7698
76 Ga0075428_100053720 3300006844 Bacteria 4414
77 Ga0075428_100099951 3300006844 Bacteria 3163
78 Ga0075428_101760582 3300006844 Bacteria 645
79 Ga0075430_100000085 3300006846 Bacteria 52821
80 Ga0075431_100005357 3300006847 Bacteria 12661
81 Ga0075431_101159807 3300006847 Unclassified 736
82 Ga0075433_10190690 3300006852 Bacteria 1823
83 Ga0075429_100086183 3300006880 Bacteria 2738
84 Ga0075429_101375530 3300006880 Bacteria 615
85 Ga0075429_101538180 3300006880 Bacteria 579
86 Ga0068865_101676101 3300006881 Bacteria 573
87 Ga0105250_10183323 3300009092 Bacteria 879
88 Ga0105240_10206218 3300009093 Bacteria 2301
89 Ga0105240_12549525 3300009093 Bacteria 528
90 Ga0111539_10012887 3300009094 Bacteria 10462
91 Ga0111539_10033518 3300009094 Bacteria 6235
92 Ga0111539_10103493 3300009094 Bacteria 3341
93 Ga0111539_10693444 3300009094 Bacteria 1185
94 Ga0111539_10841390 3300009094 Bacteria 1068
95 Ga0105245_10005584 3300009098 Bacteria 11052
96 Ga0114129_10028901 3300009147 Bacteria 7854
97 Ga0114129_10033936 3300009147 Bacteria 7208
98 Ga0114129_10207840 3300009147 Bacteria 2648
99 Ga0114129_10423916 3300009147 Bacteria 1749
100 Ga0114129_10483265 3300009147 Bacteria 1620
101 Ga0114129_11164645 3300009147 Bacteria 962
102 Ga0114129_11682023 3300009147 Bacteria 775
103 Ga0114129_11988852 3300009147 Bacteria 703
104 Ga0105237_10055021 3300009545 Bacteria 3986
105 Ga0105238_10028271 3300009551 Bacteria 5713
106 Ga0105249_10027570 3300009553 Bacteria 5125
107 Ga0105147_106599 3300009982 Bacteria 982
108 Ga0105239_10079872 3300010375 Bacteria 3599
109 Ga0105239_10326779 3300010375 Bacteria 1730
110 Ga0105246_10583264 3300011119 Bacteria 963
111 Ga0157371_10108292 3300013102 Bacteria 1972
112 Ga0157371_10392251 3300013102 Unclassified 1015
113 Ga0157370_10014157 3300013104 Bacteria 8179
114 Ga0157369_10003184 3300013105 Bacteria 19579
115 Ga0163162_10150678 3300013306 Bacteria 2443
116 Ga0157372_10019291 3300013307 Bacteria 7344
117 Ga0157372_12218345 3300013307 Bacteria 631
118 Ga0157380_10415808 3300014326 Bacteria 1281
119 Ga0163161_10058640 3300017792 Bacteria 2798
120 Ga0206356_10962434 3300020070 Bacteria 2094
121 Ga0206354_10020249 3300020081 Bacteria 972
122 Ga0206353_11074253 3300020082 Bacteria 3832
123 Ga0213876_10374225 3300021384 Bacteria 757
124 Ga0207688_10103959 3300025901 Bacteria 1643
125 Ga0207645_10049346 3300025907 Bacteria 2687
126 Ga0207705_10084154 3300025909 Bacteria 2322
127 Ga0207707_10116265 3300025912 Bacteria 2337
128 Ga0207695_10047982 3300025913 Bacteria 4513
129 Ga0207671_10017578 3300025914 Bacteria 5507
130 Ga0207693_10941995 3300025915 Unclassified 661
131 Ga0207660_10122039 3300025917 Bacteria 1974
132 Ga0207662_10434907 3300025918 Bacteria 895
133 Ga0207657_10021960 3300025919 Bacteria 5992
134 Ga0207649_10086570 3300025920 Bacteria 2042
135 Ga0207652_10007135 3300025921 Bacteria 9011
136 Ga0207652_10049357 3300025921 Bacteria 3602
137 Ga0207694_10423423 3300025924 Bacteria 1109
138 Ga0207687_10057456 3300025927 Bacteria 2734
139 Ga0207690_10010104 3300025932 Bacteria 5606
140 Ga0207706_10074660 3300025933 Bacteria 2981
141 Ga0207706_10995237 3300025933 Unclassified 705
142 Ga0207669_11080789 3300025937 Bacteria 677
143 Ga0207661_10002505 3300025944 Bacteria 12646
144 Ga0207661_10076204 3300025944 Bacteria 2754
145 Ga0207679_10527505 3300025945 Bacteria 1057
146 Ga0207667_10345114 3300025949 Bacteria 1519
147 Ga0207667_10765047 3300025949 Bacteria 964
148 Ga0207712_10319399 3300025961 Bacteria 1281
149 Ga0207668_11096547 3300025972 Bacteria 713
150 Ga0207640_10267611 3300025981 Bacteria 1335
151 Ga0207640_10514547 3300025981 Bacteria 999
152 Ga0207640_10815034 3300025981 Bacteria 810
153 Ga0207677_12318036 3300026023 Bacteria 500
154 Ga0207639_10238354 3300026041 Bacteria 1580
155 Ga0207708_10294893 3300026075 Bacteria 1317
156 Ga0207674_10102357 3300026116 Bacteria 2844
157 Ga0207675_100002581 3300026118 Bacteria 17948
158 Ga0207698_10065217 3300026142 Bacteria 2858
159 Ga0207428_10209384 3300027907 Archaea 1465
160 Ga0207428_10409850 3300027907 Bacteria 992
161 Ga0207428_10533463 3300027907 Bacteria 850
162 Ga0307408_100420023 3300031548 Bacteria 1153
163 Ga0307405_10078755 3300031731 Bacteria 2146
164 Ga0307413_10020472 3300031824 Bacteria 3519
165 Ga0307413_10100237 3300031824 Bacteria 1912
166 Ga0307410_10018645 3300031852 Bacteria 4198
167 Ga0307410_10044541 3300031852 Bacteria 2948
168 Ga0307410_10141355 3300031852 Bacteria 1781
169 Ga0307410_10435804 3300031852 Bacteria 1066
170 Ga0326468_10007887 3300031889 Unclassified 1020
171 Ga0307406_10005680 3300031901 Bacteria 6823
172 Ga0307406_10118759 3300031901 Bacteria 1834
173 Ga0307406_10443465 3300031901 Unclassified 1040
174 Ga0307412_10105089 3300031911 Bacteria 2005
175 Ga0307412_10330150 3300031911 Bacteria 1217
176 Ga0307409_100016624 3300031995 Bacteria 4874
177 Ga0307409_100044441 3300031995 Bacteria 3346
178 Ga0307409_100398085 3300031995 Bacteria 1314
179 Ga0307416_100013900 3300032002 Bacteria 5489
180 Ga0307416_100025469 3300032002 Bacteria 4336
181 Ga0307416_100090052 3300032002 Bacteria 2629
182 Ga0307416_100820795 3300032002 Bacteria 1027
183 Ga0307414_10448200 3300032004 Bacteria 1131
184 Ga0307414_10577848 3300032004 Bacteria 1005
185 Ga0307411_10068584 3300032005 Bacteria 2391
186 Ga0307411_10413817 3300032005 Bacteria 1118
187 Ga0307415_100013164 3300032126 Bacteria 4818
188 Ga0307415_100025176 3300032126 Bacteria 3729
189 Ga0307415_100127579 3300032126 Bacteria 1920
190 Ga0307415_102156856 3300032126 Bacteria 545
191 Ga0373948_0050063 3300034817 Bacteria 896
192 Ga0373932_0079864 3300035112 Bacteria 1031
193 Ga0373939_0067838 3300035114 Bacteria 1153
194 Ga0373962_0029358 3300035242 Bacteria 1498
195 Ga0373931_0043136 3300035691 Bacteria 2374
196 Ga0373947_0733635 3300035725 Bacteria 674
197 Ga0373925_1289262 3300037068 Bacteria 599
198 Ga0395900_0353789 3300037418 Bacteria 1442
199 Ga0395900_0521525 3300037418 Bacteria 1136
200 Ga0395900_1172044 3300037418 Bacteria 684
201 Ga0395898_0616025 3300037466 Bacteria 1028
202 Ga0395898_0941744 3300037466 Bacteria 801
203 Ga0395898_0985980 3300037466 Bacteria 779
204 Ga0395905_0518277 3300037471 Bacteria 1093
205 Ga0395905_0815596 3300037471 Bacteria 836
206 Ga0395905_1319803 3300037471 Bacteria 625
207 Ga0395901_0449513 3300038443 Bacteria 1318
208 Ga0395901_0551296 3300038443 Bacteria 1168
209 Ga0395901_0770081 3300038443 Bacteria 954
210 Ga0395901_0830481 3300038443 Bacteria 911
211 Ga0395901_2095326 3300038443 Unclassified 511
212 Ga0436365_0951873 3300039437 Bacteria 797
213 Ga0436362_0565002 3300039453 Bacteria 656
214 Ga0451839_1050099 3300041496 Bacteria 510
215 Ga0439463_004573 3300042016 Bacteria 3466
216 Ga0450888_025210 3300042126 Bacteria 776
217 Ga0439460_0013233 3300042461 Bacteria 2156
218 Ga0439440_0004670 3300042993 Bacteria 2699
219 Ga0466964_0745730 3300044706 Unclassified 549
220 Ga0466967_0007852 3300045976 Bacteria 7752
221 Ga0466967_0122090 3300045976 Bacteria 2409
222 Ga0495596_0090190 3300046500 Bacteria 1190
223 Ga0495596_0109284 3300046500 Bacteria 1073
224 Ga0495620_0056640 3300046515 Bacteria 1648
225 Ga0495631_0439905 3300046518 Bacteria 555
226 Ga0495632_0313372 3300046519 Bacteria 694
227 Ga0495637_0123943 3300046520 Bacteria 992
228 Ga0495656_0456766 3300046615 Bacteria 673
229 Ga0495588_0281667 3300046674 Bacteria 876
230 Ga0495670_0317686 3300046691 Bacteria 836
231 Ga0495589_0147547 3300046794 Bacteria 1124
232 Ga0495660_0275554 3300046810 Bacteria 771
233 Ga0495672_0051485 3300047320 Bacteria 2425
234 Ga0496102_0368879 3300048905 Bacteria 1351
235 Ga0496103_0820568 3300048906 Bacteria 586
236 Ga0496109_0610241 3300048912 Bacteria 1027
237 Ga0496112_0600200 3300048915 Bacteria 1033
238 Ga0496113_0403015 3300048916 Bacteria 1098
239 Ga0501031_0398366 3300049568 Bacteria 890
240 Ga0501031_0760706 3300049568 Bacteria 621
241 Ga0501032_0158852 3300049569 Bacteria 1485
242 Ga0501039_0183421 3300049575 Bacteria 1646
243 Ga0501040_0614534 3300049576 Bacteria 785
244 Ga0501041_0125276 3300049577 Bacteria 1599
245 Ga0501042_0565458 3300049578 Bacteria 826
246 Ga0501042_1119894 3300049578 Unclassified 574
247 Ga0501048_0282938 3300049582 Bacteria 1179
248 Ga0501067_0138558 3300049583 Bacteria 1355
249 Ga0501068_0979224 3300049584 Bacteria 558
250 Ga0501071_0133284 3300049587 Bacteria 1847
251 Ga0501071_0200467 3300049587 Bacteria 1499
252 Ga0501072_0040317 3300049588 Bacteria 3667
253 Ga0501072_1523623 3300049588 Archaea 516
254 Ga0501074_0647300 3300049590 Bacteria 747
255 Ga0501075_0965360 3300049591 Bacteria 648
256 Ga0501075_1012114 3300049591 Bacteria 631
257 Ga0501076_0839869 3300049592 Bacteria 757
258 Ga0501076_0873890 3300049592 Bacteria 741
259 Ga0501076_1446452 3300049592 Bacteria 564
260 Ga0501077_0290172 3300049593 Bacteria 1042
261 Ga0501077_0386741 3300049593 Bacteria 894
262 Ga0501079_0494774 3300049741 Bacteria 961
263 Ga0501081_0378195 3300049743 Bacteria 1046
264 Ga0501081_0955069 3300049743 Bacteria 647
265 Ga0501083_0823542 3300049744 Bacteria 604
266 Ga0501035_0748548 3300049822 Bacteria 784
267 Ga0501045_0097763 3300049824 Bacteria 2172
268 nmdc:mga0yw44_266631_c1 3300050492 Bacteria 1142
269 nmdc:mga0yw44_720864_c1 3300050492 Bacteria 677
270 nmdc:mga05p37_10033_c1 3300050507 Bacteria 11239
271 nmdc:mga05p37_1167330_c1 3300050507 Bacteria 799
272 nmdc:mga05p37_1227853_c1 3300050507 Bacteria 771
273 nmdc:mga05p37_15655_c1 3300050507 Bacteria 9115
274 nmdc:mga05p37_1963035_c1 3300050507 Bacteria 556
275 nmdc:mga05p37_2194004_c1 3300050507 Bacteria 513
276 nmdc:mga05p37_225757_c1 3300050507 Bacteria 2258
277 nmdc:mga05p37_950352_c1 3300050507 Bacteria 920
278 nmdc:mga09592_1092745_c1 3300050508 Bacteria 663
279 nmdc:mga09592_36080_c1 3300050508 Bacteria 4141
280 nmdc:mga09592_636365_c1 3300050508 Bacteria 911
281 nmdc:mga0qj67_1024802_c1 3300050509 Bacteria 647
282 nmdc:mga06r32_1556913_c1 3300050510 Bacteria 600
283 nmdc:mga06r32_52160_c1 3300050510 Bacteria 3917
284 nmdc:mga06r32_859661_c1 3300050510 Bacteria 865
285 nmdc:mga08y16_386801_c1 3300050511 Bacteria 1433
286 nmdc:mga08y16_4296_c1 3300050511 Bacteria 14877
287 nmdc:mga08y16_709104_c1 3300050511 Bacteria 1005
288 nmdc:mga08y16_8644_c1 3300050511 Bacteria 10680
289 nmdc:mga0a205_1192732_c1 3300050515 Bacteria 609
290 nmdc:mga0a205_77404_c1 3300050515 Bacteria 3214
291 Ga0501082_0077894 3300060353 Bacteria 2859
292 Ga0501082_0152646 3300060353 Bacteria 2007
293 Ga0530510_0033221 3300061734 Bacteria 3715
294 Ga0530510_0205165 3300061734 Bacteria 1465
295 Ga0530510_0477710 3300061734 Bacteria 944
296 Ga0530510_1368248 3300061734 Bacteria 543
297 Ga0307409_100283428
298 LJQas_1000545
299 JGI24735J21928_10062286
300 JGI25407J50210_10000174
301 JGI25407J50210_10011959
302 JGI25407J50210_10015507
303 JGI25407J50210_10020597
304 JGI25407J50210_10027031
305 JGI25407J50210_10037046
306 JGI25407J50210_10181935
307 Ga0070658_10103313
308 Ga0070676_10320110
309 Ga0070683_100004572
310 Ga0070683_100037520
311 Ga0070680_100018952
312 Ga0070680_100732338
313 Ga0070660_100004701
314 Ga0070660_100939129
315 Ga0070691_10096479
316 Ga0070691_10296481
317 Ga0070691_10347501
318 Ga0070687_100447832
319 Ga0070661_100408828
320 Ga0070692_10707397
321 Ga0070668_100078797
322 Ga0070659_100022813
323 Ga0070711_100706755
324 Ga0070705_101164527
325 Ga0070700_100086104
326 Ga0070700_100984987
327 Ga0070708_100683161
328 Ga0070662_100107735
329 Ga0070681_10014682
330 Ga0070681_10232482
331 Ga0070679_100042669
332 Ga0070679_100055176
333 Ga0070684_100054473
334 Ga0070684_100166774
335 Ga0070684_101071994
336 Ga0070696_100174416
337 Ga0070693_100363283
338 Ga0070693_100589830
339 Ga0070704_100135131
340 Ga0070704_100416105
341 Ga0068855_100156554
342 Ga0068855_100333636
343 Ga0068854_100202554
344 Ga0068854_100453446
345 Ga0068854_101076628
346 Ga0068856_100065616
347 Ga0068852_100009704
348 Ga0068861_100032884
349 Ga0068863_101783593
350 Ga0068860_102464130
351 Ga0081455_10034175
352 Ga0081538_10000064
353 Ga0081538_10000221
354 Ga0081538_10000351
355 Ga0081538_10000513
356 Ga0081538_10000855
357 Ga0081538_10001118
358 Ga0081538_10002741
359 Ga0081538_10007705
360 Ga0081538_10008194
361 Ga0081538_10011323
362 Ga0081538_10012687
363 Ga0081538_10038673
364 Ga0081538_10047796
365 Ga0081538_10060344
366 Ga0081538_10072764
367 Ga0081538_10132772
368 Ga0081538_10161643
369 Ga0075365_10466755
370 Ga0075432_10575780
371 Ga0075428_100018528
372 Ga0075428_100053720
373 Ga0075428_100099951
374 Ga0075428_101760582
375 Ga0075430_100000085
376 Ga0075431_100005357
377 Ga0075431_101159807
378 Ga0075433_10190690
379 Ga0075429_100086183
380 Ga0075429_101375530
381 Ga0075429_101538180
382 Ga0068865_101676101
383 Ga0105250_10183323
384 Ga0105240_10206218
385 Ga0105240_12549525
386 Ga0111539_10012887
387 Ga0111539_10033518
388 Ga0111539_10103493
389 Ga0111539_10693444
390 Ga0111539_10841390
391 Ga0105245_10005584
392 Ga0114129_10028901
393 Ga0114129_10033936
394 Ga0114129_10207840
395 Ga0114129_10423916
396 Ga0114129_10483265
397 Ga0114129_11164645
398 Ga0114129_11682023
399 Ga0114129_11988852
400 Ga0105237_10055021
401 Ga0105238_10028271
402 Ga0105249_10027570
403 Ga0105147_106599
404 Ga0105239_10079872
405 Ga0105239_10326779
406 Ga0105246_10583264
407 Ga0157371_10108292
408 Ga0157371_10392251
409 Ga0157370_10014157
410 Ga0157369_10003184
411 Ga0163162_10150678
412 Ga0157372_10019291
413 Ga0157372_12218345
414 Ga0157380_10415808
415 Ga0163161_10058640
416 Ga0206356_10962434
417 Ga0206354_10020249
418 Ga0206353_11074253
419 Ga0213876_10374225
420 Ga0207688_10103959
421 Ga0207645_10049346
422 Ga0207705_10084154
423 Ga0207707_10116265
424 Ga0207695_10047982
425 Ga0207671_10017578
426 Ga0207693_10941995
427 Ga0207660_10122039
428 Ga0207662_10434907
429 Ga0207657_10021960
430 Ga0207649_10086570
431 Ga0207652_10007135
432 Ga0207652_10049357
433 Ga0207694_10423423
434 Ga0207687_10057456
435 Ga0207690_10010104
436 Ga0207706_10074660
437 Ga0207706_10995237
438 Ga0207669_11080789
439 Ga0207661_10002505
440 Ga0207661_10076204
441 Ga0207679_10527505
442 Ga0207667_10345114
443 Ga0207667_10765047
444 Ga0207712_10319399
445 Ga0207668_11096547
446 Ga0207640_10267611
447 Ga0207640_10514547
448 Ga0207640_10815034
449 Ga0207677_12318036
450 Ga0207639_10238354
451 Ga0207708_10294893
452 Ga0207674_10102357
453 Ga0207675_100002581
454 Ga0207698_10065217
455 Ga0207428_10209384
456 Ga0207428_10409850
457 Ga0207428_10533463
458 Ga0307408_100420023
459 Ga0307405_10078755
460 Ga0307413_10020472
461 Ga0307413_10100237
462 Ga0307410_10018645
463 Ga0307410_10044541
464 Ga0307410_10141355
465 Ga0307410_10435804
466 Ga0326468_10007887
467 Ga0307406_10005680
468 Ga0307406_10118759
469 Ga0307406_10443465
470 Ga0307412_10105089
471 Ga0307412_10330150
472 Ga0307409_100016624
473 Ga0307409_100044441
474 Ga0307409_100398085
475 Ga0307416_100013900
476 Ga0307416_100025469
477 Ga0307416_100090052
478 Ga0307416_100820795
479 Ga0307414_10448200
480 Ga0307414_10577848
481 Ga0307411_10068584
482 Ga0307411_10413817
483 Ga0307415_100013164
484 Ga0307415_100025176
485 Ga0307415_100127579
486 Ga0307415_102156856
487 Ga0373948_0050063
488 Ga0373932_0079864
489 Ga0373939_0067838
490 Ga0373962_0029358
491 Ga0373931_0043136
492 Ga0373947_0733635
493 Ga0373925_1289262
494 Ga0395900_0353789
495 Ga0395900_0521525
496 Ga0395900_1172044
497 Ga0395898_0616025
498 Ga0395898_0941744
499 Ga0395898_0985980
500 Ga0395905_0518277
501 Ga0395905_0815596
502 Ga0395905_1319803
503 Ga0395901_0449513
504 Ga0395901_0551296
505 Ga0395901_0770081
506 Ga0395901_0830481
507 Ga0395901_2095326
508 Ga0436365_0951873
509 Ga0436362_0565002
510 Ga0451839_1050099
511 Ga0439463_004573
512 Ga0450888_025210
513 Ga0439460_0013233
514 Ga0439440_0004670
515 Ga0466964_0745730
516 Ga0466967_0007852
517 Ga0466967_0122090
518 Ga0495596_0090190
519 Ga0495596_0109284
520 Ga0495620_0056640
521 Ga0495631_0439905
522 Ga0495632_0313372
523 Ga0495637_0123943
524 Ga0495656_0456766
525 Ga0495588_0281667
526 Ga0495670_0317686
527 Ga0495589_0147547
528 Ga0495660_0275554
529 Ga0495672_0051485
530 Ga0496102_0368879
531 Ga0496103_0820568
532 Ga0496109_0610241
533 Ga0496112_0600200
534 Ga0496113_0403015
535 Ga0501031_0398366
536 Ga0501031_0760706
537 Ga0501032_0158852
538 Ga0501039_0183421
539 Ga0501040_0614534
540 Ga0501041_0125276
541 Ga0501042_0565458
542 Ga0501042_1119894
543 Ga0501048_0282938
544 Ga0501067_0138558
545 Ga0501068_0979224
546 Ga0501071_0133284
547 Ga0501071_0200467
548 Ga0501072_0040317
549 Ga0501072_1523623
550 Ga0501074_0647300
551 Ga0501075_0965360
552 Ga0501075_1012114
553 Ga0501076_0839869
554 Ga0501076_0873890
555 Ga0501076_1446452
556 Ga0501077_0290172
557 Ga0501077_0386741
558 Ga0501079_0494774
559 Ga0501081_0378195
560 Ga0501081_0955069
561 Ga0501083_0823542
562 Ga0501035_0748548
563 Ga0501045_0097763
564 nmdc:mga0yw44_266631_c1
565 nmdc:mga0yw44_720864_c1
566 nmdc:mga05p37_10033_c1
567 nmdc:mga05p37_1167330_c1
568 nmdc:mga05p37_1227853_c1
569 nmdc:mga05p37_15655_c1
570 nmdc:mga05p37_1963035_c1
571 nmdc:mga05p37_2194004_c1
572 nmdc:mga05p37_225757_c1
573 nmdc:mga05p37_950352_c1
574 nmdc:mga09592_1092745_c1
575 nmdc:mga09592_36080_c1
576 nmdc:mga09592_636365_c1
577 nmdc:mga0qj67_1024802_c1
578 nmdc:mga06r32_1556913_c1
579 nmdc:mga06r32_52160_c1
580 nmdc:mga06r32_859661_c1
581 nmdc:mga08y16_386801_c1
582 nmdc:mga08y16_4296_c1
583 nmdc:mga08y16_709104_c1
584 nmdc:mga08y16_8644_c1
585 nmdc:mga0a205_1192732_c1
586 nmdc:mga0a205_77404_c1
587 Ga0501082_0077894
588 Ga0501082_0152646
589 Ga0530510_0033221
590 Ga0530510_0205165
591 Ga0530510_0477710
592 Ga0530510_1368248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cfz-assembly1.cif.gz_A-2 crystal structure of sdsa1, an alkylsulfatase from pseudomonas aeruginosa, in complex with 1-dodecanol 0.6644 6 111
1c44-assembly1.cif.gz_A sterol carrier protein 2 (scp2) from rabbit 0.6642 3 109
2ksi-assembly1.cif.gz_A solution nmr structure of sterol carrier protein - 2 from aedes aegypti (aescp-2) complex with c16 fatty acid (palmitate) 0.6604 1 110
2qzt-assembly1.cif.gz_A crystal structure of sterol carrier protein 2 like 2 (scp2-l2) from aedes aegypti 0.6597 6 109
8iaa-assembly1.cif.gz_B spnk methyltransferase from the spinosyn biosynthetic pathway in complex with sah 0.6586 5 79
ID Description Score Start End Superfamily
4jgxA00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.6894 2 101 3.30.1050.10
af_F2Z4S3_319_422_2.170.130.30 Mainly Beta;Beta Complex;Ferric Hydroxamate Uptake Protein; Chain A, domain 1; 0.6827 27 50 2.170.130.30
1pz4A00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.6733 4 113 3.30.1050.10
af_A0A0B4K7H3_1_109_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.6616 5 113 3.30.1050.10
3bn8B00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.6597 5 111 3.30.1050.10
ID Description Score Start End GO Terms
AF-A0A7W0LIQ7-F1-model_v4 SCP2 domain-containing protein 0.9884 1 116
AF-A0A660L8X4-F1-model_v4 SCP-2 sterol transfer family protein 0.9779 1 118
AF-A0A1H6G142-F1-model_v4 SCP-2 sterol transfer family protein 0.9769 1 117
AF-A0A7K0S2R3-F1-model_v4 SCP2 domain-containing protein 0.97 7 117
AF-A0A6J4T321-F1-model_v4 SCP2 domain-containing protein 0.9638 6 118

Map